ELF`4ط 4 ((%444444HHH Ptd{{Qtd/lib/ld-linux.so.2GNUahV@c,dL)NB>(&M/8`[KZbTUY_e96H<If aW4EX 1A Qg3$^S;]O "!'2 #*.0=C:?7%PGRJ+F5-\DK(=H1;`Y /u=H0A7gM//vD7IW1{o@b*:; :Z:5/%7q:;]:C$P(W:3B5.AQ7,!OWPE E h,3L:8#q@c-:8XG(D ;b3,b=^S#(@ <:hy0uO:i4G;DJ:t?x@|ABCEFGHIJKLMNOPQRTĂUȂŴXЂYԂ[؂\܂]_`acdegUS[?[5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%āh` %ȁhh%́hp%Ёhx%ԁh%؁h%܁h%h%h%h%h%hp%h`%hP%h@%h0%h %h% h%h%h%h%h% h%$h %(h(%,h0%0h8p%4h@`%8hHP%<hP@%@hX0%Dh` %Hhh%Lhp%Phx%Th%Xh%\h%`h%dh%hh%lh%php%th`%xhP%|h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%Ăh` %Ȃhh%̂hp%Ђhx%Ԃh%؂h%܂h%h%h%h%h%hp%h`%hP1^PTRhhQVhp[US[t[ÐUPP=8t ҡu8ÉUQQtt hfÐUhL$@ÉUhر,Í&'UPP LU(Qh@RhPj'UPP&.цPPEjPnÉUPP1鰆U]2&UVS5( h(8J^\QhܶjVF9uRR`P\PC4PC$PCu^PPPhh^hQ(hh7hhjV8 uN\V` PPPPPPBSQVdu_PPhTh^h@PPhh6hhjV$8 e[^]ËRPPPPPPSQhh^h0jSSQRPPPPPP^dSN`QRh&'UPP`UWVS$Eu EE}@ET  @ D jjF  ( $ jAI.M XJT7T`@ v@@PPj/@PuO8-usX@B hD.4OU8jj jOP=LL O`BLjj jOP<jj jOP j?.{vt j*9 h-Xjʃ hQQh~$Re.XjPj PhܹǍvUWVSE=( P^ SYRXPXPXPP^`S1} (CQi~狗1ۅ~ CPD9䋇1ۅ~ CP9_8G8E9؋3u+C BCSZv$69]u֋hhE9؋3u*C BCSv$69]u֋+C t{t Pq ؋P_Ctƃ PDXCP: 5LV!L P[Q PZPXHPHX P<{X= W/{^ S"{Y R{X P {X PzXP Pz= u e[^_]A 5 Vz[  Qze[^_]A5t&C t{t P& ؋PtCtŃ PXsV뭋]u싇\9vutUP\E썴&_0G0E9؋3u*C BCSgq$i69]u֋_HGHE9؋3u7C BKCQsZCP)$69]uɋ_@G@E9؋3u GC BCCPWsXCPXCP$69]u <S" K3QZCPy$u׋,& C3P^XCPx$Ju׋w\C$t/ CPz TSDIH THNHt P JP XHX PXFP4$ut>^HUtɋC d S*z9DLD= Pe؃u SwYRwXPw$#1ҊA% ŠC1ACC=C1C=CېUSQ]{t]Ë9| C]RRjP C]Í&USP]C~ t C]PPjP ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P0C1]Ít&PPjP C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU dEPLHP@L`d]Í'UUJLBPABPBLBPBL]Ð`UV1S=`XtC0uCLX=`ue[^]à SЃ ƋCLݍ'`UV1S=`XtC4uCLX=`ue[^]à SЃ ƋCLݍ'`UV1S=`XtC8uCLX=`ue[^]à SЃ ƋCLݍ'`UV1S=`XtC뇍&E ;]%uve[^_]ÍE9sJ'USMEut[][]4t&[]Ð&USSS]jnjh$@lvQjkSh]fRPShS]Ív'UU0 vv %&]Í&'USMȊt,0Cu.t:t _t-u Au1[]É[]Í'USMȊt*0Cu.t _t-uvAu1[]É[] UVS ]ScÅtePPj:S@1t@jj jPWƊ<*„ Шt7f ffSe[^]PhSju S+t@PPShl뎐&UWVS }$W(,bDžRRj:P;1EtBCPPj-SƅFjj jS.jj EjVƊ<*„ ШtI$Eff"E U Ef 0Woe [^_]ÍvPh$Wj~u Wt@$뎉HPPWhlirUWVS(EP:ǃ1txEU PPj/WÅpPPj.VvtCPEPVjtRM SQWjtB Wy؍e[^_]ÍvEjj PV{t UtF:tA1à Wt@U 렋UM SQWjAuà wt )ȋULE>'US1ۋU t&ABHЃ v[]É'U1ɉWVSEE]߉f@f@E 9vj1C9//:%uف//:u;Kt&UF‰U9wE E}ptthte1[^_]Íe[^_]ËUEEUEEE߄uDʋU1B=wU܈EuE@E}Et_GqЉ ƒ.%uA< vu.…%I}?MAM܋EE뛃}UE)߉H øP;:tfUfBCSZ損t&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEADAFDA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$TEQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPuƃ1tPSWVe[^_]ÐU jhhiT %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSR\KC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPrN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVSu]}V4M SE)ȋu)ƍ19r e[^_]RC)XP7WP! EPEPE PC;E wKC ;E vC C$;E vC$CCхu;C(r e[^_]C뮍t&v'U1ɉWVS u]U )Ћ})NjS9s SڍBX9s e[^_])PBXP>VPIEu^C;E vCC ;E vC C$;E vC$CCхu;C(r e[^_]ÉPEPEPE PO닍&'U1ɉWVS ]u} S9r e[^_]PC)XP7WPvEE…%udC9wIC 9vC C$9vC$CCхu;C(r e[^_]C밍&PEPMQWgE D y&UVSEu] PMQF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EEE]WhEP G$PG PGPGPGXPhEPu G9EvEMQShUR;]}3ރtvPD;XPhƿEPt2C;]|͋EEEE E̿e[^_]G냋EH9tPPuVj C봍vPShѿEP,PD;XPhƿEPwEPjjhڿv믐USD@t0tf0 EčERRPEP1\ ] PEPEPEPEP(h,P (S]SQ1Z(P]ÐUSD@ttf0 EčEQQPEP Uȍ] PERPEPEP(hPPESP(P[ (Q%]ÐUSQ@]ttERPE PSx$]ÍUVSuPPVP\tKye[^]Ít&'UVSuKxPPVPue[^]Ít&'UWVSEE u]=@ Ȩ0 ;HG@9EPS@)PR*E^@);EQED Kx(EE‰EEEx2MD ÉD D D }G}1;}t&D1һ@fftD3 G;}|1;}Dž||G;}|[|E@t*f>tED|E 9D)|D)D);E }E »Ctt dd0gfffttKttU)ʉtt@w)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh0 %\4 t‹ 0 puȁ?BEU; %PEh P~E 9E%EU    Mb)ʉ  ҍ)Ѝ8  £, e[^]É@B@UE; 4; )E9FRU ؅t1Ph V0 U)‹E +4 x:tp#0 4 tpEU@BtBpUWVSEx]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERh_Pȱex[^_]ÉڹQPЉ )ʋMRhcQ花U‹EHUE%&E.P)RhghxFxEEvڹPЉ)ʋMRhkQU‹EHUEfx?ډ)UWVS}W 5L0$\0 … ШuAf\AY C@Y ;|rA D3$WD Hx4 Ȁxu t&Jx (ʀ8t  e[^_]ÉA됍t&'UWVS 1=9}-1PPEP P#u ǃ F<9|Սe[^_]ÍUWV1=19};` tF89B8~A<9|tF8t VV$uF8te1^_] e^_]UV1S9}1` F<9}"tS8t FSS(<9|ލe[^]Ð&UWVS EPjjhoήEEE 19` t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99 uP PEhP螩 MQj jh` $ EPjjhϭ~E@EPPEPCj 胫 <9cv}19} tUB4uMPVShQݨe1[^_]Í&UEPjjh2iRPEhP蚨'URR uà h Ѓu h  1ɉÐUSt'B HCЋ]á190~tLJ AJ 1҅t̓ EPx8ڋEC CEC@뒃 R(5믡P JP 1i&US]CP9XKQ/tP JP ]HÍv'UUu&B @H]]x&U jjh 3ÐUWVS }u}t<\tFGuEe)[^_]F1ҡ0DPt50MFT~~ӋM )RSPW߃듐xtFGF,F 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡ0DPuHxtVVPh 1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjj賨U PUp Pe1[^]ÐUWVSPȧ\`8`dRRj,P`t @`PPj:dP[Å PPj:CdP:UhPhjR pfDžh PdWj  PPj-SuW@jj jPjj jSÃ@=G=v)f fFV T AC T 9cPPhj! hƍ@ hRP Ffh uf fFV뎍`t`8[ \P账e[^_]PhhjP趦dfDžh<*„ Шt+DžlPPj-Sjj jSPlPdPjag dP跥tl@l?SSdQh?\ZPޥe1[^_]PdVWhPdPShQQdRhPPdPhl뤐&UVSM ut~,tt"t1te[^]û-܍v RUt,RSRPuV]SMQh8e[^]ú͍v'UPP1ɋEP89P8tEM PEPQh UPP1ҋEuËEPEPE PhRÉ'UPP1ҋEuËEPEPE Ph8É'UPP1ɋEP@9P@tMEU PQRh UPP1ɋEPH9PHtEPEPE Ph UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًMSVWQ!uƋUSVWRNt뱐t&UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًESVWPtĐ&UWVS E} u]SVWURktEEe[^_]ÉSVWEPuًEe[^_]ÉUWVS9EDžttu$@@te[^_]Í&t"@u.TT븋 @t @e[^_]H t#Q uTTgTZu Ta u Tju@@pu5LUB8jj jP<Lu2=PUB8tqjj jPP{1uu1Ciu1Cdu1Cu~5 UB8tjj jP衞 #PE PEPhXsDžtSU REPhNDžt1gu1Ciu1Cdu1Cu5$UB8rjj jP$|uG u+> E@P't{@ SM QURh6$ޛ E@P臚td@QPE PEPh蝛_3V脛ZYPW苛^SUJQU REPh@Džt {T_3V;ZYPPBXPUBPE PEPhxPE PEPhFu6=(UB8jj jPk(5,urUB8jj jP$,=@=@ h@P] SMQh,@DžtEQV u20uڋUB8jj jP茛0 u18uUB8jj jPJ8u.LRUB8tV PLuYPUB8t+ P諛PMP} WuVhh%PE PEPh1lu1Cou1Cgu1Cu+UB8tB8uzEPE P}WhH`UB8<jj jPH2PE P}Wh(] PLÅy(UrV] S1ۋMQhtDžtUB 8vU1B8UB8/ fDžxPxP|PU@ Efzu fDžz=T=XPE P}Whtty fDžxP xjnPRf듃 PDž)E@PE PEPhtt1xRjpPh܃X5`=hxQjpPhlטT5\=d PHƅtE1P RE PEPh ttBPE PEPh@ dUD8k%} tV*;uӋDDU;j4C47V] SMQh  PE PEPh0Dž  MQ:t&QPPR}PE PEPhd!Džd މPP;u鋅@ )# E(XB PX=ԕW^ܕSYRXPۊX PϊXPÊ_5\V越[ ̖Q詊Ж R膊@~ 41iu1Cdu1CMA80jj jPP``(Y9tꋍ`9`uփ WV] SMQh DžSE PEPhDžQQjSU REPjP t DžUB8PE PEPh 8v}PE P}WhH GMPE PEPh}PE PEPh1tu1Ccu1Cpu1C"A- G  `WɇM qVd@Pj蒇 `dQ}WR`Pz`dPPjEPE P}Wj5V t DžXP!ӉX6u^@ >:GvRE PEPh,DžQE MDžDžq>/ UUUU@E:t{1au1Blu1Blu1BtK1ou1Bdu1Bdu1BtR kDžlH1au1Ccu1Clu1COU JQZt-M QRPE P}WhX胿Dž VV0PEPo}_SM QURh;yt&1V] SMQh DžNE@PE PEPhDž#UPE P}Wh<趾DžE8Wu V]Sh茾Dž޿QW ?bj r EX1iu1Cfu1Ctx8uUPQ0PEP7t^} xP -}D8DžCCE8u#WV0P}PƅE FPPj(jpÉpXP讀 CP Ct8 WC  QZC$[S PDSP@UK{XDSM QURPnPPjUPE PEPjP t DžMA8jj jP~pRRjEPE PEPjP t DžUZMA8 PS}YWR% PPP~ Tjj jGP~XX?~E SQU REPhʰ Dž u~}D8tACDž?dZ ÉZDžU PPE PEPh5 DžxE }D8 Cjj jRs-- PPE PEPhT貯 DžPE P}Wh苯DžPPjGPE PEPPPw u<}tZ!ÉZJ JiDžZ-Vm g  ' YYQt$PqtRjhPrE=DžpLJ >\&UD8PPPDPU‰!U;`MYSM QURhGDž YY Qr$ptRjh-Pq E=DžpLJ> & UD8PPPDP‰!U;`fPPjUPE PEPj=W t DžMA8  <P_q}XGPp <<Po @jj jG Pyo DjPGP ?WPu V]Sh+ iPPjEPE PEPjP t DžUB8 RmpMXAPo= PnDž Ep>tW=M=GG}@;uQЃ H!ƒ t1P} WuVh =PЃ4H!ƒ4 QU REPhl褩HRRh`mP:Wu V]Sh L1V] SMQh ^ EމuC=G:Wu V]ShʨNމ=GAPPjMAP} WuVjS t Dž Qm=UG% GB8}w > Pk4$kMAZ8tr Pkà Sj ZUYB8uUPMA PAPh^S Pl $Z뗃 PYkp4$Nj WhkV VFl $q jjtRjhPk ǀ$/ t#PPj}PE PEPjP t DžE8Wu V]ShXئPPPPj}PE PEPjP4 t DžUB8  H,QkMZAPjC, Q\k }A%@A?tE@ 8uB jchtRjhPi ǀ$tuh Ph_Vht4$g EYP R@PhV Wi $ jgtVjhP'i ǀ$E P#XwN9(}*UP} WuVh蘤ً ‰;ERE PEPhңPP}PGP?Wu V]ShP蓣 DžމUD8l PhXEDPh  Pg MP} WuVhբDž WSSjM QU REPjP t Dž=t9\u LJ\EXt%uu1Cru1Ciu1CMA8txRRP\P-PE PEPh šUPE PEPh薡Wu V]Shl@}G8RRP\P轉gPE PEPh =WWE4VXSQU REPh@ Dž} GPP} WuVh菠 Dž )dRRjUPE PEPjPC t DžMq}1iu1Gfu1Gt%x8QS0PE P U PlQlh  PPjU:Wu V]Sj Q? t DžMqucP@P81iu1Gfu1Gxu?DžCk}PE PEPh~} P?Wu V]ShH DžDžWu V]Sh\US LUB8RRP\PPE PEPh 蕝E0V] SMQhfDžM1V] SMQh<z} GPP} WuVh D u>GGWu V]Sh跜޿0 )0 %1%MQ:.QjPR͓L.a#p.MA8SSP\P4QU REPh 趛WjPEpV)k.P] SMQhPhPE P}Wh>|PP}PGP?Wu V]ShP DžBމGUD8 PW`XEDP_ Po^ PPjE@PE P}Wj5VX t Dž S_B% BJP} WuVhPPMPAPPE P}Wh@衙 Dž} GPP} WuVhp DžPPj}Wu V]Sj Q] t Džtt PPtNB B>)މu~=wwxE@PE PEPh蠘DžE PRPE PEPho  1މc-=__ PPjE8Wu V]SjQ t DžRRj:UBP-Y.} GPSPS PS$@ C(}PE PEPhjDž:Q-BVVjMSM QURjP t Dž}G8e1E @P-U zWPu V]ShP褖 UPE P}WhuDž1lu1Cou1Cgu1CPUZ;t-B8u9;t }G8u%QU REPhDž1 PSÅUB 8U1B8UB8/ fDžxPЃxP|PU@ Efzu fDžzxQjpPRYI fDžxP xjnPR|Y{ PDžMyWu V]Sh虔$ZWu V]ShzDžxQjpPRX PeƅfMA PE PEPh aGPE PEPhtKIPWt^tsSSj}QU REPjP莳 t DžUB8tB8uYMPE PEPh2pMP} WuVhDžFWWj jX j}wVPuwE @PWPjSPUt(PE PEPhD舒UP} WuVSܴ_SM QURh>| hIhPE PEPh DžKPPjMPE PEPjP t Dž}G8^6 PPPCWEǃǃ_pVxP|PU@ rDžXX>xP4E|?eeHHDDU;qTRjphlPU\ dXjph܃PT`hTlPPj}PE PEPjPگ t DžUB8RRj j+U jMAPS;`jjSP EP} WuVS M QU REPh!DždsPPjMPE PEPjP t Dž}G8&RRj j;T jE@PSKjjSPMP} WuVSѰ U QU REPh1Džt{PPjEPE PEPjP t DžUB8RRj jKS jMAPS[8jjSP+EP} WuVS }QU REPhADž PPjMPE PEPjP t Dž}G8RRj j[R jE@PSkjjSP;MP} WuVS U QU REPhQDž PPjEPE PEPjP t DžUB8RRj jkQ jMAPS{jjSPKEP} WuVS }QU REPhaDž xPPjMPE PEPjP* t Dž}G8tG8u/E8Wu V]ShΊ RRj jHP jUBPSX\ } GPjOPjSP?Wu V]S QЬ 靿U QU REPh0Džs}GPE PEPhC:Wu V]ShXى PPjUPE PEPjW蝩 t DžMA8t A8}7V] SMQh={1tsPPjUPE P}WjV t DžMA8tA8uY}SM QURh詈EPE PEPhzDž齽PPj jM jE@PS [M qVMPjSPȤ PM QURhD5/SSjU QU REPjP軧 t DžMA8WWj j M j}wVPu`jjSPEPE PEPP觩 tEP} WuVhDžJ_SM QURh߆PE PEPhX賆 2SSjM QU REPjPw t Dž}G8WWj jK jEpVSu`jjSP謢MPE PEPPc 0UP} WuVhÅDžUZSM QURh蘅ֺPE PEPhXl骺 2SSjEQU REPjP0 t DžUB8WWj jJ jMqVPu`jjSPeEPE PEPP }P} WuVh|Dž鿹}_SM QURhQ鏹PE PEPhX%c 2SSjM QU REPjP t Dž}G8WWj j:I jEpVSJu`jjSPMPE PEPPե 颸UP} WuVh5DžxUZSM QURh HPE PEPhXނ 2SSjEQU REPjP袢 t DžUB8WWj jG jMqVPu`jjSPמEPE PEPP莤 [}P} WuVhDž1}OQU REPhÁPE PEPhX藁ն QQjMRE PEPjP[ t Dž5 EP:td CREUPE PEPPȣ %U:Wu V]Sh踀Dž0V] SMQh葀ϵ}PE PEPhb頵t%MA8tA8u*}PE P}WhDž>VVjESM QURjP t DžPPj jJE jUBPSZ-} wVlDPjSPPM QURhDH醴MAPE PEPhVSSjM QU REPjPܞ t Dž}G8WWj j-D jEpVS=@M APOCPjSPPE PEPhD+~iUP} WuVh}Dž?SSjEQU REPjPŝ t DžUB8,WWj jC jMqVP&E @P8BPjSPPE PEPhD}R}P} WuVh|Dž(SSjM QU REPjP讜 t Dž}G8tG8u/EPE PEPhR|鐱WWj jA jUrVP(} GP@PjSP蛘5PE PEPhD{UP} WuVh{Džް}_SM QURhp{鮰PE PEPhD{邰 [SSjU QU REPjP t DžMA8WWj jY@ j}wVPiE @P{?PjSP(¯PE PEPhDWz镯EP} WuVh(zDžk_SM QURhz>PE PEPhy ^SSjM QU REPjP蘙 t Dž}G8WWj j> jEpVSM AP >PjSP踕RPE PEPhDx%UP} WuVhxDžUZSM QURhx˭PE PEPhax韭trSSjEQU REPjP) t Dž5 MQ:tK CR< }P} WuVhwDž9Wu V]Shxw鶬UPE PEPhIw釬$ t$- t9 DRRj}PE PEPjP t DžUB8jj jMYS:} 79_ Qx:ËEZ@Pi:D$]9UzW5VhES< Dž9 @~ۋQU REPh8yv$;>MYSM QURhuN PPC tރ~ F uӡ (W;(, Q9MZËAP 9D$7}ËGPPPE P}WhtPP}PF Pm6' QRhXh^h9h^hhPjWV |/hE PEPhtDž醩hE PEPhtDž] PEP} WuVhs Dž*PPjEPE PEPjP֓ t DžUB81RRjP8ƅWPVj[7D^~8 ^h^}GPE PEPhs  S6 SPV99E XSHQU REPh(rV4XPo8M YSQRE PEPhtr x VH4麧:Wu V]ShPr鎧 V3jj jUBP'6Dž94 A~V] SMQhZrXPj7 vuDPPhPE PEPh\rq鰦 C CP_PP@ M}GPE PEPhp5:Wu V]ShXp UBPE PEPhp٥?Wu V]ShXop魥}GPE PEPh?p}:Wu V]ShXpQUBPE PEPho!?Wu V]ShXoERE PEPhoDžˤPPj j5 jE@PSM yW)4PjSP֋}7V] SMQR茑 Y}PE PEPPk8UBPE PEPhnUBPE PEPhnأEPE PEPP鷣MAPE PEPhIn釣UZSM QURhnWPE PEPhm+PE PEPhmDž9Wu V]ShmDžܢ WWj\PxVV] SMQh *mhPPP\PUDPE PEPh l}PE PEPh(l \PS̡PE PEPh dl颡RRjMPE PEPjPN t Dž}G8t~jj jP 0hGPPhEPE PEPjP t DžUB8tLjj jP/PE P}WhXk齠:Wu V]ShXSk鑠SShEQU REPjP: t DžUB8tMjj jP.3މuF=O OpPE PEPhXjڟމ?E\<.CRRj.P+ S.XIE TGR.鱿WWjE0V] SMQjR t Džerror near 'balance'Ph^hEP 6hE PEPhJi鈞MPE PEPhiYRRhj.ÅF SDždB\Z\Ad|C@MCDC@ C AP{-}XWh-VVj:P) ƅ@jj jP],1҃f0VDPu KK WtVSLPSPPST@ CXfffCN<$-Ep ǃǃǃǃǃǃǃǃC<ǃDž>1iu1Bdu1B`}D8jj jP7+=|(@\t9t ;|C苕U?Rt0u_fufftsf{{Ct%pdFpdCCÛfDž*H`AH`QU REPh ?f}Cufffwt#fx tLf@f%fIPE PEPhlef@fPE PEPh eΚPE PEPhde颚PE PEPh,:exE4V] SMQheBZ    _   MJ^ugCC@E< PP} WuVhc јd%  UD8ti P'M jj jEDP&fUQU REPhLb銗uk4Dž@4*PjPEDPY Mb:ImUD8!CCP PP|WPS\PS`PSd @ 9щChtgA=y9q)PPrD6Pj&1ɉ‰p 0~fDJA9󋅸} 9PcE|?epCC5D5DU8hPPPEPj} WuVh\_ ' RPE PEPh_  VSM QURhx_ 鶔 hPhIE PEPh(B_ 途PtRPE PEPh^9 vuACt hIhPE PEPh^ C CWLSlPSpPSt@ Cx hPE P}Wh\>^| 8UD8tbt P#} TR" P! C|DDkUSM QURh]龒jj jETR\!CÅ\;E+U z,WM1ҋlY,tl ‰l]{WI ;{uVjjK Q{=ƅ;E { WUs l1҅tl ‰l뛋E싈NP\CWWVhK]C]!uF f^ [NhG] %tCQ7RPhh<"KEE R7] RPhpJE@tEn uV=]É],MA RF7 WPhJ]CF]p R7] WPhD^JuCu;PF PU싂PhI]C6]t uG09E싘 tQ6U RPhPIE@EU싒U} (M` t71ҍu싂dFt5Dl Ɖ5D`uхt11ҋu싂Ft5D Ɖ5DuыE싀Euu~ ]]Ee[^_]PF PE싀Ph  tPi5ZYVSQu싖RPhDHE@ ?E,4]쉃tu]uPPSuV:ƅE tQ4$RU싲VPh|M tS4ZYV]䋛SQu싖RPh;RjPh|M;QjPhZ ǁ$j ] jh`P u싆|t[ty8tb]쉃x EPl= V>EY Q<U쉂tu싆|tmx ]S9MMM싁tuF\1 tP'3 WPhdrF<U쉂xQEP,RPhEE@E6P~,WShPC PE싀Ph{EE@E h4_EEEe[^_]à Pa2] RPh`)EE@E P12 RPh|E}}] tP14$QRPhRC Pu싆PhL$t&UTEPPT]ÉUEPQP@ ]ÐUMAt  9}]Ë  )Ћ]ÍUUJtH9ttu]ÍuދܐUSá $@tQ0 RPh~CXtP0YRPhjSE]ÍUWVS x@P@E9t]2 69tOZC@tC$ C$R[C$u SdLC0@6C0E@9EuEe[^_]Í&'UWVS1 tn1Qt&FtVtLX P[K$u SKS0G@S0F,t V9re[^_]ÍvUWVSƋ9t;F ƒރ FUF V ]EXZPFEFDQuPhLh^S?  F4PF$WPFxdt H`ctRPdR@`Phh^S?(hh!A}thhh!j^SBFHduP`tyFt udže[^_]hh!j떃 R@Phwh^S> 뀍t&'UWVS Ƌ9t%u9|He[^_]ËNAdu y`m  9}Ӌ)߉F ƒAFAit!8& ]VEXZPFEFDQuPhh^S= F4NPWydt Q`ctPAdPA`Ph(h^Sn=hh!|?~hh!jW@ FtYuc$ 9})É؋ É $d VЃN R@Phwh^S< Vv'UWVSËHu H@SEXZPECDQCuPhh^V$< C4PWCxdt H`ctRPdR@`Ph(h^V;hh!=hh!jCP?C xdup`tTCt&ue[^_]à R@Phwh^VS; 8&륍t&UWVSËHu߉H@SEXZPECDQCuPhh^V: C4PWCxdt H`ctRPdRx`Wh(h^V:hh!UB4, t )Ѕ$LJEe[^_]ËE, H4t)ЅGS Gx F LJPjjjƃtl94L$D E… Шu"AUfTAQ B@Q ;A D$V EH4, )…uUɉB4, u;H  LJVJH1~f QWHȉ)΍6P$]P$ M}fEƴ fEm]mƋE)ƃ , WEX4W@tJ   9!⿉WWBit=Wt:G@@t1 tn uuЋH9|~ LJVIH1 QWHȉ)΍6P$]@P$ Mh*BmE9WUBi)ًET}U WЃU, J4k)…_EɉH4, u;t&;H E5, H4)|W|uuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jhjjVy @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPVi2E#ET L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV- WxMSPQV1tJu-G tQW RPhK/]PjSV@srj t&GLE؋GPE܋GTEGXEPG\PEPV0EE[}}8PPGPh4t&A jhj jV VDF; ~ MLDDD \DDPPjV , uEH4G|, uڅtʅt )؅~ڋMQ4G tPlW SPh/Ӆv)ЅjuUB4у G|@PSjjV\ jOlEMJQRGPhZv'UWVSE(EEEEX\tCvuEEuЋ}D j$/(EEX\EU‰E Ct 2DB @B DXF @F$XEF0FDF8sHFt]ÍUWVSEEE؉uUUUU؋]عet EupeEpEP:PEjPRt UtuQPu0RUWPShuV]SE UEEe[^_]ËMtU9tShUREPdEt+ u^EuƈE UuttU SPh(EPEPe[^_]BtT tDt ubEu||EgUu€BƀUCShPEPEPjj jPIUUWVS ]u xtt e1[^_]ËS,PBzXPj WqtPPWSt.uVuRuNV8 , t)ʅ~; u7 @PPhC,@LPǃx1F4e[^_]ËC08@8օVS,ǃxfǃ@0t&C,p4߉p4ǃx1e[^_]UWVS EU@@B0EUZ,J0$E9MAD$EH0EX,CL83E uE1EEpt6CL8v̀C4%1ƉptEC4u'CuCC,C4u u CL8ЉU% = %`=@%` = `@E1ЩptECL8EUJ0vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@}%` = `@}1ptEUZ,CL8E9EQP U%%B4B8BDBDf uC:A/&Sstׅt)~t&Qqtхt)~t&ʅtt )ȅ~ʋMQ4s4t[8҉t хEʉH4EHHt˅t Љ)ȅ~ˋUZ4Ee[^_]è C4 C4Y,A)9s)Q0A,0C9C,rQ C0=K,C)9s)S0C,;Cπ;C,몉)؅' RqUZ,J0HUQQSRdt{MY,%*/&uWWQVQ:tF;ur~;}s!1F@ tG;}s 1@ u]uU)ЋS9uPRCPEP5uҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWR蜝CUM]vE U1DUDUEfDf%Ee[^_]à h룃 R'C'UWVS]u} UCM$B91@ tЋ^0))؉F4N)ȉF [^_]Ðt&B91@ tꀸ@ Ћ^()B)ػ F,9s|1@ u\)F0낐B91@uꀸ@ Ћ^ )B)ػ F$9s,1@ ur)F(g@ tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0@ tB9o 딻덐&UWVSE]UM}$B91@uꀸ@ u )K0)ȉC4{)C [^_]B91@ tꀸ@ u )s()BC,9ʸ1@ ugu )C0jB91@uꀸ@ u )s )BC$9ʸs31@ u[u )C(U@ tjB9zu tM t1[^_]øٸҸˀ@ tLB9r붍vK(u ))ȉC,} )C4C0@ tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$,:؋M)CXG9sɊ1Ѐ@ (C9r몊1Ѐ@tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB C9_1Ѐ@ H uC9 ECUX$G)ЃXGG9s WBW9r1Ѐ@ uC9r}_ uC9e uKC9P1Ѐ@ uWMA PQ: %PO)R MY$ MXMEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ@  uC9[ =C9B1Ѐ@ SOEDX9VUDX G@GDX97UDX G@GDX9r@  C9; C191Ѐ@tUXU9$_G @ V 4C 9R; 6C9;1Ѐ@tUXU9_G Mfyt tE f@ f@f@WEЍPXWG@ @؋U)ЃXG@M EY$jjSPQEUGà rG UM EY$jjSPQEUGà rG C9C9f1 'UWVS u}UE UV EG])ЃXC=^v^F XQPR7F@xWV )Ћ4 C 0 SUCCECESEE Ue[^_]֓V G$)ЃX럍t&'UWVSLE}EE \E1UMUIDM1ɋ]9EUM@,EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿L C9]s]]UZ t@MEȋUM\XDN9r&Ẻ ޿P C9]s捶UEЋMU\XDT9r Eȉ޿[ JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh` !U1D\fDf%ƅuMYUo r}&U܋U܅M܋QB9uEypу9u΋U]K0fǃ@fǃ 1 C@1@DA< PPQSwe[^_]ËEEt&MEVY SQh<]EǃXEZUPB,xLW MA,@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8, t)Ѕ~ e1[^_]á )Ћ  MbLJE))ʋM>ʉtWWjS|ZYPFLP萞CF4F8X\C$puPC$R C$e1[^_]ÍvUWVSL}GW< DBUԋU 1ۋB]ċ$E؉MEPPwVjhw  ]܃ }M؋ERjh P>] uE[]9GE01ЈU@ uqv ҉UR聶,M̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ@ tMԋ]M9sNwEƉu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjh Q蒋>E0'PEjhW!P_uUωPEj h P0tˍ&PEj h P ًUQjh R3듋u)MSjh Q̊xUB<"<, Ш^Ev'UVS]u fft>fHtUǃpPPjSZYPFPPŘC$ptu C$%e[^]ÀPC$ٍvPC\PVS^xe[^]UWVSEEM EP$ыUf@%ETTXUM EMPfDf%E܅<] f%41GD0EEUjh j SBP7 u?MAw4$M]ECHLtUM܋EM%1e[^_]Ë]C9CuыEًP I,S[0AC |AMpA BtBǁ`6EEUB[]EK ujjVS] SӾM] MMQ0‰Q0IfWf% ЉfEfH Eh @ PSh8M $hVSQeUƒ fUUz0ljz0]Kƒ ШUWVS ]}u_O1tLs$E EX EƋK8ΊEUjh j RGPS5 tUEe[^_]Ít&Gw$UB9BuҋMW Y0QI,C A|AMpA Bt ǁ`E뉋MAHLҋUBيEh G PEPh}M $hVWQ诼S0{$ƒ S0U DXMSjjPE QXjPCPƃS f‹% ЉOƒ Шu 1it&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWx|uPE SPW&UWVS|EEM EċPhыUf@%TLXMMċQfBf%Etcu}}Uf%481Bj h VWD0E…u,EE}ċMWfDf%Eue[^_]ÐMċ}}u< E‰U9ruu듋Uӊ<;t<=t<;t C9s<=u9tր;;tэKM9tljMs51SЋ 0DA u!;t}G}9us}1DA tߋUBPt&MċuuM)΋Tu9C؋Mu);[u<0ًU)ыu9ɉU ]ȋP軀 p cz Gz t}GRDPEPQ(GDCXZPGHP賝ÅMȅt P JP Su,  B @B KS:M, A1ɋt |C K@C MAP9u׉EċMt uFu}G$zE@m E} jjPEPW轷UċuJ}fV f% ЉfEċufH HtـuHt9u׉ u B @B Eĉʅɉ}GX;E}Ƌ}PVWRUċ0MIM=z}WVQR~:  Tz Gz ˅EȋUẺAA QQSBHPBMAA B @PBPEPEPE P}uNjU}}fMwtƋwt@ ~  R R h MhjAP轺 hTMăH RQ" R> J QBPEPEPE P(uË}fE؉EGt؉Gt htk EhtjXSGUWVSU}ȍt2  ,Z CZ UBRDSVQ|UBDGXZUPBHP虘DžMȅt P JP E1ɋ, pt G O@G G^\tgPPGPPxu'CF@Uċ$? 븃 h脶 hEjXS.e[^_]à RV h0<ɋ  z Gz υtZEȋUẺAA QQWBHPUċEH$H$NMȅt p Np hd薵 hd RZUWVSEEUM Eċp$f@%TLXMMċQfBf%EtiuEE]UMf%؉E1BUjh RDQEgu(EċMuPfDf%Eue[^_]ËUMEdEEE9=0ud@dE9ds%d;€, Шu1DG uËU9d-ds ;=tC;]r;]KuM9M9s=1SЋ 0DA u);t$,t}EG}9Esu1DA t׋d8$UBPMċud)΋Tu9|r9d׉ua } qB @B EąɉCUBX;E}PdWPQwMċ8u؋dv)l;,E@EEta djjPEPE P'uMuuĉMM}V0fE@}V0EE ll<Ed)d9ɉ( ]ȋ )r Fr _UuBRDWVQvMADCXZPAHPÅMȅt P JP Cuvlv\tLPPCPPsu-F=lB@-Uċ$? 6ul, 1Ʌt C K@C uEd9zEtAE E}u jjPWVJUfEM؃ EA0؉A0u9d׉llU@\UEA tuu9sE8~t @UE9rM9Mtutxu)Ή| u6ut_EPt@ ;|u9u׉uыE@mlB@]Mċu6$?u uuċx $?@luH9u%E dUEU ]MU jjSQRuĉËENufPf% ЉEċUfH fE h0MIl  z Gz ˅tEȋUẺAA QQSBHP諏 E}M @jjPWQUM‰uUq0UƉq0uf}UBv }EEUl MċEP$P$ R[ hTĭ R6 R# h茭 EhjHQ6EċMUB$ɉB$Mȅt p Np hd uhdj^S\UWVSEEM UZhf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSM }]Q,BPf@ %PBLf@ %PEPAVQh hn]Ɖ)) 9~@RPWP藓ƃƆ FuE Ee[^_]i'UWVS,MUEI0R,EUMA4R]A 9A$]sVEPSQ@+]EX@x!U JQPEPRBl$Pe M]ȋy4y4s XCE|߉|WWȋs,VS(ЃXP螛U===E}+EH$PUH$Mx],]SCJ@ ȩ!C$EMXPh1ъCfETfCf%LXM܉E؅U؍]Ћ]܋Mf%41AD0Ej h !VS能t6Uz$Pjhy!Sk Uz$EM؉MԋXfDf%E؅hU1ۋ~.Mqy\ECQVWURU9ۋMY;] ]MRPEPEPn]t,0E04UM]B4@@ǃPPjEPտ^_PEXPSFxUz$pu Pz$u M1y$e[^_]ËE@4e1[^_]=,t=-M9]]C@J06 jj}WSuV|MUƒ YtUËEЉYtI]fPf% ЉEUfH f jhy!VSMQ]MЋU܃ {tljUfE{tx$=UtDHMPTQEpu<uPuFtPPEPEP"UrF]t*C$TFNE8BU%8=8cMy$YFS Щ!t'Ex$C@ M|_02Uz$E@(^x]M   )UB |C ;ȁE9ES)ʉS;S(sCXC$C CCT3C,)ȉƉC,;M||UJUE~nSC 9)‰E DC ;ȁE9ESSXUFt :E8 uEUe[^_]t98 !1 RCTEC ; USS]S( uO BKƒK%u#C,@ t S RnC]PPjC P ]Ð&UWVS,EMELMY(|D%ƃvEԨ K0ZSK(U܋UEM؍EЉEt&E܅CXC$C C}؅h@WCPEP'<CȉCCȉE܉CEȉEC0t9vʋs,)։C0s,UЀ|t39CuKDSHS(U9U9%E}%YCAC@@CA<v E%EԋEԉEDEu(9 X~ E@uEHEEt&s,u KTCP@AST1Z PP$tCTt90MAAERRjP EԃCE)@EpF$u V}F0F0UԋuԋMuԍUԉdEe[^_]é UCr )CTpWWjQjHQjV '{0)CDCTSH{0ʉUԀ8Z49 X(K0뒋SC 9vWE)ЍxX/t&Uԉ6D3CE܁u9CCXCv);}UԉUBYЉU%tJE)@eC0ZM9NCP8BA_3vMA띋C 1ɋ, t K똋2CTtUJJ8u P׌CTEMAuEM dEPt'48 M DdQ EExx E PPEtW}%CAC@@CA<v uԋEԋUEԋEԉBB&M9MuC@CA@C@<vʋE E뽁}%}!lj}YCAC@뉋BBPPjV CPC$P$bt/28 MAACT33⡐90}ԁ}ԋEԉ訉CT MЍUSP]S, uY BStwCuS K Q?SC(S@ C]Ãu؉SPPjK Q XZjC P2C( u]Í'UWVS EM4|D<_,p uhډqEF CT C,%"=uC1, t nƉsW(Bt%B 5, Et 6EEB%"=uCL@t PP  )_S$u SwC0C0MdEe[^_]Ðt&s,% = 0PPjEP  CCT M DdQ G_GC$u SvC0C0e[^_]øE?4 W it&WW!<PDPDPEP2u 6/+/rt[stVt jDC0us,u KT7?.CL8"< Ev UWVS u~(F E^, u,%.PPEjP G u7K,u8STu1%=PPEjP Ce[^_]u˩tċFFuPPjV KC1ɋ, t WKtG 1ɋ, t O놋FMFPPjQ $WuAG 1ɋ, ttIOFFFF  8밸<U&UPPUB(:u# u%tt/PPjB P ËBBQQjB P BBPPjB P ƍUWVS u^,>  FF DC,ډ<C,CT % = *%=8C tOC,uCTt%"=V(Bt%B =, Et EEB)$^S$u SarC0C0t&e[^_]ËCTt QQjV R FFCuC1ɋ, tt K +cC1, tt lj{ v> V^2~~ F  DF dF P FFC0u{,u KT>UPPD  A @A t.XB @B$XB0BDB8@tF, B@tHB4BRjVh!& H@H (Pjjh!+,&UWVS(E#, Uu<tfEHuEHuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]á@t:tt2Cu"PPh"h+ PhjD&CS PSUSRu, HE4, U_UE PEP&%Ív'US] t P JP Kt H IH  P JP []ÍvUSP(v HPFu@C t Sֵ9DtlC$t- CP踵TSDHTHH @t X KX X@I X]D눐UWVSUBxHtUztUB`J\@Eǁ uE9}}]UU1Ett A#;EtG uEU䋎)4@E9}UB\믋E[^_]Ãt01҉Å;E Шt΋ ]놉농t&UP\@d@`@p@lǀtDBt2 u.t*t.Adu Au@AdApu]ËA`@A`Alt&U‹H`t @lJxBt]ËtBxBt]ËBpBtBdBx] UVS]Ss;StMu3SS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉSS빉UWVS}G\LJpLJppLJEÐu]w|EEt4t&1ҋCCtnEȉEuЋE9E}EuSSjMQ %LJV}e[^_]-e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwdNGpwd9tBtt ut቗l kufvSSe[^_]Ë;䍇GGlG`HG` Pίǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPS芰e[^_])QQPWNjUWVS u^\dž@wdžrdžpxdž$&CCu߉8FlFp^\dždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPW轮t&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFpFd@FFduP؅tt>9ut6.&;aiFlF`@F`O(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AlAp;B= PF UZ(B$؋Z )1dE\GGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P( VE싗Y[X)ЉVSOvUVSuue[^]Í& S表XZV )1SPשe[^]Í'UVS]SKs9tKu4t uu=vSSe[^] uu;u܃tBVp)‹FdHVpFd9u8tBtt utቖVl)‹F`HVlF` P苧ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFpЉFpFd@FFduT؅ttB9ut:2;v~FlЉFlF`@F`S )1PPPQקCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xpωxpS )1QQURP~EcCCe[^_]Ë9]e[^_]a]e[^_]aE)plΉplY P衤sv'UVSu^\dž`|džp{dž}dž{dž {dž$&CCu߉Q^\dždždždžt\CtG uCt?tHS )1PPPPߤue[^]Í붍&U1WVSEUu RtPEPj?VÃ1MC؉])u)ƋEu E3vWuVj&S?ÅCM؋U)ȉ])‹EU9EU<=uM9މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1qte[^_]Íe1[^_]Q_ v'U1ɉWVS‹E;@dhEǀMfff EǀSSQR"Y=LEEE=(t)9~%!?EЋUЋU)ЉENfG/űE@EԋE9,fuStƨ1tPEǀe11{x~#v1Ѓ9v1stыMeEK`Eɋt@uƅC,tAK4t)F @u@1ҩt t@u‰뻃 SU9C s99]빋MMK`uSdEEEF$u F(F$F بt@utGF 9w<ЅtwDžuyEkFVFF(EVF$F 맍&Ft&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC PSF @F G,t)G4tE}艇 W9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EMMUMPEUWPJQMEHxU1WttWXx;Gt| LJ1EE*;uuȉ]9_t%!9ڋC4F,tà V9F$s밉؅ExE1񋃈UpLSdA@SYWRj&Pa EPUSXKt VH9F$|]ȅt M̉EWiXUD8jj jPzUjj jDP\U(E: 1lu1Beu1Bnu1Bt"aUD8(jj jPUjj jtVU@,g1Cr1Ci1C" UB8U Bh% BhRXE@PU E@PU UB8" UB 8+U$ǂ$0 #.sPPj)VÅ9 ШU Bh0% BhW U)4ZYPV)Uǂ80UB8#Eǀ8Eǀ$EDPhl%EPE PE|Wh%܃ P$U$ESh%Qh(&Ph\&Ph&Ph'Ph@'UWVS }u]G Vt@((ttPPF PPtuԍe1[^_]ÉtC`u te[^_]ËCd썶UWVS u}]F Gt@((ttPPG PP9tuԍe1[^_]ÉtS\t Buue[^_]ÍB,tJ8dd1gu1Biu1Bdu 1Bt&#dddp LQ@pd:tjd1uu1Biu1Bdu1B jj jpDPpd:uv h\s%4@4e1[^_]jj jp@P…)4=)У4뎍vjj jpDPVjjjp|W6 p tV@PtjPpAP~u\tto(Vh)UREPe[^_]Qh)Rh*؋pLQhH*Vh*Ph*볋p\Sh+PhH+Ph+둍&'U E h+PEP%ÍUWVSEEMEU@0Ew $L1ۍe[^_]ËESMfǁe[^_]ÅZt|u PE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9`]fǃ uufdžE tFhh M lRhP*Ehh  ] dP`PEhhb u PP1҉Ehh RP1҉Ehh RP1҉EhhaRPEh hhP1҉Ehh RPAÉhh`WPuZ1YRP}WuVMQUR}W}uVMQSPh,h^W"0hhE \RXPhh U TPPPhh`M LPHPx} 'W t 'Jt(QVSPEh-h^P! uPPV1ۋ}W=}E Ux\fǂuE fdžt}fLJR}O]/utt+9|t#U]lj}}uE܅u}܋EEP9 ËH9%E] ]t EEEE?Q}E ttU } S PsPjE QR`P,P1U z\PM  ˋ$)PPAdPA`PIt{|ʋ׉ƍTP P} DS@Q<R8V4S0Q,V(STQPVLQHSlQhWdV`SQM苀PPPPPPWh.h^Qİ]VVS]S71ۃu/hhc hPdP Ehh `P\V Eh hh  _,S Ehhb G(RP Ehh G$RPg 1҉Ehh XRPH ELhhaQPp^Z1RP Eh hh_i_Z1ҍ}RP|hh ] RPxhh`u ËRPT uV|QSPh2h^W hhc E lRhPxhh U dP`Pthh  M PPphhb ] VQ1҉lhh RPt1҉hhhaRPR1҉hhu RP1x^ZQtRpVlQhRSPh2h^W0hhaE 4V0SdhhU ,Q(Phh M TPPPhh`] LPHPd\CdPK`QKtS|‰XXTÉPPQQjM  $)P(P] DP@Q<RU苃8PdPWV\Phd3h^RjM y\4(P] Vuht4h^V6 HUU)ʍuPh!h^VJU 4Z\s\^ Ph(h^Ve} E苿Wh5h^P[U^R1ۋMQ&]*PPU ЋWV PePjM `S,R'A t 'Ht(R] \PXPTPPPLPHP؋lWhVdS]苈`QRPPPPPh48h^Svp jQc${&VRLY[GB3UWVSEu} E$L.t&{ t tfdžÉufdžfdž%e[^_]ø(u(PEh8h^PdUB ~ EQhh^P6džpX]ZSGPP EF$puPF$u F$=fdžyUSh8h^RXEZPW 1҅fdž $ )Y <E( PLRPPPR@ P0P,P4R8P(uP<EP1҉Rщ1񸉈RQ1ų RE.R(P,PPPUBuAMPhAh^Q`tBP SSuRhEUHQh Gh^R@QQMh^QRRP uRhL MAPEhPGh^PUB ~AOL SShuREMIQhGh^P PPP uRL uRUE@PhGh^R MY P EPUE]HQhGh^RS h Hh^S@ XZSW 1҅(fdžfdžA&PEPSVt 1MEQh(h^P XEZPW" 1҅ e[^_]èRRL hP uRMUBPhTIh^Q%MPh(h^QV Phh`Q <EUWVSEu} E&$LPPEPGPPfdž  $ )fdž(fdžfdždžfdžt9-&{ t tuAfdžÉufdž77e[^_]Ít&PjSVu1݋뀍v  $ )Ѩ0 P,4PLPPP@ P0P8SRP<P<1QRf1󸉈QR1ųU RE.RP,UP(PhIh^R& XEPWy1҅]UPPh^RQY[]SWE1҅ t&'USP]xt]PjE PSmtǃx]Í&UWVS\E }(jxt e[^_]Ðt&uEEt&E fLJLJxe[^_]ÍE;Ut BUPB4PC,@PC,PhJh^VS,J JPh(h^VgS,J8Ph(h^VCS0JPB4PC0@PC0PhJh^V S0J ePh(h^VS0J8!Ph(h^VSHPK@QSDRC4Ph(h^VPCxPC|PClPh)h^V]SJ4 :Ph,)h^V6CP$Phh^VY^uVU ReÉ GC PSh4)h^VC f@% *PCH8Qj )PZYPC@0PxPhJh^VaS,JQhB, )PT S,y@DPhA)h^VPPhB4 , )PPh, )R XPh, )R t&QQhB8, )PQQhB, )P{QhB, )Py S0!QQhB8, )PVQQhB, )P6Ej4PPjffO)tRUCPCPQRhV)h^V E fLJE LJxxEj4PPj mffbPPVU BPP/‹ EfLJ%C US Sf9A&UWVSU (]xte[^_]Í}EhE<Uptt2}x9`ttG9`uoEUt;AShJh^h]QXZhSE P UEǀǀCvTUǂ} Eǀxe[^_]Íl$t]뺋}t;pt&hUYPxlpl^{ 9t+RVht)h^hPt ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡ0DP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM Q{}xމt;XN\L\El9Zh\hhSZXËDxsh^XDDȋhrD^ZDret]ߋ4nPPWE @PP (ǃǃǃ}E|WWP|Pt[^JMb)RMQUREPElPEPEPh@Kh^hPat0fz]j.St$Pj BMt G PGPGt|R~)tRtB`WBVJQSM`RPhdKh^hP@PPhWu V ]ǃtGh G@GpÉxHut G PGPGt|R~)tRtB`WBVJQSM`RPhKЍ] j.SPjzM%fǁǁxvUh耹ÐUWVS<1] utKt:EEEEtUfBfEڐt& jhjjV t5EQjPVx 1҅ttR1ҍe[^_]ÍERjPVɃ jhjjV 2 E܍UȉEfEj EREh ,fEjEVE\ @t Ej Ph ,jV@ @H@UBE jhjjV Yt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %PÃ94PhjS@f jhjjSI @H jhjjS+ @F jhjjS Fr-P@ PF PSӿ@WWuPS @F DC; ~ DDD DtDDUE…%u Ee[^_]PEPEPE PEEEM S0EEMEEM놃 W2@$WjjS製 @EEME jhjjSp @p jhjjSR @REENE=& jhj jS ELEEE MEMEMM&UWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]ÉAǁ`ǁ@] UMyt]ÉDADHǁǁ@@H] UWVS } u FPPW8 , t )ʅE‹XTt&uMVBT9tGCt: EPjVRCPC ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF0@@G4@@FX\F$pt@u F$1e[^_]Ë_8ۉuF@Pt, tG81рPF$븸G8t&UWVSEEX;6MlDM%ME9MUZE8t#LME8E1ۋP %itֿx8PQE0PEP^@Å9@tPPPhSCtH SM@puaMRQhDNEP}W莺E VVjjMUP XQXPAXʃTEe[^_]ÐE9E*MtEP:tESjPRE( tQU RPMAPPhNEPEP̹E ;M%u#e[^_]1Bfp1BfUPhiM})ω}uVEPj뵍( tQLh0URPMyW1Vh(EPEPe[^_]ËMYPuUEBP1( tQU RPMAPPhN뙡( tSZUYWPM1VhN]SMQ膸( tQnU RPM9WqVhO븋M tV=UZSMQPBPPhDO냃 SUShOoU tWM^Y SURPAPAPPhOEPEP SE8WhOM tWU[^J QMRPhO&UE Ut@,u1]Ë@B |]Ðt&UWVSE tx,u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9EE~x11ҊCS1҉E1CS}B=G_(؋O )ȃX9}9|EU@ |o]C X~1CE Uh`$$Ќx$ 4ÐUVSu] 9t"u'tC @C Cu/e[^]ÉBJ I J udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@8S4FEF,@Tb^0CT@N,t P JP t x Ox ]EHtU싂H IH Exx:Ex4tGU싚t C tCP JP utU싂X K8X Et H IH Ut P JP Et x Ox V~9׋u AًBABR tA BQ J9׋uŋF]BF 0p Nۉp t Uz e[^_]ËU싚t C tCP JP uU싂H I8H v࿉F$FK$S4I҉K$C,t S9C$ W P^0 Po P/CVQQjVpP  Q9<EZP)<X P<X P<X= W<U^S;UEe[^_];'U     jhhZ9 %ÐUVSuF,tTPH@D+ t,FV`d9t `duqF0tfPH@D+ t>FVhl9t hlttx[^]lp끍&'UWVS ] uC,K(C@A  up t^ )Ћ  MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QMS01uC4CC01^'UWVS u} t F$@F HF uQF8<G_0uG0, Ge1[^_]ÅFt48듃࿉F$C$HC$F HF pO0t$(F(,tS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@&S4C,t S訽9C$s PѿF$F$G0_4C6C,t SF9C$ QktCtVGOUWVS } uG,_(EF@unC(^{]Ft }T tZFV@r!tEQjW RUBL@ PY*C4C(XC4{Wv,dž  E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$ )Ћ  Mb<))ʍe[^_]Ðt&C,@u kU CSS$SC0 C0 3] ue[^_]Cj )Ћ  MbC<))ʍF(, SS$SC,{0uC0 B V֤a\ L`L]9\A@AP;XXF@CCF$=p{{] ue[^_]LC,@u u F@ )ȋ   )ѺMbC<)ʍSS$SC0$(S{0C0@{4tX\  L`LM9JAJP;XvXt$(F(,tAW4ut0Gt*G,t W39G$s W\ SS$SC, )Ћ  Mb<))ʍbuY)ƉHtHAEALJMM)Ht!BMBLY뺋EBލt&UMQ$u!AluAX\Q$]ÃtwQ$Q$ރt Q$΁Q$ÐUWVSEp@@0 ^,N0$E FDMF F| VlF N0~ ^,CL8 CP8Q ;E uU1UEptACL8v̀C4  %1ljptE # C4u u CL8 uC0t T gЉU% = & E%=%`=@%` = `@SP:u"t%=%VlBwf^lt&JFlQQPVVl~u.tϋ@tF%tPPFlPVVlt^,E1ЩptECL8CP8EN0t&E7 uE1؉EEptAALڃ8v΀y4z 0%1ÉptE A4u. u&AL8vA9A,sA, uA0= u;A0t4T t+90~VFz@ E% = %`=@%` = `@1E1ЩptE^,CL8CP8U9Es@-AP8 JF@t F$AP8^,CP8x N0F4F8FlFpFDFDF|F|f uCAS{}tUt )~}Qytхt )~EʅtUt )ȅ~ʋMQ4{4t[8҉t хuEʉH4NHt˅t Љ)ȅ~ˋMډY4t˅t Љ)ȅ~ˋEX4Ee[^_]èC4C4C4C4C4,90VFz@ unb UC9C, "C0=K,C)9s)S0C,: -Y,A)9s)Q0A,C ' V觤t`Vlf SS$SC,C0uC0@Fl $QQSVЃVl )Ћ  MbFlEG))ʋMʺ V1N0rCP8F@ N0 E@C,e)؅x^lPPSV~l^, Pm^,t PmTVy[N09PPSVt^,aPPSV ^,PPSV>t^,7PPSV tЋ^,)E@ APPPN0Y4 @V$pU0V$VXN00*PPQVQ<N0 ALPPN0F$pA4N$@N$VpXN0^,V@qWWSV^,VlB ^lS$$F04t,0^,C4F0@4F$pu@F$f F$Yt ALPPN0Ad APPPRV$p V$VXX^,C42@( CPPP^,Ѐ@ CLPP^,F$p5C4#N$ N$VX^,(V$0V$D F$@t ࿉F$Z$KZ$QQjVFtAS4ut0Ct*{,t S葫9C$s Q躭^,$ B -F4 ^4SVL$VP$^,C4F0@4tF$pu F$[ F$N&F$ F$t CLPP^,C5 CPPP#t~l ~4 YN0^,CPHFIF$tFJ@ H@ @r )Ћ  Mb))ʍډVlX|t+F$ u%F@tF,PH@D t V V]Ex t! P&U9Du DMq$t4 ȃP%MTKHQDTHMt MP JP XHX1v F4P脦Fl$y^,¯uC , t )ȅz/uC , t )ȅhuC8 , t )ȅSN0¯uA=, t )?/uA=, t )A8=, )uht(dt)V$V$F$F$/t @7pF$@F$0atWWCPf@ %PF,@Lf@ %PFSQh#PhPhj/+|~8PPfFx%PfF@%PFPWh>Ph|Phj謒O~p;PPfFx%PfF@%PFPPhYPh$PhjTPPSV7F$0t&US E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]Éȋ@fG뱐UUM Ѓ L]ÍUU E L1]UU E L1]USUE уL %t []Ít&'USU EL t []ULEP]ÍUWVSE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$TE @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP贬%Ðt&U$EP $]ÉUEPQP@ ]ÍUWVS u }PPWCP]}t9ue1[^_]Íe[^_]UWVSj(EP|tu=  tSu)E_t:QUsREPCPWu CU<tCu΋? ue1[^_]Íe[^_]à EP~}r&USRË@tS u CP[ SO]à P҃C P5؍t&UWVS ǍX@09uG __uGHIHe[^_]à PGHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjjqEtU؉PJEAJMA AAAWWj(S{tV@EQQj)PzRRNjE)ǍGPj~ÅPWEPS}E܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjjn]t) EEj Sh ,jPj 1@tЋ]i]81҈ƒUUM Ѓ d]ÍUU E d1]UU E d1]USUE уd %t []Ít&'USU Ed t []UdEh]ÍUWVS,E EE9Ed h=`U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;EmTu=  1ۋ=`PESPWfY^PES1ζU;u%t1t&`|u FU;u%uӍe[^_]ËEH dE؃t|t؉ڃ ht | l`DZ FST Ju , E f1)ЅM )CM  SQ&'UVS4uP j-i`t\PPSjidt5PPSjiht e[^]à dPh `Ph1F8Ѝe[^]Í&USh]PhXdPhY`RhC8]U]ÍU  |)A ` ǀ` B4CB8B,.B$-B(.B p+B`*B*B *B@+B@+B*B+]ÐUSQ̀Ãv dۉZ[]É'UxMʃɋU B]!Í&'UWVSEtE9El5xUupU1ۋuǃuɋ9tR0=tɃ̀Ãvcۉ5tu]EC]9E`t[^_]Ít&'UV5lSӋu%tp@t ؉[^]ÐUWVSSE] ƉEC<x1uEx ى Z[^_]Ít&'UWVSPE] ƉEC<x1t!E'xB(@B `9B0@B7B08B08B 8B8B 9B@9]ÐU=@iEhjjEV‰@tFEPh hjRR u 1"t&5@NQ@ÐU5@(Q@UEEPh hj5@RÍvU塀 ÉUj uhj5@pRÉUj uhj5@LRÉUE=t =t!v5D5DU0WV}VoP…uEPuQjSt&jEPRQEut1e^_ÐU)tu tj PD1ÐUm5D{SÐUEM DBJh1ÐUSUM ]DHXh1]ÐUWVSE} WXʉȻXtzt80t1@80t,@80t'@utttu߃@@)ȍp} tUE xtL؉ڃtzt80t1@80t,@80t'@utttu߃@@)؃1ƅt7t9rU BPSQhXEPRGPQURdRED8e[^_]UEP Љ]U S]Eƒtt t@tjEPEPEPRE P+‰ECtjjReC1 E@V]]ÐUWVSu }UMEE@ |tE@|t1>t: wUU- P*NEEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQP9sUډ@C9r18}t MQOF w$X p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1sbEtq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸsbL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿsbL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$d~1ۊY!#E9t]υt=0q1A1ҊQ 9At1t10q%뎉[^_]ÍvUWVS1]1O~PP$eE PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At10q%`FW1C1ҊS ƃ>FC4M!1̓w3$g1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊq0qL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ q0qT$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$0gS!1C!̓w$0h1BR Ѕ~1(jjj10qPÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸ZNju =Zt3%9uxYVPEPF uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$PhEU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0RZ}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$Dj1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCS<6T`MMT~`U(RjjTQtWTVP5`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Q6` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q66` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP3E`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$\jEPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71Bsb%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}sb@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSPi0 u @CRQ V1D;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW0 t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM11sb1ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$$kE%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEwMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $ljE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$xmH@vP@t<)u担87DžRt#sbH@%u㋅8) PB<v?t { 5sbB1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WЉƃ؅uDžM ERCP~NF fF(ffVffNfF}wtSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:V ЋU+M MH}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$o]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB P%C MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh U ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PЉEupEEMP EPRQ UM$ ABLErLPjURMQEPURCPV u'EMA`Up9R ]Ex`UH EPRQ 1C1ҊS à ;AoEUB`Up9&R M ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ<[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE ooDž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžwE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\Invalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789: @*3=I T _is{@@ splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerpersistredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledenabledhealthbind-processevenappsessioncaptureretriesblockunlessredirectlocationheadercaphdrprefixuse_backend(unknown)optionhttplogtcplogclear-cookiecodehttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForrewriteindirectinsertHTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 default_backendredispHELO localhost EHLOHELO%s %s drop-queryrealmhttp-checkmonitorfaildisable-on-404backlogfullconngracescopenocachepostonlybalanceserversourceusesrccliexpreqrepclientreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionclientipenablehide-versiondomainredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackintefacehdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : '%s' expects 'code', 'prefix' or 'location' (was '%s'). parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). Maybe you want 'fullconn' instead ? Maybe you want 'maxconn' instead ?parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots or does not start with a dot. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracing: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracing as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled againCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPHTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)timeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. 6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket. Aborting. Invalid name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket. Aborting. error when trying to preserve previous UNIX socket. Aborting. cannot change UNIX socket ownership. Aborting. socket(): not enough free sockets for UNIX listener. Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener. Aborting. cannot listen to socket for UNIX listener. Aborting. cannot switch final and temporary sockets for UNIX listener. Aborting. cannot bind socket for UNIX listener. Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE`HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. a1h!!!!!u^UnK`8V?(HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession:calloc(). Not enough memory process_cli():asession_temp->sessid:calloc(). Not enough Memory process_cli():asession_temp->sessid:calloc(). Found Application Session without matching server. Not enough memory process_cli():asession:calloc(). Not enough memory process_cli():asession->sessid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valpathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/; domain=%sCache-control: privatesrvrepsrvhdrConnection: close: %d.%d.%d.%dclireqclihdr HTTP/1.0 : %s /Content-LengthExpect100-continueappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓NOLBno checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,OPENFULLSTOPactiveY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,%s

 text/plaintext/htmlunlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max, Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,%lld%lld%sBackend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%sDOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy version 1.3.20, released 2009/08/09

HAProxy%s

Statistics Report for pid %d

> General process information

%s
QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits : memmax = %s%s ; ulimit-n = %d
maxsock = %d ; maxconn = %d ; maxpipes = %d
current conns = %d ; current pipes = %d/%d
Running tasks : %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.20 Release_date: 2009/08/09 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: ta۪eS7Mreq_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endQQ'Q-Q:QSDQPQGZYQG^QbQ@gQoQ@tQ}QxQ@}QQ@QQ@QQ@QQQQc!Q_QQQR\RLR\RRccccccc!=====Q)@parsing acl '%s' : matching '%s' for pattern '%s' is likely a mistake and probably not what you want. Maybe you need to remove the extraneous space before '('. If you are really sure this is not an error, please insert '--' between the match and the pattern to make this warning message disappear. Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_spliceUVV V V      XsXWXIX;X-XXXWWWWWWuWbWUWHWmatch failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6dqGqGxGjGxGjGxGqGqGqGcG:;<=>?@[\]^_` YYYYYYYYYYYYYYxdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error _HHHHHHHHHHIIIIIIIIIIIIIIIIIIGIGIIIIIIGIIIIIIIIIIIIIsIIIIIIIIIGIIIIIIIIGIIHKKKKbKbKbKbKbKbKbKbKbKbKbKbKbKKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKbKOKbKbKbKbKbK!K!K!KbKbKbKOKbKbKOKK L L L LELELELELELELELLLBLBLL L L L L L L LLLLLLLLLL)LLLLLLLLLLLLLLLLLL)LLLLLLLLLSLSLLLL LKKKKKKKK LKK LLL LKLLLLLLiLiLMMMMMMMMMMMNNNNNMMMNNMMNNNNMNNMMNNNNMNNMMNNNNMNNNNNNNNMMNNNN&N&N&N&NNNMMNNMMDRjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjRjjj"aDR~YYjjRjjjjjjjjjjjjjjjjYjjjjjjjjjjjjjjjjjjjjjjjjjjjSijtRjjjjjjjjjjjjjjjjjjjjjjjjjjjjOYDR:VVVVuVXVlbflaffffafffffffeeeeeeeeeeaf{b]bbffffbffffffffffff~cfe=p=pPpPpPp=p=pPpPpPpPp:pPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPpPppPpPpPpPpppPpPpPpPpp&t~~~BxG}1t1t~~&t~~~~~~~~~~~~~~~~1t~~~~~~~~~~~~~~~~~~~~~~~~~~~2ur~&t~~~~~~~~~~~~~~~~~~~~~~~~~~~~u;;u<9u6u3u0uZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x; 1<2hzR| (p- (Hd. W`P.p6@$  h W |8o<ool’Ғ"2BRbr“ғ"2BRbr”Ҕ"2BRbr•ҕ"2BRbr–Җ"2BRbr—җ"2BR ('``:>BFJNRVZ^bfjpv{p @PP@S``p@p     unix_streamnlZ`b0`@OPPPGQ`Q0 OQQ0 X R_0R0 c0R` k0R s0R0 {0RP0RpR `RPS!0T0 T 0T` 0T 0T0 0TP0TppUV0T0 T 0T` 0T 0T0 0TP0TpUW0@W0 @W 0@W`  0@W  0@W0  0@WP" 0@Wpt4 pS"0Y"Тc"p"0*^v''''''''''''L@L0pLtcpv6  Z`b@ж@@tcpv4Z`b@жQ   -Q   R     ((jbVbAb baaa@aa````@``___}_e_G_*__^^^^R^ ^]]]`] ]]\\\`\B\'\\[[[Q[ [ZZ<<QedAdAP<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&@-ic9-$-c$CpBDD$ c$J|BcIDK$"c$RBcQDS$"d$pBdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$CDDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$lCDDD!D(D7$;d$CDD $d$Cdd DD DDDD+D/d@d@d@/$/e$Cdd #eDDDDDDD*D1d@d@.e@d@1$19e d%Dlibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)5 8@9`sIM@KЌ'P`v0!@t 10QЍtPyЪRb Ľp"WNRi~nR6,(_Vpl\ /4"=#^EC0%K)S`*h`/ 7q F#5+display_version-+display_build_opts?+usagee+sig_soft_stop+sig_pause+sig_listen+sig_dump_state,dumpG,init@.deinit1run_poll_loop1main3global4progname4pid'4relative_pidF4trashX4zeroj4one|4nolinger4stopping5UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)8%a2base64base64tab89HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_auth&stats_set_uristats_set_realmstats_set_refresh>stats_set_flagstats_add_authHstats_add_scopeTM3C%ultoa_r%strlcpy2%ulltoh_rF&limit_r&str2sun&ishex'invalid_charE'invalid_domaincharn'str2sa(str2sa_range*str2netK,str2uic,url2sa.encode_string/str2ui/strl2ui0strl2uic0strl2ic1strl2ircy1strl2llrc1parse_time_err2my_strndupw3itoa_str3hextab! init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace/ buffer_replace2 buffer_insert_line2 chunk_printfT buffer_dump pool2_bufferЌW-&Alert'Warning'qfprintf$(get_log_levelz(get_log_facility(send_log+tcp_sess_log,log_facilities,log_levels-monthname(-sess_term_cond?-sess_fin_state'p+$__task_queue %__task_wakeupF%wake_expired_tasks'process_runnable_tasksf)init_task*nb_tasks*run_queue*run_queue_cur*nb_tasks_cur+niced_tasks+pool2_task*+last_timerN_tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnr!S > get_pipe kill_pipe put_pipe pool2_pipe pipes_live. pipes_used@ pipes_freeRt  '$exp_replace%check_replace_string%chain_regex&pmatch1i.warnifnotcapj/warnif_rule_after_block/warnif_rule_after_reqxxx0warnif_rule_after_reqaddr0warnif_rule_after_redirect0warnif_rule_after_use_backend"1warnif_misplaced_blockx1warnif_misplaced_reqxxx1warnif_misplaced_reqadd$2cfg_parse_global9init_default_instancer9cfg_parse_listensareadcfgfile*dcheck_config_validityfcfg_register_keywordsgcfg_unregister_keywordshcfg_maxpconnhcfg_maxconnisslv3_client_hello_pkt06%|$srv_downtime$srv_getinter/Q3,process_chkf1start_checks'|$srv_dynamic_maxconn$init_pendconn$pendconn_free%pendconn_get_next_sess7&process_srv_queue&pendconn_addx'pool2_pendconn06p+get_frt_addr+event_accept R2(proxy_cap_str:(proxy_mode_str,findproxy3-findserver-proxy_cfg_ensure_no_httpO.start_proxies/soft_stopx/pause_proxy/stop_proxy/maintain_proxiesE1pause_proxiesx1listen_proxies|2proxy2next_pxid2listeners18'uxst_add_listeneri*uxst_event_accept-unix_sock_parse_request/uxst_req_analyser_stats1uxst_process_session8unix_sock_usage_msg8unix_sock_usageĽd}.init_proto_http.http_header_add_tailb/http_header_add_tail2/http_header_match270find_hdr_value_end0http_find_header21http_find_header2error_message3perform_http_redirect4http_return_srv_error5http_sess_logX7capture_headersS8http_parse_stsline:9http_parse_reqline3:http_msg_analyzerR<http_capture_bad_message<stats_check_uri_authy>http_process_tarpit+?http_process_request_body@check_response_for_cacheabilityAproduce_content Bapply_filter_to_req_headersCapply_filter_to_req_lineCapply_filters_to_request6Dmanage_server_side_cookies)Fget_srv_from_appsessionGGmanage_client_side_cookiesIapply_filter_to_resp_headersJapply_filter_to_sts_lineKapply_filters_to_responseLdebug_hdrLprocess_responseOhttp_process_requestapool2_captureapool2_requribhttp_is_ctlbhttp_is_sep5bhttp_is_lwsMbhttp_is_sphtebhttp_is_crlf}bhttp_is_tokenbhttp_is_ver_tokencHTTP_200chttp_200_chunk-cHTTP_301?cHTTP_302QcHTTP_303ccHTTP_401_fmtchttp_err_codeschttp_err_chunkschdr_encode_mapcurl_encode_mapdhttp_methodsdsess_cookiedsess_set_cookie"/'splice(stream_sock_shutr(stream_sock_read+stream_sock_shutw:+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv-stream_sock_chk_sndNR1,O&appsession_task_initw'appsession_init'appsession_refresh(match_strR)destroyw)appsession_cleanup(+pool2_appsess:+apoolsL+have_appsessionI~M+recalc_server_map-init_server_map"0fwrr_init_server_groups6fwlc_init_server_tree 7get_server_ph7get_server_ph_post8get_server_hhb9assign_serverAassign_server_addressAassign_server_and_queueBconnect_serverDsrv_redispatch_connect/Fbe_downtimeYFbackend_parse_balancew'|$stream_int_check_timeouts$stream_int_report_error %stream_int_return%stream_int_retnclose"5,print_csv_header -stats_dump_proxy.stats_dump_httpg/stats_dump_raw/stats_dump_raw_to_buffer+0stats_dump_sess_to_buffer;1stats_dump_errors_to_buffer(6d,tcpv4_bind_socket-tcp_bind_listener.tcpv4_add_listener.tcpv6_add_listener/tcp_inspect_request%_4&sess_change_server&session_free(init_session(session_process_countersM(sess_update_st_con_tcp)sess_update_st_cer)sess_establishU*sess_update_stream_intA,sess_set_term_flagsf,process_session/3default_srv_errorQ4pool2_sessionc4sessionsVAhdr_idx_add&$signal_init9%signal_handler^%signal_register%__signal_process_queueN&signal_queue_lenp&signal_state&signal_queue&blocked_sig`\<*acl_parse_nothingE+acl_fetch_nothing+acl_match_nothing+acl_match_str+,acl_match_reg,acl_match_beg,acl_match_end-acl_match_subR.acl_match_dir.acl_match_dom.acl_match_int.acl_match_ipJ/acl_parse_str/acl_parse_reg)0acl_parse_int2acl_parse_dotted_ver4acl_parse_ipM4acl_register_keywordsz4acl_unregister_keywords4find_acl_by_name5find_acl_kw6parse_acl_expr6prune_acl\7parse_acl7find_acl_default8prune_acl_cond 9parse_acl_cond%:acl_exec_cond5;cond_find_require[<filt_cap<default_acl_listr&|$create_pool$pool_gc2S%pool_refill_alloc%pool_flush2%pool_destroy2&dump_poolsI4read_freq_ctrifreq_ctr_remainnext_event_delay.=feb_deleteeb_insert_dupcEC[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)K-check_cttproxy_versionOO__udivdi3F`O__umoddi35({0Ea  "0 #[@;] &tc 5int 60 >Ee ?EJ AE3 C Di3 GPEjg S U@  01 %-<- %->&#/& #& #Z & #  &#&#O&# &#z&# &#$&#(# &#,E&#0(&$#4.&#8&#<&#@&">#D &#{#F@&$*#Gb&(:#H&1#L &7/#T\&8/#X|&:#\!&<@#` / &y & &#  &$# : &#< :  P 3gBLGQiFr "D "E# "F# $S >   # #  + J # B #  +# ; wgq 6 7#o 8#2>40Yg? rg  p# !ڰ# }# f ܓ#  # 7 5$kC$t $v# $x#h n h#p h#C  - C#ref !h#0U4 w x#  yC#  z0# {0# ' |0# r }0#  ~0# > 0# - 0#$ u 0#( @ c bc# ss @ ~H#s#s# bit#u32"0~* +y#key,#r H0wq1#rq2# ~ 3#0 4#4 50#8 6#< 7/#@ 8#Dr!  R# # # [# C#2 R# #B)8(H ~ (I0# " (J0# s(K/#fd(L# >(M0#exp(N0# _4(O# 4(P# K4(Q# 4(R#$ib(SJ #(ob(SJ #, p (T0#0 (U/#4J  (S >!}0#rex!~#wex!#rto!# wto!#cto!#l!0#r!#w!# lr!#$ >!0#( !0#, !0#0 { !0#4 @!#8 (!3 #< !7#@ !7#A !b#D J!#L !#P !? #T !E #X y /!tstr!u#len!v#  J  3 h !z )C# L)C# )# )#fe)| #be)| # )# >)#$ R )0#(req)J #,rep)J #0si)"#4 )# m$)# )#srv)H# T)H# I )H# 6 )"#txn)# z )# ) # )"# 1)"#  )‚# )Â# $)Z"# )0#y 9 V ] Ln y  # ! # k auid^f#gid_P# }`[# buxa  LfdM# ~ N# LO# >P# Q# R# 4$S# T0# U# VC# s)W# @X# &Y# DZ/# { [0# b # I)c# TQ um# n# Ko# p# q# r# s#$ %4t#( <5u#, v#0 w#4 _x#8 $y#< `zC#@ ]{#H |C#L    8CfA#bBJ #&(?cbC# sD/# ~ E7#evF7# G # H# I# J#$   J  #get#put# u# s# <_ D`/# ?a#setb#clrc# E@d# }?e#remf'#clog'# :4hD# j8iZ#$ FAjl#( $kZ#, FlZ#0 um#4 n#8 '>>-Z>Jl>` a ^/# _%# c`%#ar]+ ,# -# .# S/#  /4 h# A#;;/-,8len,90#cr,:0#,;0#F ,Cv,D#  ,E# ,F# ),G# 2,H# G"+    < ++l+ݔ#m_l+ޔ#u+ߔ#u_l+ߔ# v+#v_l+#+l+#v_l+#c+#c_l+# r+#r_l+#+rq+-st+D+ H +0#sol+#eol+#som+0# col+0#sov+0#eoh+0#cap+#sl+# +b#8 +#@<+ 2+"# F+#  +P #req+#rsp+#\uri+# +# +# BH+# >+0#s.E  0# ^ 0# 0# g H>I JH# ~ K# " L# M# N# O# : P# q'R| # S# T#$ - T#( 4$U0#, 6U0#0 lV#4 , V#8 W#< lXC#@ C!Y#H >[#L T\#\ O>^#l `#| oa# b# @dH# dH# e# g f# og# h# i# ;i# #j# j# 6j# k# Tl# Fm#ido# p0# Z p0# q0# r0# ms0# #t0# Vt0# gu# v # hwH# yt# yt# bz0# {q# }t# }t# ~t# ~t# t# &<# 0# t# t# t# It# M#| q'hDR # # G# ~ # L# j# }# # :$#,aclC#0 {C#8 C#@ C#H =$#PsrvH#\ ] #` 7 #d ` %#h Y# R # Ĕ# # Ɣ# 0# Ȕ# _ɔ# S# ˔# J ̔# # Δ# ϔ# # ? # RҔ# /Ӕ# -y'# # ֔# C# &&#id# lC# l# , # # 0# w0# }0# 0# <# 0# #<# 0# t# yt# t# 4$0# 0# X0# # r# # # # # 0# # 0# b0# q# t# t# t# t# t# t#! t#t#It##cap#T#O># #o # | #e  ##m  ##J {# {#x### # #u##:#h ###R#'#U'###]#'# '##o ##'#5  #!#"0# #0#>$>$#2$>$#HNH 3 * * C# *! #srv*"H# p!D) )# )|# )|# ')|# )# )#  )#$ 1%)[#( u )[#, ,)[#0 )t#4 I)t#<!)px)| #sv)H# )Ȃ# <)Ȃ# >)0# iid)ʔ# H)ʔ#sid)ʔ#! ) )n#Z")iid)Д#px)| #buf)0#sid)0# ptr)Ԕ#bol)Ք#")!')p!!)!!)! "  " "" "H"##acl#*#+C#u#,#)B#-C#  #.##/0#"#OB#>#?C#_#@C#pol#A##B0#-#C##p7!>4un5V in6#p2u7##>$p ,z {H#t0|H#t1|H# j8} # ~ # # (#$ #($ |#len0#pos0# sid0#srvH#oe| #src#bufE #$be| !u$  0# <C#2% srv2%# # ~ #H]%Xact##bck##,%actH#bckH#q& # I # # # # # 0 # H#map$# 8%#, N]%# L }&# 6}&# I8}&# '}&# }&#}&Hq&&  ٔ# 2ڔ# %8۔# 9ܔ# >ݔ#  ޔ# Tߔ# C!#y'-  &# '# z(# 5)# >*# -+5)# ,r)# -y'#&'  '# u# Z#len # @!# D"#' ' (P #)(-$+| $u,c(8'(C#C)c(#be-(# )#(p(01C#C2c(#H3# 4#%5#6#>70#8# 9#$5)  5)# # #(r)  r)# # ?#;))-R ;-N# -O# L-P# -Q# ++ -;uid-<#gid-=# -># 4$-?# $-@# -A# -B# Y-C# }-D# `-E#$ -F#( 4-G#, '-H#0 J-I#4 -I#8 x-J#< -J#@ -K#D -K#H e -L##L m -L## -Rx)# -S # g-T#%.U%s0BU&e+'PU'u&+ U(sig&+U(sig)+əU*sig), ЙU*sig+p| V,+sHS)G,>U*sig=)-j8=U-W-#V+iS.yp.l/tmp.#h.d0,.YS0-`+curH| P. IV.IS1O--ɢע2-3.ɢע2.2'.23.1--MS2-3.MS2.2'.23.1--2-3.2.2'.23.3-2-3.2.2'.23.4.n5m4@. -5+5p+5,)0)@U+p| W+p0| P+h'S.C'V+sHV.[Hp+lP.S.Cc(S.' c(V+expS.P+acl##S.##V.B0S.: 0V+rdr0S.;0V+uapy'V+uay'l.!5)S+iS0/6jh0/6jh0/6jh0/6jh0/6j h1B0072030720307203070P1[017[71Q3(1ĩ2913C1ĩ2T13020)(i(80"9t809t809t: 1];\ 1:(19tǂ8C1 ~9t}8^1 v9tu<1 pU*sigoV+pqS=1 ~mU.t>1$.?a@@2&pU--# +errV.uS.'`.'2\0W2+w|h02+pxp| S+retqP. rV028+ret*P,X.NP1AS%2AB %2AD%2Av'L22 A'M2A,AA  A qA&vJ38AwA xA -[ 3B A.Qw3Cq'<| A/;A/<A0;0Dnow0<|A0>|AR %E+ s) E-n@FpidoEPp,A`-\EE E FoneE4 ;E@A- 1#A 2$A3#Ab 4AA Q0AR0A U0A VAW 1GlLG[m'`GDGHGf 5 G|5@Q" 7 (0Ea @;cintEjn#p#! R}#}#h#E# #2<4 #N# H H< 0 SU ptr}Q h0S 'h`U?%S&NP i(hQ4U?3Vh 3HS idx50P ~}<~GU?;RR;}W idx=0P>HS% C%C% fJPƳU?Iph IHW idxK0PLHS R%R%jS[г7U?ZW i\0V]HSxjgX ]@(3*@]UinQ =VoutSintj @E  D Ӹ`(Ea "%@;]&^cint6%>:e?:JA:3CDSEj@ %1 -- -> s#/ # #Z #  # #O # #z #  #$ #(# #,E #0( #4. s#8 s#< #@ "3#D #e#F@ $#Gb (#H 1#L  7#T\ 8#X| :s#\! <#`  y  #  # : s#    3-n-#p-#g BL G Q$S3  _# #   J_# Bz# #  w    b  #  m  ~ # # # bit s#u32"%~* +##key,m# H0wq1x#rq2x# ~ 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,B)8H ~ I%# " J%# sK#fdLs# >M%#expN%# _4O# 4P# K4Q# 4R#$ibSg#(obSg#, p T%#0 U#48g S >}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 { %#4 @s#8 (#< ,#@ ,#A L#D J#L #P #T #X~~gh m ] auid^I#gid_3# }`># buxa LfdMs# ~ Ns# LOs# >P# Q # Rs# 4$Ss# T%# U # V# s)W # @X2# &Y # DZ# { [%# b# I)c#  TQ um # ns# Kos# ps# q_# rT# ss#$ %4t #( <5u #, v/ #0 w/ #4 _x/ #8 $y/ #< `z#@ ]{s#H |#L ss s  / s  V  Cf A #b Bg# &( ?cb C # s D# ~ E,#ev F,# G #  HT#  Is# J #$ 5 j   < _ D `# ? a #set b #clr c # E@ d # }? e #rem f #clo g # :4 h # j8 i1 #$ FA jC #( $ k1 #, F l1 #0 u m#4  ns#8 s s s      s  1 s ! C  7 n  `U  S j/U . S >s-U = P ? S @Ls0mU K P M S( )ZspŶU Y S^ jsж U i P k S 0xMU w Q !j|- PsU  P U  R"!j-)sU  S#errsV_{s3U  S#errsVVs@U  S#errsVsӸU  S#errsV$S $B $ q $& vV $ ws )% $Q`e(0Einta @;cEj #>#}# #>#?}#- %&>#'}#z(}#5)># >*>#-+#,#-# U   V uS ^7+ d4_ 2  %%%}P *%*}Pl@+U  ? uri?}S uASzB}V C> dS! ^Q\0U  [  [} u]S^}V l ^jw>7uU  t  t>P uvROU    Y>P uRB@U    J} uWT}V $> >-SBp Q E ^л % %U    }V uW }V-SIpout᡼ ^ߕ ݉ / % %3QS9(#0E2 Ba "0@;]&tcs2B5int60>Pe?PJAP3CDiEjgS U@ 02I40Y1? <xg pR#4 "7 $Pg BL G QiFr %D%E#%F#  7  J G#  ? J$$SI_ +#_# o J+#B##  w!+#G#f ]# # B d rT s# t # u# v#  w #6Lny  +#!#  k 1 -L- - ># / #  # Z  # # # O# # z# #$ #( # #, E#0 (#4 .#8 #< #@ "I#D #{#F @$#G b(#H 1#L 7/#T \8/#X |:#\ !<#`/y # #: #Y  R  3 b#  E  ~# # # bit#u32"0y~*+#key,E#n#p#y - y#ref!#H H0wq1P#rq2P#~ 3#04#450#86^#< 7/#@8#DXXXHU4$w $xL#$yy#$z0#  ${0#'$|0#r$}0# $~0#>$0# -$0#$u$#(  B)8H~ I0#" J0#sK/#fdL# >M0#expN0#_4O#4P#K4Q# 4R#$ibS< #(obS< #,p T0#0U/#4 <  S>}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@#8(% #< B#@B#Ab#DJ#L #P1 #T7 #Xk /tstru#lenv#| | <  % h zy#Ly# X# #fe#be## >#$R 0#(req< #,rep< #0si!#4 o#m$o##srvP#TP#I P#6 !#txn#z ##!#1!# #Í#$b!#0#k + H ] { auid^#gid_#}`# buxaH  LfdM#~ N#LO#>Po#  Q#R#4$S#T0#U#Vy#s)W#@X^#&Y#DZ/#{ [0#b{ #I)c# TQum#n#Ko#p# q+# r # s#$%4t#(<5u#,v#0w#4_x#8$y#<`zy#@]{#H|y#L     CfA#bB< #l&(?cbCl#sD/#~ EB#evFB# Gd#H #I#  J#$ |  J #get#put#u# {#|p 7> 46un 5jin 6p 2u 7#i! R###[# y#2d  "a"^/#"_%#c"`%#"az]!+!,#!-#!.#S!/#   74 #I#CCi7-(8len(90#cr(:0#(;0#F (Cv(D# (E#(F#)(G#2(H# O*'          < ' 'l'ݟ#m_l'ޟ#u'ߟ#u_l'ߟ# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'5st'D'H '0#sol'#eol'#som'0# col'0#sov'0#eoh'0#cap' #sl'#  'b#8 '#@D'2'*#F'# 'B #req'#rsp'#\uri'# '#'#BH'#>'0#{.E 0#^ 0#0# 1!P>IJP#~ K#" L#M# N# O#: P#q'R#S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lXy#@C!YX#H>[#LT\#\O>^#l`#|oa# b#@dP#dP#e#g f#og#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guP# v#hwP#yt#yt#bz0# {#}t#}t#~t#~t#t#&D# 0#t# t#t#It#M#q'hDR# ]#G]#~ # L#j#}##:"#,acly#0{y#8y#@y#H="#PsrvP#\] #`7 #d` ##hY#R #ğ##Ɵ#0#ȟ#_ɟ#S# ˟#J ̟##Ο#ϟ##? #Rҟ#/ӟ#-%##֟#y#&$#id#ly#l#, ##0#w0#}0#0# D# 0##D# 0#t#yt# t#4$0#0#X0#]#r]#]#]## #0##0#b0# #t#t#t#t#t#t# ! t# t# It# #cap# T# O>#  # o #  # e  # m  # J {#  {# x# # # # # u# # :# h # # # R# %# U%# t# t# ]t# #%# #%# # o # # 3%# 5  # !# "0# #0# >$M"# 2$M"#HV3 && y#&!| #srv&"P# x D ## # '###  #$1%[#(u [#,,[#0t#4It#< pxƄ#svP#ȍ#<ȍ# >0# iidʟ#Hʟ#sidʟ# ! ͤ# b!iidП#pxф#buf0#sid0# ptrԟ#bol՟#!'x  ! !  !| !!| !HM"p ,z{#t0|#t1|#j8}#~## (#$#("#len0#pos0# sid0#srvP#oe#srco#buf7 #"beu # 0#<y# A# srvA## #~ #P l#Xact!#bck!#, #act#bck# $#I # ## ##0 # P#map## G##,Nl##L $#6$#I8$#'$#$#$P$ % ٟ#2ڟ#%8۟#9ܟ# >ݟ# ޟ#Tߟ#C!#- % % 3% C%B "%<U#n;[Q$ ; $ ;%pos=S"%,?U#dst+R#src+S$ +Q&-V"F&}P@WU#nObVW$ O$ O&~*QS&Rp"&or`U#nq[Q$ qS$ qR#altqP"&`{&U#strzS%su|j&}P'(__s/j"'[2U#sR"E';@U$uQ"n'wѿU$uQ"(F(U#strS%sa϶%cP&'#џV)h*((__s/(0IB(__uӊ((__cӂ+R((9J,(-(9J,(,(,(.m(fl%__vIP'%he(P'/(n0m/( -0+0p+ 0,"|*(/U#strW#lowP$P%sa %cS1Sp1MV2h**)3__s/4)505I5B3__u|*3__c*L*6sepV+*(bq,(-(bq,(,(,(-(qu,(-(qu,(,(,(.h*6__v#IP76he(P)89,50cU9str4:>49, :49,2g2e6c7V6s7W138S6len9[P*s+03__s?/4Z+?5?05?I5?B3__u??,3__c?*+H3__s@/4+@5@05@I5@B3__u@E,3__c@*,`6errJd-(,(;(P,(.",6heX(P'=K3__vO0],++8,0pU9s-,t;,R7x<,S<,Q=,0>s(i0(j08-[U9url: :>(1S6cpV3ret1Q1H0l+--L,;-W;.h*-<.d<.`<&.Q<1.p<=.\?H.7nAdstn9,BpBYp3chp3tmpqp.3tpq.3cprCByBC3new} .x x8/`U:~*Q:  :s9map/:9V'1RR / 8[/0'U9s-[/;l/Q7sգ(i08/00YU9s9lenP-/13;/S;/Q7<0R=00>s>len(i08|00`U9s9lenP-|0df;0S;0Q7<0V<0R?0@00AsAlen3i03j03k081gU9sS9lenQ6iV6jR3k8y1a,U9s+V9len+S9ret+P6i-Q6j.R81)\(U9s[9len[ 9ret[1P6i]tVW6j^lt820U: S9ret2P:010V1A0W1;0p10l10d'p6j0R082'9U9srcW9nP6lenS6retVD K22 IDv L 33 D M 3DS .3DB .3D&vN3Dw w3 E"a3` 3 F`3D 3  @(y+06ji%Ea @;]&vcint3CDkE6@ H1 -r- ->#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.#8#<#@"V#D #}#F@$#Gb(#H1#L 7#T\8#X|:#\!<#`x 6 y  #  # : # 6  6 3n#p#U4w x}# y# zH# {H# '|H# r}H#  ~H# >H# -H#$ u#( 6  $S V   # # 6 B)8H ~ IH# " JH# sK#fdL# >MH#expNH# _4O# 4P# K4Q# 4R#$ibSE#(obSE#, p TH#0 U#4E S >}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 { H#4 @#8 (#< O#@ O#A d#D J#L #P #T #Xt/tstru#lenv#Eh t 6] Cf A#b BE#f&( ?cb Cf# s D# ~ EO#ev FO# Gv#  H#  I# J#$ v  |@kU&pFUbuf%ESmsg%r len%Vmax'%2C2j buf EObufOU EP:UbufDES /DVmaxFi%2pCK/ k@UbjESposj endjWstrjr!lVlenm  UbESpos endVstrrlen!W UbESposWstrrlen!VT >UchkV  Sfmtr"#=$retP% @Uo pbEW $Stol&S &B  && v & w 6' & Q & ;H(   S- N(b0Ea "0@;]&icint60>Ee?EJAE3CD^~EjgS U@ 0gBLGQiF ur !D !E# !F#y+iu1 - /- - >~# / #  # Z  # # # O# # z# #$ #( # #, E~#0 (#4 .~#8 ~#< #@ ">#D #p#F @$#G b(#H 1#L 7#T \8#X |:~#\ !<#`5   ~y  ~#  # : ~#G@3Vtm,w x~# y~# :z~# B{~# |~# }~# ~~# 2~# \~# #$ /#(2>40Ya? l g  p#S >    # # # J # B #  ##3w x !ڨ# w# f ܍#  x#7 b#   ~# # # bit~#u32"0 ?~* +#key, # dnd#pd#?   - ?#ref!d#  H0wq1#rq2# ~ 3~#0 4~#4 50#8 6$#< 7#@ 8~#D U4w x:# y?# z0# {0# '|0# r}0#  ~0# >0# -0#$ u#( B)8#H ~ #I0# " #J0# s#K#fd#L~# >#M0#exp#N0# _4#O# 4#P# K4#Q# 4#R#$ib#S #(ob#S #, p #T0#0 #U#4  #S > }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#, 0#0 { 0#4 @ ~#8 ( #< 7#@  7#A W#D J #L #P  #T #X 1 / tstr u#len v~#B B  H  h  z "?# L"?# "# "#fe"7!#be"7!# "~# >"~#$ R "0#(req" #,rep" #0si"?##4 "# m$"# "3#srv"# T"# I "# 6 "O##txn"Y# z "~# "z!# "a## 1"x##  "w# "w# $"## "0#1   ] 7 Ln y  # !7 #G kz auid ^6#gid _ # } `+# bux aG Lfd M~# ~ N~# L O~# > P# Q#  R~# 4$ S~#  T0#  U#  V?# s) W# @ X$# & Y# D Z# { [0#  bz # I) c#  T Q u m#  n~# K o~#  p~# q# rV#  s~#$ %4 t#( <5 u#,  v#0  w#4 _ x#8 $ y#< ` z?#@ ] {~#H  |?#L  ~~~~CfA#bB # k&(?cbCk# sD# ~ E7#evF7# G{# HV# I~# J#${  J  ~#get~#put~# u~# .# ~p7>4un5 in63 p2u7#a'R ;'N~# 'O~# L'P~# 'Q~# + ';uid'<~#gid'=~# '>~# 4$'?~# $'@~# 'A~# 'B~# Y'C~# }'D~# `'E~#$ 'F~#( 4'G#, ''H#0 J'I~#4 'I~#8 x'J~#< 'J~#@ 'K~#D 'K~#H e 'L#L m 'L# 'R # 'S # g'T~# !  R# # ~# P# ?#2*Z a ^# _%# c`%#a' ]+ ,# -# .~# S//# e Z 4 d# # ;-&8len&90#cr&:0#&;0# F &Cv&D#  &Ew# &Fw# )&Gw# 2&Hw#  %!!!! ! !!!! ! < %9%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq%st%9 SD% H %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%S#sl%# %W#8 %~#@ % 2%# F%;#  % #req%#rsp%#\uri%# %# %# BH%~# >%0# ..E  0# ^ 0# 0#=a"> I  J# ~ K~# " L~#  M~#  N~# O# : P# q' R7!#  S~#  T~#$ - T~#( 4$ U0#, 6 U0#0 l V~#4 , V~#8  W~#< l X?#@ C! Y#H > [3#L T \3#\ O> ^3#l  `~#| o a# b# @ d#  d#  e# g f3# o gw#  h~# i~# ; i~# # j~# j~# 6 j~#  k~# T l~# F m~#id o#  p0# Z p0# q0#  r0# m s0# # t0# V t0# g u# v=!# h w#  yi# yi# b z0# {A#  }i#  }i#  ~i#  ~i#  i# & # 0#  i# i#  i# I i# M ~#=7!q'hD R  # # G # ~ ~# L ~# j ~# } ~#  3# : ~$#,acl ?#0 { ?#8  ?#@  ?#H = $#Psrv #\ ] ~#` 7 ~#d ` D%#h Y # R #  ~#  #  ~#  0#  ~# _ ~# S # ~# J ~#  #  ~#  ~#  л# ? # R ~# / ~# - &#  #  ~#  ?# & E&#id # l ?# l ~# , ~#  ~#  0# w 0# } 0#  0# #  0# # # 0#  i# y i# i# 4$ 0#  0# X 0#  # r #  #  #  # ~# 0 #  ~# 0# b 0# A#  i#  i#  i#  i#  i#  i# ! i#  i# I i#  ~#cap ~# T 3# O> 3#  ~# o #  7!# e # m # J p#  p# x ~#  ~#  ~# ~# ~# u ~#  ~# : ~# h #  #  ~# R ~#  &# U &#  !#  !# ] !#  &# &#  ~# o #  ~#  &# 5 ~#  !~#  "0# #0# > $$# 2 $$#H  z!3 $ $ ?# $!B #srv$"# +"D" "~# "L# "L# '"L# "# "#  "#$ 1%"P#( u "P#, ,"P#0 "i#4 I"i#<""px"7!#sv"# "w# <"w# >"0# iid"~# H"~#sid"~#" " "j##"iid"~#px"7!#buf"0#sid"0# ptr"~#bol"~#?#"'"+""΢""ֹ"O#C!a#B U#x#B g#H $p , z  {#t0 |#t1 |# j8 }=!#  ~=!#  ~# ( ~#$  ~#(~$  L#len 0#pos 0# sid 0#srv #oe 7!#src #buf #$ be 7!u $  0# < ?#$ srv $# ~# ~ ~#%X act ##bck ##,D% act #bck #3&  ~# I ~# ~#  ~#  ~#  ~# 0 ~# #map $#  $#, N %# L ?&# 6 ?&# I8 ?&# ' ?&#  ?&#?&3&&  ~# 2 ~# %8 ~# 9 ~# > ~#  ~# T ~# C! ~#-& && & #R'AU$fmt@/%&B'tmCH(R')`'D)l'P*x'+nowx'+tm}' A#'*VU$fmtU/%&W'tmXH(R'$;)`'D)l'P#(jU$outi(S$fmti/ %&k,z(y~U$levx/V-z~S.& }%&}%,(~EU$fac/V-~S.%8& %&%#*DP[U$p7!V/~ /-/S%-~@-~D-eH&-*@-2@-~~-~P-)~-*-o-l-u-|~W-:~-"S01*-*P1 ~R1S2~*1*V11J~P(*}3*.['tm(R')`')l'P**** 4+z~5*6+ C`NU7sBB S8pnD8feE7!V8beF7!~9OG7!1H~W1H~~8errH~~1I~8tmJ~:+R')`'~)l'P2+NY;__vm>.$;__vl>pid'Y~< '^,/?k%,,/?W/,-/ ?4,(-5?M9:-2 -?:Q-* -l+#!P(6 0Ea "0@;]&ics27int60>Ee?EJAE3CD^EjgS U@ 0gBLGQiFpr "D"E#"F#    b#  p  ~x### bit#u32"0'~*+#key,#LnL#pL#'{ - '#ref!L#U4!w !x#!y'#!z0#  !{0#'!|0#r!}0# !~0#>!0# -!0#$u!#( * 02>40Y5? @|g pV#$S> ##  J#B##  wW!ڇ#K#f a# W# g7 1 -r- -> #/ # #Z #  # #O # #z #  #$ #(# #,E C#0( I#4. #8 #< #@ ">#D #p#F@ $O#Gb (_#H 1#L  7#T\ 8#X| :#\! <e#` Cy  C# I#: # r _  u 3 H0wq1#rq2#~ 3#04#450#86#< 7#@8#DuB)8 H~ I0#" J0#s K#fd L# > M0#exp N0#_4 O#4 P#K4 Q# 4 R#$ib S; #(ob S; #,p T0#0 U#4 ;   S> }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0{ 0#4@ #8( $ #< 7#@ 7#A W#DJ #L #P 0 #T 6 #Xj / tstr u#len v#{ { ;  $ h  z '#L '# # #fe #be # # > #$R 0#(req ; #,rep ; #0si #4 #m$ # #srv S#T S#I S#6 #txn #z # # #1 # ‚# Â#$ e # 0#j * G ]p Lny  #!p # k auid^1#gid_#}`&# buxa  LfdM#~ N#LO#>P#  Q #R#4$S#T0#U #V'#s)W #@X#&Y #DZ#{ [0#b #I)c#  TQum #n#Ko#p# q# r|# s#$%4t #(<5u #,v#0w#4_x#8$y#<`z'#@]{#H|'#L       ) Cf A #b B; #&( ?cb C#s D#~ E7#ev F7# G# H|# I#  J #$     J #get#put#u# ~#f! R###P# '#2{ a^#_%#c`%#aw]+,#-#.#S/*# 44 L#F#@@f4-%8len%90#cr%:0#%;0#F %Cv%D# %E#%F#)%G#2%H# L'$    < $$l$݉#m_l$މ#u$߉#u_l$߉# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$#$rq$2st$D$H $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڣ#sl$#  $W#8 $#@G$2$'#F$# $A #req$#rsp$#\uri$# $#$#BH$#>$0#~.E 0#^ 0#0# 5 S>IJS#~ K#" L#M# N# O#: P#q'R#S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lX'#@C!Y#H>[#LT\#\O>^#l`#|oa# b #@dS#dS#e#g f#og#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v#hwS#yi#yi#bz0# {<#}i#}i#~i#~i#i#&G# 0#i# i#i#Ii#M#q'hDR # a#Ga#~ # L#j#}##:"#,acl'#0{'#8'#@'#H=-"#PsrvS#\] #`7 #d` "#hY#R #ĉ##Ɖ#0#ȉ#_ɉ#S# ˉ#J ̉##Ή#ω# #? #R҉#/Ӊ#-U$##։#'#&##id#l'#l#, ##0#w0#}0#0# G# 0##G# 0#i#yi# i#4$0#0#X0#a#ra#a#a## #0##0#b0# <#i#i#i#i#i#i#! i#i#Ii## cap#T#O># #o # #e   #m   #J p# p#x### # #u##:#h ###R#a$#Ua$#q#q#]q#g$# g$##o ##w$#5  #!#"0# #0#>$!#2$!#HYx3 ## '##!{ #srv#"S# {D  # G# G# ' G# # #  #$1% P#(u P#,, P#0 i#4I i#< px Ƈ#sv S# Ȃ#< Ȃ# > 0# iid ʉ#H ʉ#sid ʉ#  R#e  iid Љ#px ч#buf 0#sid 0# ptr ԉ#bol Չ#  !' {! !   {   {  H p7!>4un5G in6!p2u7 #!p ,z{x#t0|x#t1|x#j8}#~## (#$#("G#len0#pos0# sid0#srvS#oe#src#buf6 #-"be!uR" 0#<'#" srv"# #~ #S"Xact!#bck!#,"actx#bckx###I # ## ##0 # S#mapR"# "#,N"#L ##6##I8##'#####S#O$ ى#2ډ#%8ۉ#9܉# >݉# މ#T߉#C!#-O$ [$ w$ $A "$TPU# SS$$cx%$$$cl%$&$ v'tu(%])\%*F%o0tU+t/S,8-5P"&yU#x V- zW.eb{%S/%&%&0&P/%&%&$&%&$'0'P%!'/:&.' %?'$K' %]'1 2i'P$'0'P%!'/d&$  %$$$  %$/&t'!5%'0'P$'r%'%'&&_'t1^'t2^&&7%) 63&Q6&4 53.'&4~*4]E0&K'C%)B%3t'T&4S&5tU&'Ak)j'nowj&'qh'tg'fg0" )RU# .tS.eb%V-Z0W-p/l(.'J%?'$K'J%]'1J2i'P$'8G0'P%!'/( )JP%)$$JP0$P/(')%4)/(@)%Q)%[)$&-%&$&-%&$'-0'P%!'&')'t(@)) &f)'t1't26:*`U7)fz5__s8)909>975__u:*5__cw,P5__s8 *909>975__u@*5__cw)):SS*g:B S*:& vs*): w *; :&Q*:';0h# / #  # Z  # # # O# # z# #$ #( # #, E"#0 ((#4 .h#8 h#< o#@ "3#D #Z#F @$.#G b(>#H 1#L 7#T \8#X |:h#\ !<D#` "y "# (#: h#Q >  T 3"B)8H~ I%#" J%#sK# fdLh# >M%# expN%#_4O4#4P4#K4Q4# 4R4#$ ibS#( obS#,p T%#0U#4..T" S> }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0{ %#4@ h#8( #< ,#@ ,#A A#DJ .#L .#P #T #X:h  ]hhC fA# bB#{&(? cbC{#sD#~ E,# evF,# G#H#Ih#  J#$    -hKUtv1,Qtv2,Shtv1tv2`8`PUtv`S$ mshQ6hUtv15Qtv25Rhtv1tv2-AhpUtv1@Vtv2@W-)?KX*htv1)tv2)K:pUtv1JVtv2JS|  h!" [:tv1Ztv2Z/ J:tv1Itv2I"retK: U:,Utv1TWtv2TS '  #'!"  a:0jUtv1`Stv2`R;W  $" Pb i`pUtvh`V$hRinchPb ~t    w`tvv`%$vincv !rhUtvq`S$qVincqQ    - htv`%$inc {`dUtv1zRtv2zPtvz`V )    `tv1tv2tv`U `pUtv1Stv2Rtv`QA U }g s         `tv1tv2tv` Co`tvn` Ph Utv1Qtv2R    Ohtv1tv2k }h PUtv1Qtv2Rk )7|   |htv1tv2&umPU/hSYh ' p'p'h(()b rt   Euauhtv1tv2ex`tvx`&UthSaQ)rvx)p͓p)cnthl ' *S4F*B 4*&vT*wh x+ * Qg,%  ,%8 ,%, -now ,w0 ,$  }y,10(r0Ea @;] &^cint3 C DSEj@  01 -a- ->s#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.s#8s#<z#@">#D #e#F@$#Gb(#H1#L 7#T\8#X|:s#\!<#`g y  #  # : s#s  l  3S >   # # + 2>B)8 H ~ I0# " J0# s K#fd Ls# > M0#exp N0# _4 O# 4 P# K4 Q# 4 R#$ib Se#(ob Se#, p T0#0  U#46e  S > }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#, 0#0 { 0#4 @ s#8 ( #< 7#@  7#A L#D J #L #P  #T #X||eh k ]ssCfA#bBe#]&(?cbC]# sD# ~ E7#evF7# Gm# H# Is# J#$ m  J  s#gets#puts# us# "#s <_ D`# ?a#setb#clrc# E@d# }?e#remf#clog# :4h# j8i #$ FAj#( $k #, Fl #0 uma#4 ns#8ss ss s 1+q4&0Ufd%sWqCO~QS/#.'#.s4JUY3ap5sV, 8% 8%! @AsPUpBsQbpCV"D >ZU#bp\p]sV$ elsUoutk pmsS%)nsh%nsW%6ospbppl&Ms1U'S 'B  (  (*s   (E ` (&= (s ( sD ( s@  ) 'Qy O /@(Ea  "%@;cint 6% >:e ?:J A:hEj % gBLGQz $  n $# p $# U4w x# y# z%# {%# '|%# r}%#  ~%# >%# -%#$ u#(  23 4%Y?  g  p#S3 T   # T#d  J # Bo# #w  ! # # f #  #, )Ln y  # !)#9k ap7 >4+un5in6 zp2 u79# b#z ~### bith#u32"% 1~* +# key,#  H0 wq1# rq2# ~ 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _# } `#  bux a  L fd Mh# ~ Nh# L Oh# > Pd# Q#  Rh# 4$ Sh#  T%#  U#  V# s) W# @ X# & Y$# D Z# { [%#  b# I) c#  T Q u m*#  nh# K oh#  ph# q # r#  sh#$ %4 t#( <5 u#,  vJ#0  wJ#4 _ xJ#8 $ yJ#< ` z#@ ] {h#H  |#Lhhh:Jh:R ;Nh# Oh# LPh# Qh# + ; uidh# 4$?h# $@h# Ah# Bh# YCh# }Dh# `Eh#$ Fh#( 4G#, 'H#0 JIh#4 Ih#8 xJh#< Jh#@ Kh#D Kh#H e La#L m La# RP# S# gTh# 8   h# J!h# "h# #8 #  {&8 @Uret'8 (p__p5S IVUpH8 S V`UpU8 R dU !"+ W# *#8 #h#h'{ 3(0Ea "0@;]&ic5int60>Ee?EJAE3CD^EjgS U@ 0gBLGQiFpr !D!E#!F#|  a^#_%#c`%#a@e jIh#%i# j?]+,?#-E#.#S/v# K 2>40YP? [g pq#$S> ##  J#B## - wr!ڢ#f#f |# r# 7 1 - - - ># / #  # Z  # # # O# # z# #$ #( # #, Ed#0 (j#4 .#8 #< #@ ">#D #p#F @$p#G b(#H 1#L 7#T \8#X |:#\ !<#`dy d# j#: #-  &  3 b#    ~# # # bit#u32"0M~*+#key,#r n r#p r#M - M#ref !r# H0wq1$#rq2$#~ 3#04#450#862#< 7#@8#D,,,U4 w x # yM# z0#  {0#' |0#r }0# ~0#> 0# - 0#$u #(  B)8 H~ I0#" J0#s K#fd L# > M0#exp N0#_4 O#4 P#K4 Q# 4 R#$ib S #(ob S #,p T0#0 U#4   S> }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0{ 0#4@ #8( #< 7#@ 7#A W#DJ #L #P  #T #X? / tstr u#len v#P P  V  h  z M#L M# ,# #fe #be # # > #$R 0#(req  #,rep  #0si !#4 #m$ # -#srv #T #I #6 !#txn %#z # F# -!#1 D!# w# w#$ # 0#?   ]E Lny  #!E # U k auid^1#gid_#}`&# buxaU  LfdM#~ N#LO#>P#  Q#R#4$S#T0#U#VM#s)W#@X2#&Yp#DZ#{ [0#b #I)c# TQum#n#Ko#p# q# r# s#$%4t#(<5u#,v#0w#4_x#8$y#<`zM#@]{#H|M#L      Cf A#b B #s&( ?cb Cs#s D#~ E7#ev F7# G# H# I#  J#$    J #get#put#u# # p7>4un5 in6-#p2u7#v! R###P# M#2#84 r##v-$8len$90#cr$:0#$;0#XF $Cv$DX# $Ew#$Fw#)$Gw#2$Hw# #          < #^ #l#݉#m_l#މ#u#߉#u_l#߉# v##v_l## \#l##v_l##c##c_l## r##r_l##y#rq#st#D#H #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap##sl#\#  #W#8 ##@#2##F## # #req#y#rsp#y#\uri## ####BH##>#0#.E 0#^ 0#0# P!>IJ#~ K#" L#M# N# O#: P#q'R#S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lXM#@C!Y,#H>[-#LT\-#\O>^-#l`#|oa# b#@d#d#e#g f-#ogw#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu$# v #hw#yi#yi#bz0# {<#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M# q'hDR# |#G|#~ # L#j#}#-#:J"#,aclM#0{M#8M#@M#H=h"#Psrv#\] #`7 #d` ##hY#R #ĉ##Ɖ#0#ȉ#_ɉ#S# ˉ#J ̉##Ή#ω#Ї#? #R҉#/Ӊ#-Ԑ$##։#M#&$#id#lM#l#, ##0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0#|#r|#|#|## #0##0#b0# <#i#i#i#i#i#i# ! i# i# Ii# #cap# T-# O>-#  # o #  # e   # m   # J p#  p# x# # # # # u# # :# h ?# ?# # R# $# U$# # # ]# $# $# # o # # $# 5  # !# "0# #0# >$!# 2$!#HF3 "" M#"!P #srv""# D  # G# G# ' G# # #  #$1% P#(u P#,, P#0 i#4I i#< n  px #sv # w#< w# > 0# iid ʉ#H ʉ#sid ʉ#  x#  iid Љ#px #buf 0#sid 0# ptr ԉ#bol Չ# ! '  n  օ ! -!P !!D!P 3!H!p ,z{#t0|#t1|#j8} #~ ## (#$#(J"G#len0#pos0# sid0#srv#oe#src#buf #h"beu " 0#<M# " srv"# #~ # "XactQ!#bckQ!#, #act#bck# ##I # ## ##0 # #map"# "#,N"#L  $#6 $#I8 $#' $# $# $# $ ى#2ډ#%8ۉ#9܉# >݉# މ#T߉#C!#-$ $ $ $ "%OU#dstW#src #strvV$j%%bp&I%+`'len#S'num#P(% /7Q%/7P&%lv)2()3% "%+Ev=U#strDvS'errFvV"G&fv@U$ZdG&S$dER$eR$SevV*expg?+O_'errjvP?,KZ&`& >,vLr&x& ~,Mr& & -[& ,S&,B &,& v&, w &. ,%Q&i8*(1 0Ea  "0 #[@t! %m;] &c 5int 60 =b >Ee ?E1! @PJ AEP BE3 C DtEjg S U l q@  01 *-s- *->+#/+ #+ #Z + #  +#+#O+# +#z+# +#$+#(# +#,E+`#0(+f#4.+#8+#<+#@+">#D +##F@+$l#Gb+(|#H+1P#L +7f#T\+8f#X|+:#\!+<#`  7 f +`y + +`#  +f# : +#)s | "  3gBLGQiF$r $D $E$# $F/#2>40Y? .g  p#$[S >m  9# m# }   J9# B# #  w  !9# # f #   # 7 rr Ts# t# u# v# w#D%3 k%4# %5# %6# %7# %8# I%9# `!%:#,C', '-# '.# 9!'/# s'0# Q X)% )&# )'># !!))# Z)-# ).# )/# ))0# )1# \)2>#( )4#, )8:#0 );E#4 (!)?$#8 !)@[#< m )A$#@ !)B[#D )C$#H )D[#L !)F[#P )G[#Tt bt#  Q ~Y### bit#u32 "0~ *  +#key ,#- n -#p -#\  - #ref !-# H 0wq 1#rq 2# ~ 3#0  4#4  50#8  6#< 7f#@  8#D\ U4"w "x# "y# "z0# "{0# '"|0# r"}0#  "~0# >"0# -"0#$ u" #(   j B)8-H ~ -I0# " -J0# s-Kf#fd-L# >-M0#exp-N0# _4-O| # 4-P| # K4-Q| # 4-R| #$ib-S #(ob-S #, p -T0#0 -Uf#4v v  j   -S >#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 { #0#4 @##8 (# #< #7#@ #7#A #m#D J#v #L #v #P # #T # #X  /#tstr#u#len#v#     h #z .# L.# .# .P#fe.!#be.!# .# >.#$ R .0#(req. #,rep. #0si.##4 .}# m$.}# .#srv.# T.# I .# 6 .(##txn.2# z .# .S!# .:## 1.Q##  .# .Í# $."# .0#  ]Ln y  9# !#  kC auid^#gid_# }`#V buxa] LfdM# ~ N# LO# >P}# QJ# R# 4$S# T0# UP# V# s)Wf# @X# &Yl# DZf# { [0# bC# I)c#J TQ umr# n# Ko# p# q9# r.# s#$ %4tf#( <5uf#, v#0 w#4 _x#8 $y#< `z#@ ]{#H |#L]VfV  JCfAf#bB #4&(?cbC4# sDf# ~ E7#evF7# Gr# H.# I# J#$ D  J  #get#put# u# #D !  R# # # [# #29 a ^f# _%# c`%#a]+ ,# -# .# S/# D 94 -# #-18len190#cr1:0#1;0#kF 1Cv1Dk#  1E# 1F# )1G# 21H# 0    < 0q0l0ݟ#m_l0ޟ#u0ߟ#u_l0ߟ# v0#v_l0#o0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st02D0 H 00#sol0#eol0#som00# col00#sov00#eoh00#cap0#sl0o# 0m#8 0#@0 20# F0#  0 #req0#rsp0#\uri0# 0# 0# BH0# >00#.E  0# ^ 0# 0#  >I J# ~ K# " L# M# N# O# : P# q'R!# S# T#$ - T#( 4$U0#, 6U0#0 lV#4 , V#8 W#< lX#@ C!Y#H >[#L T\#\ O>^#l `#| oa# b# @d# d# e# g f# og# h# i# ;i# #j# j# 6j# k# Tl# Fm#ido# p0# Z p0# q0# r0# ms0# #t0# Vt0# gu# v!# hw# y# y# bz0# {# }# }# ~# ~# # &# 0# # # # I# M#!q'hDR P# # G# ~ # L# j# }# # :V%#,acl#0 {#8 #@ #H =t%#Psrv#\ ] #` 7 #d ` &#h Y# R # ğ# # Ɵ# 0# ȟ# _ɟ# S# ˟# J ̟# # Ο# ϟ# К# ? # Rҟ# /ӟ# -(# # ֟# # &'#id# l# l# , # # 0# w0# }0# 0# # 0# ## 0# # y# # 4$0# 0# X0# # r# # # # # 0# # 0# b0# # # # # # # #! ##I##cap#T#O># #o # !#e  D$#m  D$#J # #x### # #u##:#h ###R#{(#U{(###]#(# (##o ##(#5  #!#"0# #0#>$$#2$$#HYS!3 / / # /! #srv/"# "D. .# .# .# '.# .# .#  .#$ 1%.[#( u .[#, ,.[#0 .#4 I.#<{".px.!#sv.# .ȍ# <.ȍ# >.0# iid.ʟ# H.ʟ#sid.ʟ#" . .3#".iid.П#px.!#buf.0#sid.0# ptr.ԟ#bol.՟##.!'."!.{"!.֒" (# !:# .#Q# v @#9H"#acl(*(+#u(,#)B(-#  (.#(/0#d#$OB(>(?#_(@#pol(A#(B0#-(C#D$p7!>4Dun5 in6]$p2u7$#$p ,z {Y#t0|Y#t1|Y# j8}!# ~!# # (#$ #(V% #len0#pos0# sid0#srv#oe!#src}#buf #t%be!!u%  0# <#% srv%# # ~ #%Xact]$#bck]$#,&actY#bckY# ' # I # # # # # 0 # #map%# %#, N%# L '# 6'# I8'# ''# '#' ''  ٟ# 2ڟ# %8۟# 9ܟ# >ݟ#  ޟ# Tߟ# C!#(-  &# '# z(# 5)# >*# -+k*# ,*# -(#'{(  !{(# u!# Z!#len! # @!!# D!"#( (  ( #(-$+!$u,(8'(#C)(#be-(# #)p(01#C2(#H3# 4#%5#6#>70#8# 9#$)E &$ &%#kw&&# N &-)#)!!)%*&5 &6#kw&7%*# 4*) k*  k*# # #4**  *# # ?#q**4R ;4N# 4O# L4P# 4Q# Q,+ 4;uid4<#gid4=# 4># 4$4?# $4@# 4A# 4B# Y4C# }4D# `4E#$ 4F#( 44G#, '4H#0 J4I#4 4I#8 x4J#< 4J#@ 4K#D 4K#H e 4LD$#L m 4LD$# 4R*# 4SV# g4T#, U uV#valW0#capX0# Y0# %Y. PU&str~'2PV(lPP(cP)~)#S)~)'#S(endW*L+1.(ss}~,b-=T-__sf.-Y./l.0y./././..-Y./l.0y./././..-Y./l.0y./././.,.(__v>P1EK(__v>P+F.-__sf2((heƱ.P3y.n4m3. -4+4p+4,5M/FU6q'!V7capQ6*6-7arg68msg S0M/ /^/9j/2:q'1!5/ PU6q'!P6* 6-7arg50,U6q'+!P6*+ 6-+7arg+5r0T 9U6q'8!P6*8 6-87arg850!FAU6q'E!P6*E 6-E7argE5"1rSPU6q'R!P6*R 6-R7argR5x1^ U6q']!6*]W6-]V7arg]S51!gxU6q'f!6*fW6-fV7argfS5$2oU6q'n!6*nW6-nV7argnS59! U6*~6 ~ 6=~7inv~;~K= %=%.6Y.l{/l.0y.l{/././.,!7= %=%.U7Y./l.0y./././.,{7*= $%=$%.7Y.FU/l.0y.FU/././.,7_l= 1%=1%,7= >%=>%,E8*= K%=K%1*=[K;RKP+8;LD$~;MS;MV;uMW,8Yf= %=%.8Y./l.0y./././.1:N= %=%x)>Y92 U+E9 ?__sf0Y9/f9@r908:q'7!5`zU6*6  6=7inv;!;!S8errP8rc}8val0~;~HU= /%=/%,5>= ^%=^%++?;_}8set`0}+t>8ucP,>!= d%=d%1!=[d;RdP,?%G= h%=h%1%G=[h;RhP1KX= k%=k%,u?= %=%1=[;RP,?#= %=%,?+8= %=%,?@M=  %; %Q,@Ub= [%=[%,5@jw= g%=g%+@8polhQ;Ci(Q,@= q%=q%1=[q;RqP1= s%=s%,@= %=%+A08pol};C(V;B`S;S;H};};!}; };i!};>0}1'= %=%.AY./l.0y./././., B= %=%.ABY.{/l.0y.{/././.,gB)6= !%=!%,B>N= !%=!%+C?hdr"{(,Bq= *%=*%1q;[*R;R*P0Y.//l.0y.//././.,EC= ;%=;%,kC= ;%=;%+C?hdr<{(,C= D%=D%1;[DR;RDP0Y./l.0y./././.,#D\o= %=%,ID= %=%,E8polS;C(V=B`,D%I= .%=.%1%I=[.;R.P,DRm= 0%=0%28aclC#P;uDR,7E= S%=S%,]E= %=%+F=,E(@= %=%,E`x= %=%,E= %=%1= %=%,-F " = %=%,SF  = %=%,yFm!!= %=%.FY.!!/l.0y.!!/././.,F""= %=%,F""= %=%,G""= %=%,EG""= %=%,kG""= '%='%,G"#= W%=W%+G0;X},G0#T#=a%;aP1##= g%=g%+YHP;(},6H$$=1%;1P1$$= 7%=7%.H`&&&/a0y.&&&/././.+Hp;}1#'2'= %=%,H((= %=%,I((= %=%+-I;S+EI;V,mIt**=%;P,I**= %=%,I**= %=%,I**= %=%,J,A,=%;P,-Ja,t,= %=%,SJx,,= %=%+kJ;V,J,-="%;"P,J..= B%=B%,J..= %=%,)Kc//= ^%=^%1c//=[^;R^P,OK;0H0= h%=h%,uK1 1= %=%,K(151= %=%,K~11= %=%+SL8polS;C(Q,0L11= %=%111=[;RP111= %=%,yL22= %=%,L22= %=%122=[;RP,L22= %=%,M33= r%=r%,5M33= %=%,[M44= %=%,M44= %=%,M55= %=%,M5'5= %=%,M/5<5= %=%,N55= %=%+3N;s0~,YN66= r%=r%,N88= %=%,N89G9= %=%,Ni9v9= %=%,N8:E:= "%="%,OM:Z:= -%=-%+mO0;.};H /P; 0W; 1};@!2},O-;O;=  %= %1-;O;=[ ;R P++PP; D$~; S,Pj;w;=  %= %1;=; V;u W,QP===  %= %,wP=== q %=q %,P=== w %=w %,P=== w %=w %+Ph;x W#S+=Q; },Qo@~@= - %=- %1@@= > %=> %,cQAA=  %= %+{Q; W#S,QBB=  %= %+Q; W#S,QqC~C=  %= %+Q; W#S,RaDnD=  %= %+5R ; W#S,[RQE^E=  %= %+sR ; W#S,RAFNF=  %= %+R@ ; W#S,RGG= 4 %=4 %+R` ;5 W#S,SjHwH= O %=O %+-S ;P W#S,SSII= p %=p %+kS ;q W#S,SJK=  %= %+S ; W#S,S;LHL=  %= %+S ; W#S, TMM=  %= %+%T ; W#S,KTNN=  %= %+cT ; W#S,TPP=  %= %,TEQRQ=  %= %,TVQbQ=  %= %+T ; W#S,URR= & %=& %++U8 ;' W#S,QUSS= E %=E %+iUP ;F W#S,UTT= d %=d %+Uh ;e W#S,UcVpV=  %= %,UxVW; W#S,VWW=  %= %,+VWFY; W#S,QVFYSY=  %= %,wV^ZkZ=  %= %,VoZ{Z=  %= %,VZZ=  %= %+GW =! ; V8err S.(WY.ZZ/l.0y.ZZ/././.2 =  %= %,mW[[=  %= %+W 8kwl? 9S=@@ ,W\\= F %=F %+XX ;! P; S8fd V8err };  ,~.'Xa^$^/.aA:aP0Y.c_z_/l.0y.c_z_/././.,~X__= @ %=@ %,X dd= %=%,Xd+d= %=%.XY.ee/l.0y.ee/././..2YY.ee/l.0y.ee/././..fYY.ff/l.0y.ff/././.,Yff= %=%,Y gg= %=%.YY.3i?i/l.0y.3i?i/././.,Zii8__vq>P,LZj;j= %=%1j;j=[;RP+Z ;P0Y.Yjjj/l.0y.Yjjj/././.+Z 8l PP2 ;'# P1kk?__v >,Zkk?__v >,[ll= %=%,:[ll= %=%,`[ll= %=%,[lm= %=%,[m"m= %=%,[*m=m= %=%,[EmXm= %=%,\`msm= %=%,D\{mm= %=%,j\mm= %=%,\n'n= %=%,\/nBn= %=%,\Jn]n= %=%,]enxn=  %= %,(]nn=  %= %,N]nn=  %= %.]Y.no/l.0y.no/././.+]0 8err P,][ono= & %=& %,]oo= + %=+ %+^P ;, ~;, ~+E^x 8i< Q0MappA^aV2 Bga,k^pp= L %=L %1"q4q= \ %=\ %,^erxr=  %= %,^rr= ^ %=^ %,_is|s= r %=r %.4_Y.'tCt/l.0y.'tCt/././..h_Y.Ktgt/l.0y.Ktgt/././.._Y.ott/l.0y.ott/././.+_ ?w0Y.tt/l.0y.tt/././.,`uu= T %=T %.:`Y.ww/l.0y.ww/././..n`Y.ww/l.0y.ww/././.+` 8errP+` 8errP2 8errPC` !Ddst!`Dsrc!` ` )(3ai4h3Ga f4!e4!eGa,9saI!>En=-ret?5dn zU6*m ; o do8fp dm; q m; r m;s m+lc 8argy S8invy m8endz W;={ dm;-| V,b.|L|=  %= %1.|L|=[ ;R P,b||=  %= %,b||=  %= %,b| }=  %; %S,#c }}=  %= %,Ic }/}=  %= %13}E}=  %= %+c( ; m,c~=  %= %1;  7Q; 7P,c= 1= dh *d @Ff` U; p;!l;!W;hIv,Lgg I,MgI&vgIw gJ I2QgI  Kq'<!KQ=LLLI3;0Mnow3<I+ 4W*I`4\I4]  }h Iv 5h mhI5Ib5I 6Q0I6R0I 6U0I 6VI6Wh i ~L !;i` h 'i'i  Q,)]=i` i Ri'i )yci Bi)) ) )P2% $U0("0Einta "0@;]&wc60>Se?SJAS3C7DlEjgS7 U7@ 0g BL G QiFer DE#F#k 2L40 Yp? {g  p #$SL ##  =J#B#=# M w ! # ۆ#f ܜ# # E 1 -@- - >># / #  # Z  # # # O# # z# #$ #( # #, E#0 (#4 .>#8 >#< #@ "L#D #~#F @$#G b(#H 1#L 7#T \8#X |:>#\ !<#` y # #: >#M  F  3   b #  9   ~ #  #  # bit >#u32 "0m~ * +#key ,9#n#p#m - m#ref!#< H 0wq 1D#rq 2D#~ 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<U4w x@#ym#z0#  {0#'|0#r}0# ~0#>0# -0#$u#(  B)8H~ I0#" J0#sK#fdL># >M0#expN0#_4O#4P#K4Q# 4R#$ibS0 #(obS0 #,p T0#0U#40  S>}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@>#8( #< E#@E#Ae#DJ#L #P% #T+ #X_ /tstru#lenv>#p p 0 v  h z m#L m# L# #fe |#be |# ># > >#$R 0#(req 0 #,rep 0 #0si #4 #m$ # M#srv H#T H#I H#6 #txn #z ># # #1 # …# Å#$ Z # 0#_  < ]e Lny  #!e # u k auid^&#gid_#}`# buxau  LfdM>#~ N>#LO>#>P#  Q #R>#4$S>#T0#U #Vm#s)W #@XR#&Y #DZ#{ [0#b #I)c#  TQum #n>#Ko>#p># q# r# s>#$%4t #(<5u #,v #0w #4_x #8$y #<`zm#@]{>#H|m#L   >> >  >  CfA #bB0 #&(?cbC#sD#~ EE#evFE# G#H#I>#  J#$   J >#get>#put>#u># s#[! R##>#^# m#2X a^#_%#c`%#al]+,#-#.>#S/e#  )4 #;#55[)-#8len#90#cr#:0##;0#F #Cv#D# #E##F#)#G#2#H# A"    < "~"l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"'st"~D"H "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ژ#sl"#  "e#8 ">#@<"2"#F"# "6 #req"#rsp"#\uri"# "#"#BH">#>"0#s.E 0#^ 0#0# p H>IJH#~ K>#" L>#M># N># O#: P#q'R|#S># T>#$- T>#(4$U0#,6U0#0lV>#4, V>#8W>#<lXm#@C!YL#H>[M#LT\M#\O>^M#l`>#|oa# b#@dH#dH#e#g fM#og#h># i>#;i>##j># j>#6j>#k>#Tl>#Fm>#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guD# v#hwH#yw#yw#bz0# {1#}w#}w#~w#~w#w#&<# 0#w# w#w#Iw#M>#|q'hDR # #G#~ ># L>#j>#}>#M#:"#,aclm#0{m#8m#@m#H=""#PsrvH#\] >#`7 >#d` "#hY#R #>##>#0#>#_>#S# >#J >##>#>##? #R>#/>#-J$##>#m#&##id#lm#l>#, >#>#0#w0#}0#0# <# 0##<# 0#w#yw# w#4$0#0#X0##r#### >#0#>#0#b0# 1#w#w#w#w#w#w# ! w# w# Iw# >#cap># TM# O>M#  ># o #  |# e   # m   # J ~#  ~# x># ># ># ># ># u># ># :># h # # ># R># V$# UV$# f# f# ]f# \$# \$# ># o # ># l$# 5  ># !># "0# #0# >$!# 2$!#HN3 !! m#!!p #srv!"H# pD  ># <# <# ' <# 7# 7#  7#$1% ^#(u ^#,, ^#0 w#4I w#< px |#sv H# ȅ#< ȅ# > 0# iid >#H >#sid >#  ͘#Z  iid >#px |#buf 0#sid 0# ptr >#bol >#  !' p! !    p   p  H p7!>4un5< in6M !p2u7 #!p ,z{#t0|#t1|#j8}#~#># (>#$>#("<#len0#pos0# sid0#srvH#oe|#src#buf+ #""be|!uG" 0#<m#z" srvz"# >#~ >#H"Xact !#bck !#,"act#bck##>#I ># >#># >#>#0 ># H#mapG"# "#,N"#L ##6##I8##'#####H#D$ >#2>#%8>#9># >># >#T>#C!>#-D$ P$ l$ |$6 "$">0jU#sHQ"$">pU#sHR$S$$B $$&v$$w> %% $$Q %&now%<<3"YDЍ(#"0Ea  "0@;] &icint 60 >Ee ?EJ AE3 C D^Ejg S U@  0gBLGQiFer %D%E#%F#1 *-p- *- >+~# /+ # + # Z + # +# +# O+# +# z+# +#$ +#( # +#, E+R#0 (+X#4 .+~#8 +~#< +#@ +">#D +#p#F @+$^#G b+(n#H +1#L +7#T \+8#X |+:~#\ !+<t#`   +Ry ++R# +X#: +~#p n   3S >   # #    J #B # #  wFq 6  7~# o 8~#2>40YF? Qg pg#!ڏ#\#f r# # 7  b#  e  ~# # # bit~#u32"0~*+#key,e#n#p# - #ref!#h H0wq1p#rq2p#~ 3~#04~#450#86~#< 7#@8~#DxxxhU4#w #x##y##z0#  #{0#'#|0#r#}0# #~0#>#0# -#0#$u##( - B)8'H~ 'I0#" 'J0#s'K#fd'L~# >'M0#exp'N0#_4'O #4'P #K4'Q # 4'R #$ib'S\ #(ob'S\ #,p 'T0#0'U#4-\  'S>$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#, $0#0{ $0#4@$~#8($E #< $7#@$7#A$W#DJ$#L $#P$Q #T$W #X /$tstr$u#len$v~#  \  E h $z&#L&# &x# & #fe&#be&#&~# >&~#$R &0#(req&\ #,rep&\ #0si&b'#4 &#m$&#&#srv& "#T& "#I & "#6 &r'#txn&#z &~#&%#&'#1&'# &w#&w#$&8'#&0# K h ] Lny  #! # k auid ^&#gid _#} `# bux a  Lfd M~#~ N~#L O~#> P#  Q # R~#4$ S~# T0# U # V#s) W #@ X~#& Y #D Z#{ [0# b #I) c#  T Qu m# n~#K o~# p~# q# r#  s~#$%4 t #(<5 u #, v##0 w##4_ x##8$ y##<` z#@] {~#H |#L   ~~ ~  #~ JCfA #bB\ #&(?cbC#sD#~ E7#evF7# G#H#I~#  J.#$ ) . J ~#get~#put~#u~# # <_D`#?a-#setb-#clrc-# E@d-#}?e-#remf?#clog?#:4h\# j8ir#$FAj#($kr#,Flr#0um#4n~#8(~(~ ~?(3VV~4Er~VbVxp7>4un5h in6p2u7# .R;.N~#.O~#L.P~# .Q~# n+ .;uid.<~#gid.=~#.>~#4$.?~# $.@~# .A~#.B~#Y.C~#}.D~# `.E~#$.F~#(4.G#,'.H#0J.I~#4.I~#8x.J~#<.J~#@.K~#D .K~#He .L#Lm .L#.R# .S #g.T~#-)8len)90#cr):0#);0#F )Cv)D# )Ew#)Fw#))Gw#2)Hw# nI(          < ((l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(Tst(D(H (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(#sl(#  (W#8 (~#@i(2(I#F(# (b #req(#rsp(#\uri(# (#(#BH(~#>(0#! R##~#P# #2i !a!^#!_%#c!`%#!aP] + ,P# -V# .~#S /#  \ 4 ##Hq'hD # r#G r#~ ~# L ~#j ~#} ~# #: %##,acl #0{ #8 #@ #H= C##Psrv "#\] ~#`7 ~#d` ##hY #R # ~# # ~# 0# ~#_ ~#S # ~#J ~# # ~# ~# a#? #R ~#/ ~#- k%# # ~# י#& $#id #l #l ~#, ~# ~# 0#w 0#} 0# 0# #  0## # 0# i#y i# i#4$ 0# 0#X 0# r#r r# r# r# # ~#0 # ~# 0#b 0# 1# i# i# i# i# i# i# ! i#  i# I i#  ~#cap ~# T # O> #  ~# o #  # e # m # J p#  p# x ~#  ~#  ~# ~# ~# u ~#  ~# : ~# h P#  P#  ~# R ~#  w%# U w%#  #  # ] #  }%# }%#  ~# o #  ~#  %# 5 ~#  !~#  "0# #0# > $"# 2 $"#H.E 0#^ 0#0# #F!Z3  #! #srv" "#  ">"J "#~ K~#" L~#M~# N~# O#: P#q'R#S~# T~#$- T~#(4$U0#,6U0#0lV~#4, V~#8W~#<lX#@C!Yx#H>[#LT\#\O>^#l`~#|oa# b.#@d "#d "#e#g f#ogw#h~# i~#;i~##j~# j~#6j~#k~#Tl~#Fm~#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gup# v&"#hw "#yi#yi#bz0# {1#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M~#Z"p , z {#t0 |#t1 |#j8 }&"# ~&"# ~# ( ~#$ ~#(%#  <#len 0#pos 0# sid 0#srv "#oe #src #buf W #C# be u h#  0#< ## srv ## ~#~ ~# "#X act ,"#bck ,"#,# act #bck #$  ~#I ~# ~# ~#  ~# ~#0 ~# "#map h##  ##,N ##L $#6 $#I8 $#' $# $#$ "$e%  ~#2 ~#%8 ~#9 ~# > ~# ~#T ~#C! ~#-e% q% % %b N&D& &~#&<# &<# '&<#&#&#  &#$1%&P#(u &P#,,&P#0&i#4I&i#<&&px&Ʃ#sv& "#&w#<&w# >&0# iid&~#H&~#sid&~#& &&#8'&iid&~#px&ѩ#buf&0#sid&0# ptr&~#bol&~#b'&'&N&&&&& r'- #' x'' '"'"2Ѝ:U#be1S$''%'&' %'' (2(q'1)(\#>~@ŽU#s= "P*pc?r'R+("?r'V+o"?r'W+"@~p,8 +C S&(-(S%('(qhx.tgx.fg0)6),#Z~Ў]U#sY "V+"[~W,` /a 0pbr'$)6)-G)P&(-(S%('R)";r'.px;R)X) ")q#u`U#st "V*srvv "S*msgwb h+"x~W,x +"{~d"*/" VU#s "V*srv "S*msgb h+"~W"O*"`U#s "S*srv "S*msgb h+"~W1*I#ݕU2s "S3srv  "S3msg!b h4""~W5+#N~U2fdM~W6"6>#:6"6F"і3tPxV3sQ "S$*+(:%(%(7n+ 3ret^~P8|9"e~8|:__ve07+ 3sa86A:__v>&+%+%+&+- ,P%,'+#W~.nowV~(&V~' ,="L~.nowK~(&K~5,v"~hU2fd~6"3len~S3tx`3s "\4#~d4#h&(%(%(;0Y"xpU2tx4"~3s "W3saX3fd~V3rv~V6#$M-0šܚ-0P-0R$i-0 %0%0$-0L-0Q-0$-0ٛ%0-0P$-+ٛ- ,P%,$-+ʜ- ,S-,P$.0k%0-0P$#.+- ,P%,$A.0 %0-0V7. 9#~$t.+ - ,S%,$.+.- ,P%,&0@V% 1%1<.ܟ:__vC>7/ 4#J 13retK~4>K~80|4"Z~3src[H$P/&1ݠ%718ݠ=B1P&0%|-0Q-07/4# 1S3ret~P4>~&'--'P$/N1TW%[1$0+ţˣ- ,P-,P<^029#~$E0+- ,S%,&0'% 1%1$w0'2D-'P$00h|%0%0&+|- ,P%,'0Ak~(j~.nowj~>0/(#..('#.~' 1"u~.t1t~.t2t~'N1#~(#.0ret~>f1e"T.fdS~?L2 #G~DU3pxIp3sJ "S:tKx4#L~l4#L~h4#L~d$2L2@]2,@]2728=g2V&t2ԥۥ%2$82+- ,W-,P&2So%2't2P"x0txA0__p'25x.tx>2( xBS*2eBB *2B q4B&v2JBw~ 3C B,Q2B-;0Dnow-<<Bw-=<B+ .W B.]W Done._(B.`n3 Eq' <B Q0BR0B U0B VBW3p'C&cɪP(#0Einta  "0@;] &wc 60 >Se ?SJ AS3 C7 DlEjg S7 U7@  0gBLGQiFer DE#F#  n # p #e - e# ref !#RU4w xR#ye#z0#  {0#'|0#r}0# ~0#>0# -0#$uX#( h n 2L40Ys? ~g p#$S L ##  @J#B#@# P w!#ۉ#f ܟ# # E 1 %-C- %- >&># /& # & # Z & # &# &# O&# &# z&# &#$ &#( # &#, E&#0 (&#4 .&>#8 &>#< &#@ &"L#D &#~#F @&$#G b&(#H &1#L &7#T \&8#X |&:>#\ !&<#`&y &&# &#: &>#J  C  3 b#  6  ~# # # bit>#u32 "0j~ * +# key ,6# H 0 wq 1A# rq 2A#~ 3>#0 4>#4 50#8 6#< 7#@ 8>#DjB)8"H~ "I0#" "J0#s"K# fd"L># >"M0# exp"N0#_4"O#4"P#K4"Q# 4"R#$ ib"S0 #( ob"S0 #,p "T0#0"U#40  "S>}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#, 0#0{ 0#4@>#8( #< E#@E#Ae#DJ#L #P% #T+ #X_ /t stru# lenv>#p p 0 v  h z!e#L!e# !# ! # fe!|# be!|#!># >!>#$R !0#( req!0 #, rep!0 #0 si! #4 ! #m$! #!P# srv!H#T!H#I !H#6 ! # txn!#z !>#!#! #1! # !…#!Å#$!Z #!0#_  < ]e Lny  #!e # u k a uid^&# gid_#}`# buxau  L fdM>#~ N>#LO>#>P #  Q #R>#4$S>#T0#U #Ve#s)W #@X#&Y #DZ#{ [0#b #I)c#  TQum #n>#Ko>#p># q# r# s>#$%4t #(<5u #,v #0w #4_x #8$y #<`ze#@]{>#H|e#L   >> >  >  C fA # bB0 #&(? cbC#sD#~ EE# evFE# G#H#I>#  J#$   J ># get># put>#u># s#[! R##>#^# e#2 a^#_%#c`%#al]+,#-#.>#S/h#  )4 #;#55[)-$8len$90#cr$:0#$;0#F $C v$D# $E#$F#)$G#2$H# A#    < #~# l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#'st#~D#H #0# sol## eol## som#0# col#0# sov#0# eoh#0# cap#ژ# sl##  #e#8 #>#@<#2##F## #6 # req## rsp##\ uri## ####BH#>#>#0#s.E 0#^ 0#0# s H>IJH#~ K>#" L>#M># N># O#: P#q'R|#S># T>#$- T>#(4$U0#,6U0#0lV>#4, V>#8W>#<lXe#@C!Y#H>[P#LT\P#\O>^P#l`>#|oa# b#@dH#dH#e#g fP#og#h># i>#;i>##j># j>#6j>#k>#Tl>#Fm># ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guA# v#hwH#yw#yw#bz0# {1#}w#}w#~w#~w#w#&<# 0#w# w#w#Iw#M>#|q'hDR # #G#~ ># L>#j>#}>#P#:"#, acle#0{e#8e#@e#H=""#P srvH#\] >#`7 >#d` "#hY#R #>##>#0#>#_>#S# >#J >##>#>##? #R>#/>#-J$##>#e#&## id#le#l>#, >#>#0#w0#}0#0# <# 0##<# 0#w#yw# w#4$0#0#X0##r#### >#0#>#0#b0# 1#w#w#w#w#w#w# ! w# w# Iw# >#cap># TP# O>P#  ># o #  |# e   # m   # J ~#  ~# x># ># ># ># ># u># ># :># h # # ># R># V$# UV$# f# f# ]f# \$# \$# ># o # ># l$# 5  ># !># "0# #0# >$!# 2$!#HN3   e# !p # srv "H# pD! !>#!<# !<# '!<#!7#!7#  !7#$1%!^#(u !^#,,!^#0!w#4I!w#<! px!|# sv!H#!ȅ#<!ȅ# >!0# iid!>#H!># sid!># !!͐#Z ! iid!># px!|# buf!0# sid!0# ptr!># bol!># !!'!p!!!!   p   p  H p7!>4un5< in6P !p2 u7 #!p ,z{# t0|# t1|#j8}#~#># (>#$>#("<# len0# pos0# sid0# srvH# oe|# src # buf+ #""be|!uG" 0#<e#z"  srvz"# >#~ >#H"X act !# bck !#," act# bck##>#I ># >#># >#>#0 ># H# mapG"# "#,N"#L ##6##I8##'#####H#D$ >#2>#%8>#9># >># >#T>#C!>#-D$ P$ l$ |$6 "$($'0PU#s&$S$max(0V%§&$60$ '$>U(%I$ U#p Q%&3&j"%#ap U#srv`HV#px`|W$psb Q)ppb *cp S+%%,%+%%,%-&ߨ.&p. &l/%W$1 0s1$/%"; 0px;%% N/,&>0tv1,&0tv2,&2& <(&$CU#sBHV$pD|p*4$E>W%*Mp P-&é.&S,&/&qh0tg0fg0" '<$ ɪU1p S)p 2P$__pQ3S%'3B %'3&v:'3w> ^'4 3'QM'5now<<6- fP 3 Q03R03 U03 Vf3W'A6)\iЪ($#0Ea "0@;]&icint60>Ee?EJAE3CD^EjgS U@ 0gBLGQiFer %D%E#%F#1 +-p- +- >,~# /, # , # Z , # ,# ,# O,# ,# z,# ,#$ ,#( # ,#, E,j#0 (,p#4 .,~#8 ,~#< ,#@ ,">#D ,#p#F @,$v#G b,(#H ,1#L ,7#T \,8#X |,:~#\ !,<#`    ,  ,jy ,,j# ,p#: ,~#3p,3$S> ## "J#B#"#2w^q6 7~# o8~#2>40Y^? ig p#!ڧ#t#f ܊# #7 b#--}  ~# -# -# bit~#u32"0~*+3#key,}# n #p # - #ref !# H 0wq 1#rq 2#~ 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5U4$w $x#$y#$z0#  ${0#'$|0#r$}0# $~0#>$0# -$0#$u$5#(E B)8&H~ &I0#" &J0#s&K#fd&L~# >&M0#exp&N0#_4&O%#4&P%#K4&Q%# 4&R%#$ib&St #(ob&St #,p &T0#0&U#4  Et  &S> }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0{ 0#4@ ~#8( ] #< 7#@ 7#A W#DJ #L #P i #T o #X+ / tstr u#len v~#  t  ] h  z #L # # #fe !#be !# ~# > ~#$R 0#(req t #,rep t #0si $#4 #m$ # #srv #T #I #6 $#txn S#z ~# ="# $$#1 ;$# w# w#$ ## 0# c  ] Ln y # ! # k auid^&#gid_#}`# buxa  LfdM~#~ N~#LO~#>P#  Q #R~#4$S~#T0#U #V#s)W#@X#&Y#DZ#{ [0#b #I)c#  TQum#n~#Ko~#p~# q# r# s~#$%4t#(<5u#,v;#0w;#4_x;#8$y;#<`z#@]{~#H|#L  ~ ~ ~+;~ +bCfA#bBt #&(?cbC#sD#~ E7#evF7# G#H#I~#  JF#$AF J ~#get~#put~#u~# #+ <_D`#?aE#setbE#clrcE# E@dE#}?eE#remfW#clogW#:4ht# j8i#$FAj#($k#,Fl#0um#4n~#8@~ @ ~ ~+ W @K n n ~L]~ nz  np7>4un5 in6p2u7#$-R;-N~#-O~#L-P~# -Q~# + -;uid-<~#gid-=~#->~#4$-?~# $-@~# -A~#-B~#Y-C~#}-D~# `-E~#$-F~#(4-G#,'-H#0J-I~#4-I~#8x-J~#<-J~#@-K~#D -K~#He -L#Lm -L#-R# -S #g-T~#! R##~#P# #2 "a"^#"_%#c"`%#"am]!+!,m#!-s#!.~#S!/# (y 4 ##  .E 0#^ 0#0#5-)8len)90#cr):0#);0#F )Cv)D# )Ew#)Fw#))Gw#2)Hw# (          < (3(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(3MD(H (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(M#sl(#  (W#8 (~#@(2(#F(5# (z #req(#rsp(#\uri(# (#(#BH(~#>(0#^!>IJ#~ K~#" L~#M~# N~# O#: P#q'R!#S~# T~#$- T~#(4$U0#,6U0#0lV~#4, V~#8W~#<lX#@C!Y#H>[#LT\#\O>^#l`~#|oa# bF#@d#d#e#g f#ogw#h~# i~#;i~##j~# j~#6j~#k~#Tl~#Fm~#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v"#hw#yi#yi#bz0# {1#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M~#!q'hDR # #G#~ ~# L~#j~#}~##::%#,acl#0{#8#@#H=X%#Psrv#\] ~#`7 ~#d` &#hY#R #~##~#0#~#_~#S# ~#J ~##~#~#~#? #R~#/~#-Ԁ'##~#ױ#&'#id#l#l~#, ~#~#0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0##r#### ~#0#~#0#b0# 1#i#i#i#i#i#i# ! i# i# Ii# ~#cap~# T# O>#  ~# o #  !# e  # m  # J p#  p# x~# ~# ~# ~# ~# u~# ~# :~# h m# m# ~# R~# '# U'# # # ]# '# '# ~# o # ~# '# 5  ~# !~# "0# #0# >$$# 2$$#H="3 '' #'! #srv'"# "D  ~# <# <# ' <# # #  #$1% P#(u P#,, P#0 i#4I i#<e# px !#sv # w#< w# > 0# iid ~#H ~#sid ~#|#  ## iid ~#px !#buf 0#sid 0# ptr ~#bol ~#$ ' " e# |#$E" $$ $ ;$ *$$p ,z{#t0|#t1|#j8}"#~"#~# (~#$~#(:%<#len0#pos0# sid0#srv#oe!#src#bufo #X%be!u}% 0#<#% srv%# ~#~ ~#%XactA$#bckA$#,&act#bck#&~#I ~# ~#~# ~#~#0 ~# #map}%# %#,N%#L &#6&#I8&#'&#&# & &z' ~#2~#%8~#9~# >~# ~#T~#C!~#-z' '' 'z (Y%*dow*~#h1*~#m1*~#h2*~ #m2*~#W(*min*i#max*i#$*~#$*~#|(*>*ϊ#*Њ#(*i*~#*(v$*W(]%*Ҳ'(*ptr*str*reg*(@)M%,**Ʊ#val*|(#ptr*د(#$*# len*~#$>*~#(w) *p*i*~ll*id*w)a*~)H))$0*i*~#ptr*#len*~#>*~# ctx*@)#F*$*kw*# N *f*# )%**# pA*+# *0# E&* ~#`*~  `* (F**~ !  ~ * ***A* *!#kw*"j+#arg*%T+# %*&~# $*'#)l*+~ * `**E+%* *#kw*E+#T+)!"j+*%#str*$)$+i$/Ъ0U%s. S&Z0p'+٪ܪ(+)+V)+W*+4&.~+fd.~+sa.+,$.+-1m)@~0U%fd@~.lA }.pB!W/sC .txnD1}/tE.cfdF~}&%G~}0/%0$|0%M0%M0%-0{$ 0'&0&׹1.p&>P~&$Q}1-.__pnV2d- 1>314311O-5$1}'11y(B12{-L1 (Y12-d1%(u12-1gs)1R(11-6pnE1~6snE1}1.6lenW~P76png1}7ɰ8__vn>17. 6__ptR2N.1;>(12e.1Ʊͱ(11}.86__pR2.1'(12.1jp(12. 2rx(2($2'.2(;2'1dz)1S(19(/6pn]~7ڴ8__vd>1@/`6__pQ9Z/8__s1r/x6__pQ9/ٶ8__s 1/6__p&Q2/F2!P)S2P7-33_29/q6msgz }906msgz }9#05.maxJ~P9=0Wb8__vP>1S08__vO>106pn5~6sn5~90gr8__v@>48__v?>20p2M|(}290|:j202s(2'2&E(2S*11P"/t;/__p*L15+tpx!>l4 R>l7>dir~?)B*?$*Q=3 &~cU>px!>l4 P>l7>dir~?)B*?$*R93#.8__v>7CN8__v>=#4$~pU>px!>l4 S>l7>dir~?)B*?$*V=4$$~kU>px"!>l4" S>l7">dir"~?)B#*?$#*V94 8__v+>7FQ8__v)>=55%5~pU>px3!P>l43  >l73>dir3~?)B4*?$4*P@p%KUAS+U5eAB +U5A qLA&v5bAw~A x~A -[~5BA.Q5A;0Cnow<<Aw=<A+ -W$A-]o Cone-_@A-`(6 2A $Ab /A$ /A Q0AR0A U0A VAW6DE%<+X2m,Pr(_'0Ea  "0@;] &icint 60 >Ee ?EJ AE3 C D^Ejg S U@  0gBLGQiFer  D E# F# S > p##  Jp#B##  w 2>40Y? Mg p'#!p##f 2# # 7 1 !-@- !- >"~# /" # " # Z " # "# "# O"# "# z"# "#$ "#( # "#, E"#0 ("#4 ."~#8 "~#< "#@ "">#D "#p#F @"$#G b"(#H "1#L "7#T \"8#X |":~#\ !"<#` "y ""# "#: "~#M  F  3 b#  9  ~# # # bit~#u32"0m~*+#key,9# n #p #m - m#ref !#< H 0wq 1D#rq 2D#~ 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<U4w x@#ym#z0#  {0#'|0#r}0# ~0#>0# -0#$u#(  B)8#H~ #I0#" #J0#s#K#fd#L~# >#M0#exp#N0#_4#O#4#P#K4#Q# 4#R#$ib#S0 #(ob#S0 #,p #T0#0#U#40  #S>}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@~#8( #< 7#@7#AW#DJ#L #P% #T+ #X_ /tstru#lenv~#p p 0 v  h z$m#L$m# $L# $ #fe$#be$#$~# >$~#$R $0#(req$0 #,rep$0 #0si$!#4 $#m$$#$M#srv$#T$#I $#6 $!#txn$#z $~#$ #$!#1$"# $w#$w#$$װ!#$0#_  < ]e Lny  p#!e # u k auid^&#gid_#}`# buxau  LfdM~#~ N~#LO~#>P#  Q #R~#4$S~#T0#U #Vm#s)W #@XR#&Y #DZ#{ [0#b #I)c#  TQum #n~#Ko~#p~# qp# re# s~#$%4t #(<5u #,v #0w #4_x #8$y #<`zm#@]{~#H|m#L   ~~ ~  ~  CfA #bB0 #&(?cbC#sD#~ E7#evF7# G#He#I~#  J#$  { J ~#get~#put~#u~# # <_D`#?a#setb#clrc# E@d#}?e#remf#clog#:4h0# j8iF#$FAjX#($kF#,FlF#0um#4n~#8~~ ~**~F~*6X*L! R##~#P# m#2^X a^#_%#c`%#aE]+,E#-K#.~#S/# Q 4 ##-'8len'90#cr':0#';0#'F 'Cv'D'# 'Ew#'Fw#)'Gw#2'Hw# r&    < &-&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#+&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#H&rq&}st&D&H &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&+#  &W#8 &~#@&2&r#F&# &6 #req&H#rsp&H#\uri&# &#&#BH&~#>&0#.E 0#^ 0#0#  >IJ#~ K~#" L~#M~# N~# O#: P#q'R#S~# T~#$- T~#(4$U0#,6U0#0lV~#4, V~#8W~#<lXm#@C!YL#H>[M#LT\M#\O>^M#l`~#|oa# b#@d#d#e#g fM#ogw#h~# i~#;i~##j~# j~#6j~#k~#Tl~#Fm~#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guD# v#hw#yi#yi#bz0# {1#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M~#q'hDR # 2#G2#~ ~# L~#j~#}~#M#:Z##,aclm#0{m#8m#@m#H=x##Psrv#\] ~#`7 ~#d`  $#hY#R #~##~#0#~#_~#S# ~#J ~##~#~#V#? #R~#/~#-Ԡ%##~#m#&!%#id#lm#l~#, ~#~#0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0#2#r2#2#2## ~#0#~#0#b0# 1#i#i#i#i#i#i# ! i# i# Ii# ~#cap~# TM# O>M#  ~# o #  # e  H"# m  H"# J p#  p# x~# ~# ~# ~# ~# u~# ~# :~# h E# E# ~# R~# %# U%# # # ]# %# %# ~# o # ~# %# 5  ~# !~# "0# #0# >$"# 2$"#H 3 %% m#%!p #srv%"#  D$ $~#$<# $<# '$<#$#$#  $#$1%$P#(u $P#,,$P#0$i#4I$i#<=!$px$#sv$Ǟ#$w#<$w# >$0# iid$~#H$~#sid$~#T! $$͘#!$iid$~#px$#buf$0#sid$0# ptr$~#bol$~#!$!'$ !$=!!$T! ! !p !"p "HH"p7!>4{un5< in6Ma"p2u7 "#"p ,z{#t0|#t1|#j8}#~#~# (~#$~#(Z#<#len0#pos0# sid0#srv#oe#src#buf+ #x#be!u# 0#<m## srv## ~#~ ~##Xacta"#bcka"#, $act#bck#%~#I ~# ~#~# ~#~#0 ~# #map## ##,N##L %#6%#I8%#'%#%#%%% ~#2~#%8~#9~# >~# ~#T~#C!~#-% % % %6 &E +$+%~#kw+&#N +-1&#1&~~~&_&+5+6m#kw+7_&# n&% &(R;(N~#(O~#L(P~# (Q~# (+ (;uid(<~#gid(=~#(>~#4$(?~# $(@~# (A~#(B~#Y(C~#}(D~# `(E~#$(F~#(4(G#,'(H#0J(I~#4(I~#8x(J~#<(J~#@(K~#D (K~#He (LH"#Lm (LH"#(Rn&# (S #g(T~#":(&2U#cap1~R"c('BU$}B~R%*t&Y~ U$=W$W~ $q'W$2'X#errX$X~&&Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V(M)) c%)c%*q)]j) g%)g%*)nz) g%)g%+)*Կڿ,**)Ta) l%)l%*)er) p%)p%**) t%)t%*<*) t%)t%*`*) y%)y%**) y%)y%**x) ~%)~%**) %)%-) %)%. +2/q'1%G,'~ yU$=S$~ $q'$2'#err$~&~l0cap~'resp)u'tvG,W0tdG,'val0V(+ ) %)%*,Td) %)%+3,M,,`,1l,P,x,2*,*03,&3P414p142~"3-U']U$u$}~ #cap~W&S&p*-) %)%+-*,*2*,*5-''`U6px-W7u 8'S8V-9 %9%- 5O.&3~U72S+-*'3,*+ .*R^,*+$.*,*+;.*,*2*,*5.&X~ U7&W~8YV8 Z S8^&[~W:err[~~8O'\~~:msg].~+.*7C,*2*,* / c;P/ kU:pS2P/>D1a/P1l/P.x/="L~t~+|0010Q,020,1,1+01101Q,:1215101Q,:12P/1a/S,l/.0&~__vj>->__vh>?&U@S!2@B !2@ q@&v>2@w~@ ([~ o2A @)Q^2Bq'((BQ)~@*;0Cnow*<<@+ (W&B`'~T @(a~88'z7&-8/vz () 0Ea  "0@;] &ic 5int 60 >Ee ?EJ AE3 C D^Ejg S U@  0gBLGQiFpr "D"E#"F#1 (-{- (- >)# /) # ) # Z ) # )# )# O)# )# z)# )#$ )#( # )#, E)]#0 ()c#4 .)#8 )#< )#@ )">#D )#p#F @)$i#G b)(y#H )1#L )7#T \)8#X |):#\ !)<#`  )]y ))]# )c#: )#&{ y   3 $S >   # #   J #B # # % wNLny  #!N# ^ k2>40Y^? ig p#!ښ#t#f ܊# # 7  b# -- }  ~# -# -# bit#u32"0~*+3#key,}# n #p # - #ref !# H 0wq 1#rq 2#~ 3#0 4#4 50#8 6#< 7#@ 8#D5U4!w !x#!y#!z0#  !{0#'!|0#r!}0# !~0#>!0# -!0#$u!5#( E B)8#H~ #I0#" #J0#s#K#fd#L# >#M0#exp#N0#_4#O%#4#P%#K4#Q%# 4#R%#$ib#St #(ob#St #,p #T0#0#U#4Et  #S>}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@#8(] #< 7#@7#AW#DJ#L #Pi #To #X+ /tstru#lenv#  t  ] h z#L# #  #fe!#be!## >#$R 0#(reqt #,rept #0si##4 #m$##srv#T#I #6 ##txn#z #"###1$# w#w#$ן##0# c ] auid^1#gid_#}`&# buxa  LfdM#~ N#LO#>P#  Q #R#4$S#T0#U #V#s)W #@X#&Y #DZ#{ [0#b #I)c#  TQum #n#Ko#p# q# r# s#$%4t #(<5u #,v#0w#4_x#8$y#<`z#@]{#H|#L       )CfA #bBt #&(?cbC#sD#~ E7#evF7# G#H#I#  J #$    J #get#put#u# # <_D`#?a #setb #clrc # E@d #}?e #remf#clog#:4h;# j8iQ#$FAjc#($kQ#,FlQ#0um#4n#8 55$Q5Ac5Wp7>4un5%in6p2u7i#*R;*N#*O#L*P# *Q# M+ *;uid*<#gid*=#*>#4$*?# $*@# *A#*B#Y*C#}*D# `*E#$*F#(4*G#,'*H#0J*I#4*I#8x*J#<*J#@*K#D *K#He *L#Lm *L#*R# *S #g*T#! R###P# #2M a^#_%#c`%#a4]+,4#-:#.#S/# @ n4 ##zzn.E 0#^ 0#0#-&8len&90#cr&:0#&;0#MF &Cv&DM# &Ew#&Fw#)&Gw#2&Hw# %          < %S%l%݉#m_l%މ#u%߉#u_l%߉# v%#v_l%#Q%l%#v_l%#c%#c_l%# r%#r_l%#n%rq%st%D%H %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%#sl%Q#  %W#8 %#@%2%#F%# %z #req%n#rsp%n#\uri%# %#%#BH%#>%0# ^!>IJ#~ K#" L#M# N# O#: P#q'R!#S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lX#@C!Y#H>[#LT\#\O>^#l`#|oa# b #@d#d#e#g f#ogw#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v!#hw#yi#yi#bz0# {<#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M#!q'hDR # #G#~ # L#j#}##:%#,acl#0{#8#@#H=%#Psrv#\] #`7 #d` %#hY#R #ĉ##Ɖ#0#ȉ#_ɉ#S# ˉ#J ̉##Ή#ω#E#? #R҉#/Ӊ#-G'##։#ױ#&&#id#l#l#, ##0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0##r#### #0##0#b0# <#i#i#i#i#i#i# ! i# i# Ii# #cap# T# O>#  # o #  !# e  # m  # J p#  p# x# # # # # u# # :# h 4# 4# # R# S'# US'# # # ]# Y'# Y'# # o # # i'# 5  # !# "0# #0# >$$# 2$$#H"3 $$ #$! #srv$"# "D #G# G# 'G###  #$1%P#(u P#,,P#0i#4Ii#<,#px!#svǍ#w#<w# >0# iidʉ#Hʉ#sidʉ#C# ##iidЉ#px!#buf0#sid0# ptrԉ#bolՉ##'˵",#C# #E !# #$ #$p ,z{#t0|#t1|#j8}!#~!## (#$#(%G#len0#pos0# sid0#srv#oe!#src#bufo #%be!uD% 0#<#w% srvw%# #~ #%Xact$#bck$#,%act#bck#&#I # ## ##0 # #mapD%# }%#,N%#L &#6&#I8&#'&#&#&&A' ى#2ډ#%8ۉ#9܉# >݉# މ#T߉#C!#-A' M' i' y'z H"'(5 qU# 4 Q$((LU# K R% M S&errN'(((()P*(+((,(V,(,(, ))h-)_-)-*)-5)P-@)W.K)F.R).Y).`)'y)()/()0  1fd2h)U(k30j4uidj14gidj3}j&5y(lh)5(mh)5>n%6retp5 p7(7X)7)7( y)8)e"T4fdS$*(^U# ] P% _ S'*("*'/*:,<*~)-G*~-R*V-]*P//*)$0 # 8i*(305>%5 ݉6ret݉9x,h)sU:fds&lt ~1su 1tv&cfdw~%%x~;/%9f;$6G;%4$;4(2 ~%$~j72,P"6t?6__p2,54t8,9%/4buf.t 2,qh4tg4fg08-4tǐ9X/)CdU:sB #-BQ%=DX/&argEW@-Zp> ^%>^%@-v> _%>_%+-h/(u/,~/P(/+-h/(u/,~/P(/@.> l%>l%@B. > r%>r%@h.'> v%>v%+./(/'/(/(/(/+./(/'/(/(/(/+//(/'/(/(/(/+'/h/(u/,~/P(/'/GS(/'/GS(/(/(/ h/ 8/(4s 4bt 3S)] A/i0hA/ -0+0p+0,90'pU:s S:reqt V%-W1p+Y00,0R,0Q+r001@,0P@0HV&__sW+00VY(1'0q(020Ak3j4nowj80#(4buft 81h(4buft 95(U:t&s p%z)l%)0h%)0W;;)u;(x;' <1>>0'5<C(5@1Gp%>0R'5QV(5+2+5(85+`2D5(U5(_5+C2D5,U5R,_5V'D5,U5R,_5V+~2D5(U5,_5S+2D5*(U5(_5+2j5Qu(w5(5=Qu-5P+2+5u}(85+ 3j5(w5(5=-5P@%3H>>0+<35`j(5+S30(0+j30(0+35(5+35/2(5'5/2(5+35<W(5'6<E(6+4"6W(36'=6a(N6'6ao,6P++4,(-+B4X6JM(e6+b40Zq,0P,0Q+40v,0P,0Q+40,0P,0Q'X6 (e6+40,0P,0V+40,0P,0V'0,0P,0V8+5%4buft 8D5)t4bufst 2j5"u4t1t4t2t85'c4bufbt 3i?b05'd085'4buft 25"4t25 ~4t}26 v4tu86]3\62=64t2X64t8o6'M4bLt B&)UC'K66 >Cv'L66 ~C'M6CS(6pCB (6C qC&v6)CwC xC *[ 77D C+Q&7C,;0Enow,Ee?EJAE3CD^EjgS U@ 0gBLGQiFpr )D)E#)F# 37 3J3G# p ?3J{1 /-K- /- >0# /0 # 0 # Z 0 # 0# 0# O0# 0# z0# 0#$ 0#( # 0#, E0#0 (0#4 .0#8 0#< 0#@ 0">#D 0#p#F @0$#G b0(#H 01#L 07#T \08#X |0:#\ !0<#`7W Qnz0y 00# 0#: 0#  z  3tm,wx#y#:z#B{# |#}#~#2#\# #$Q#($S> ##  J#B## & wKnK#pK#&z - &#ref!K#U4(w (xb#(y&#(z0#  ({0#'(|0#r(}0# (~0#>(0# -(0#$u(#( # F bF# VV #  ~+# V# V# bit#u32"0~*+\#key,#U H0wq1#rq2#~ 3#04#450#86k#< 7#@8#DeeeU!  R # # # P#  &#2 q R # #z2>40Y?  Eg p#!ڛ##f *# # 7 h B)8 H~ I0#" J0#s K#fd L# > M0#exp N0#_4 Oz #4 Pz #K4 Qz # 4 Rz #$ib S #(ob S #,p T0#0 U#4t t h    S> }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0{ 0#4@ #8( #< 7#@ 7#A W#DJ t #L t #P #T #X  / tstr u#len v#     h  z &#L &# e# N#fe ##be ## # > #$R 0#(req #,rep #0si %#4 #m$ # E#srv O#T O#I O#6 %#txn #z # ## %#1 %# w# w#$ a%# 0#  ] Ln#y # ##! #  k A auid^1#gid_#}`&#T buxa [ LfdM#~ N#LO#>P#  QH#R#4$S#T0#UN#V&#s)Wd#@Xk#&Yj#DZ#{ [0#bA #I)c#H TQump#n#Ko#p# q# r# s#$%4td#(<5ud#,v#0w#4_x#8$y#<`z&#@]{#H|&#L[T dT  H CfAd#bB #2&(?cbC2#sD#~ E7#evF7# GB#H#I#  J#$ B  J #get#put#u# z#H  !!#!#!# !!#!#?!#- !%!&#!'#z!(#5!)# >!*#-!+#!,#!-#  ''#u'#Z'#len' # @'!#D'"#2p"7>"4un"5 in"6EKp"2u"7 # 1R;1N#1O#L1P# 1Q# + 1;uid1<#gid1=#1>#4$1?# $1@# 1A#1B#Y1C#}1D# `1E#$1F#(41G#,'1H#0J1I#41I#8x1J#<1J#@1K#D 1K#He 1L2#Lm 1L2#1RK# 1ST #g1T# ! %a%^#%_%#c%`%#%a@%e \%jI%h,#%%i,# %j7]$+$,#$-#$.#S$/Q# g !4 K##5.E 0#^ 0#0#t-,8len,90#cr,:0#,;0#F ,Cv,D# ,Ew#,Fw#),Gw#2,Hw# 5 +!!!! ! !!!! ! < + r+l+݉#m_l+މ#u+߉#u_l+߉# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#+rq+st+rD+H +0#sol+#eol+#som+0# col+0#sov+0#eoh+0#cap+ڌ#sl+#  +W#8 +#@0+2+#F+t# + #req+#rsp+#\uri+# +#+#BH+#>+0#z-+ -+Q#idx+#val+# +# "O>IJO#~ K#" L#M# N# O#: P#q'R##S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lX&#@C!Ye#H>[E#LT\E#\O>^E#l`#|oa# b#@dO#dO#e#g fE#ogw#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v##hwO#yi#yi#bz0# {<#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M##q'hDRN# *#G*#~ # L#j#}#E#:&#,acl&#0{&#8&#@&#H=&#PsrvO#\] #`7 #d` '#hY#R #ĉ##Ɖ#0#ȉ#_ɉ#S# ˉ#J ̉##Ή#ω#н#? #R҉#/Ӊ#-ԝ##։#&#&(#id#l&#l#, ##0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0#*#r*#*#*## #0##0#b0# <#i#i#i#i#i#i# ! i# i# Ii# #cap# TE# O>E#  # o #  ## e  2# m  2# J p#  p# x# # # # # u# # :# h # # # R# # U# # # ]# )# )# # o # # )# 5  # !# "0# #0# >$E&# 2$E&#HU+#3 ** &#*! #srv*"O# w$D  # G# G# ' G# # #  #$1% P#(u P#,, P#0 i#4I i#< $ px ƃ##sv O# w#< w# > 0# iid ʉ#H ʉ#sid ʉ# %  Q# a% iid Љ#px у##buf 0#sid 0# ptr ԉ#bol Չ#% ' w$ $ % % #% %% t %E&p ,z{+#t0|+#t1|+#j8}##~### (#$#(&G#len0#pos0# sid0#srvO#oe##src#buf #&be#u ' 0#<&# 9' srv9'# #~ #O d'Xact%#bck%#, 'act+#bck+# x(#I # ## ##0 # O#map'# ?'#,Nd'#L (#6(#I8(#'(#(#(Ox( ) ى#2ډ#%8ۉ#9܉# >݉# މ#T߉#C!# ) #) #E)-$+#$u,)8' (&# C))#be-#)# )OB) -?&# _-@&#pol-A# -B0# --C#)s*p(0 1&# C2)# H3# 4# %5# 6# >70# 8# 9#$*Y%-dow-#h1-#m1-#h2- #m2-# +-min-i#max-i#$-ˉ#$-̉# =+->-*#-*#p+-i-ȉ#-*v$-+]%-s*+-ptr-str-reg-ך+!,M%,--&#val-=+#ptr-p+#$-h# len-ډ#$>-ۉ#(8, -p-i-ll-id-8,a-?,H O, ,$0-i-#ptr-#len-#>-# ctx-,#-$-kw-Q# N -'-# )%--# pA--# -0# E&- #!-\!-j+-V-# V--\--A- -!&#kw-"+.#arg-%.# %-&# $-'&#O,----!--.%- -&#kw-.# .,"#+.-%%str-$,h.*2#len# x.# x.W  h.&.09U'iljQ'tmpQ'msgɉS(.6K)__s*K_)__s+V/2r@U,bp ,msgpV/W-Fq\/p- qQS.i?sP/lenst+/+#U,b R,msgV/S-F\/V- Q,lenW.i?P+70c20U,hdrQ,endQV-uQ,lenW0valQR+0.QU,sQP,eQS.,V.,Q+[1~/ U-uQ,len ,solQW,idx\/R,ctx[10eolQV0sovQS./p13 1!-s2G1a13r14~13105~1/<6;\/51@1160\/+1. U-uQS,solQ ,idx\/,ctx [172 *U,t S,sit R,err-) -BHW,msg2V2v2282Q222'^3242^c322 920~:buf} 92%:buf +34)3U,s( S-2(Q ;m317qU,str6Qp,len6l0m87P0h9m3Ss3 1.;3+PCU,txnO3P0ptrQQ0endQSK7(6/__vE>*7G/__vD> 6?6@now6@tm6 <57h*:tv17:tv277 GAX7JP@tv1I7@tv2I7/retKP8~131B0__p~Q+49?-Q0U,msgV/V-.QW-~ 0S,ptrQR,endQQ-.-A+49 1o,1A*E11212101/1,z1*a0+3:.(QU,msg%V/S-.%Q -~ &0P,ptr&QR,end&QQ-.'W-A+'49 1,-1A*1.C1,L}13YC1E.dO10m10N111[h1,f<<.U,buf ,msgV/W,idx\/.~ 0R0ptrS0endV1A*1",u1o,1)1N*^121!3J111,%!18/12;1*1*U13i1/1P2zU1o0n10r1,-K1/`2;<Lr3 <8<w 8#<R2;<3 <8<w 8#<R4.<3;<*>G<9.<r*F6E\/:lenE:crE9R<~%"6!\/C)e$5<<,UuU,esR<S,sR p,bufS W,msgSV/V-/T#lE&+> -U,t -#P0txn3d.-`.!\=p/./V0hSDX=0__sW2o=a1 (3r1D=0/len2=>3>2=>8)>Q2=5>3B>2=N>Ol3[>3d>3m>BH0msg2 h9>h(:buf 95>':buf 9N>#(:buf 9y>(:s :b 6S) +?2l U,sk S,reqk V0txnm 3W2>?8?P8?R4!73373?7B`EK7P5+?Ak6j:nowj+o@h1 5 U,s ,req  0msg V/W.+ PT.' i@0ctx 0X17. < (@9( ./ 0PB/c B0hex 0R*. P2!@?  3?8?P28@>  3>4o@  8@R8@P4@  8@P3@5@#W:nowV6&V5@="L:nowK6&K 3A*P i 0ret P9 B|+:buf +C* p U,t ,req  ,exp .FA s.Z/ S._- V.// l=/ .9* h.+ d0txn 3`.. W0len P. P4a1  3r1+Cu-p +U,to ,reqo  ,expo W.FAq s.Z/r l._-r V.c*s h0txnt 3S0lenu P.u P4<3 <8<P8#<R+6D'1 0U,t W,req  ,exp S0txn 3VB0ret P<)FC3H@U,tG ,rtrG  0txnI3D0p1J@0p2JS0p3J0p4J.,LS./MH.Z/O._-OV.//O./P.9*P.PS2BEa13r1DjE..Y0valZRDE..%VDEH0__pQDEh0__pQ4o@8@R8@P4@8@P3@DF.*VB0__pQB0__pQ0 #DM.Z/ S._- V.// \./ X.9* T. P0val P.. P4a14+7+3r12N>,,3)>45>,,3B>25NOO/m/3O3O2bN!7m//3373?7*m//EK7P(~N-120lenL S(Na230eol V0sol W2Na1223r14~122312N>X3^33)>2O5>c3p33B>2O>(4.43)>2.O5>34@43B>2EO>443)>2\O5>443B>2sO5>553B>2O>.6163)>4>k6x63>9O_,:buf 6 +UZ06OU,s ,req  ./ W0txn 30msg V/.4 #~11Q @1+_ Q81+3 ?DP.C)W.BUS=>0#DP0ret$PB(0retRB`0rdr .+QR2QV893V448884R34DQ.Z/RV._-RW.//R~./S~.9*S~.SP0valSP..T~4a1c9f93r1DR.BVWDQ0retR4V<<3V44<<84R3422RVr==3V44y==84R342NRO ?'?3O3O2gR2Q??82R2~R>??3>2Ro@??8@Q8@P2R@??8@P3@2R@??8@P3@2 SVAA3V44AA84R34D\S0lenPWB. i0ctx 04>BB3>DS0.0Q~.,VBP0qsPDSh0lenS0pnKVDS0lensS0pntKW(5THH0eolS0solV2!Ta1%H0H3r14~1FHMH31DaT.C)VB0retPDyT0__pQ(TdII.1SDT.P._-S4<6JnJ3 <8<P8#<R2T4nJJ34DU0lenS0pn V28U?+M.M3>2Uo@AMdM8@R8@P4@YMbM8@P3@2U4MM342U>>NAN3>DU0ctx044cO|O34)9VM& N:be M#E) 0V -;V2OLPU- ~\S-0D~!-W-$0~j/len.2P;W43PPPU,px#,l4  ,l7R,dir-)BV--$-Q.2P/txn3;`W1PQU-$-Q-0D!-S=1;W-QQQU- \S-0D!-V-$0j;@X/`QQU,px#,l4  ,l7P,dir-)BV--$-V/txn30ptrR0lenQ;X<,QRU,px#,l4  ,l7P,dir-)BV--$-V/txn30ptrR0lenQ;Y\+ RRU,px#,l4  ,l7R,dir-)BV--$-V/txn3/ptr0len P4YQRsR8YQ8YS*VRsREYR5Y0:sQ:len)i0;IZg-RRU,px#,l4  ,l7R,dir-)BV--$-Q/txn3;Z/5RCSU,px3#P,l43 V,l73R,dir3-)B4V--$4-S/txn63;U[3UPSSU,pxS#P,l4S S,l7SR,dirS-)BTV--$T-V/txnV3*SS/__vd>;[3sS{TU,pxq#P,l4q R,l7qP,solq -)BrV-W-$r-S/txnt30idxu\/Q0ctxv[1V;e\m+TTU,px#V,l4 S,l7Q,dir-)BV-R-$-P/txn3;\+TUU,px#V,l4 S,l7Q,dir-)BV-R-$-P/txn3;]0UoUU,px#P,l4 R,l7P,sol -)BV-W-$-/txn30idx\/V0ctx0X0cntS;]X.pUUU,px#V,l4 S,l7Q,dir-)BV-R-$-P/txn3;y^+0UUU,px#V,l4 S,l7Q,dir-)BV-R-$-P/txn3;_,VVU,px#P,l4 R,l7P,sol -)BV-W-$-V/txn30idx\/Q0ctx[1S;_y3 VVU,px #V,l4  S,l7 Q,dir -)B V-R-$ -P/txn 3;`L,W?WU,px#V,l4 S,l7Q,dir-)BV-R-$-P/txn3;`00@WWU,px.#,l4.  ,l7.P,dir.-)B/V--$/-S/txn130ptr2P0end2VF+WWUG.K`` >Gv.L`` ~G.M`GS/`GB /`G, G G&v3aGwG 1[ daH GQSaG;0InowLe?LJAL3CDeEjgS U@ 7-gBLGQiFpr #D#E##F#1 '-{- '- >(%# /( # ( # Z ( # (# (# O(# (# z(# (#$ (#( # (#, E(]#0 ((c#4 .(%#8 (%#< (#@ ("E#D (#w#F @($i#G b((y#H (1#L (7#T \(8#X |(:%#\ !(<#`  (]y ((]# (c#: (%#&{ y   3% %$SE ##   J#B# # 0 w{W!ڥ#ۺ#f # #LnWy  #! #2E47Y? g p# >    b # .. ~   ~ #  .#  .# bit %#u32 "7~ * +4#key ,~# n #p # - #ref !# H 0wq 1#rq 2#~ 3%#0 4%#4 57#8 6#< 7#@ 8%#D6U4"w "x#"y#"z7#  "{7#'"|7#r"}7# "~7#>"7# -"7#$u"6#( F B)8H~ I7#" J7#sK#fdL%# >M7#expN7#_4O&#4P&#K4Q&# 4R&#$ibSu #(obSu #,p T7#0U#4  Fu  S>}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#, 7#0{ 7#4@%#8(^ #< >#@>#A^#DJ #L  #P #T #X, /tstru#lenv%#  u  ^ h z #L # # #fe #be # %# > %#$R 7#(req u #,rep u #0si %#4 #m$ # 6#srv #T #I #6 %#txn #z %# $# %#1 &# ~# ~#$ ׳%# 7#  & %#J&!%# &"%#&# # d ] k auid^1#gid_#}`&# buxa  LfdM%#~ N%#LO%#>P#  Q #R%#4$S%#T7#U#V#s)W&#@X#&Y#DZ#{ [7#b #I)c#  TQum,#n%#Ko%#p%# q# r# s%#$%4t&#(<5u&#,vL#0wL#4_xL#8$yL#<`z#@]{%#H|#L  &%% < L% <sCfA&#bBu #&(?cbC#sD#~ E>#evF># G0#H#I%#  JQ#$ R Q J %#get%#put%#u%# #6 <_D`#?aK#setbK#clrcK# E@dK#}?eK#remf]#clog]#:4hz# j8i#$FAj#($k#,Fl#0um#4n%#8K%%6]Qtt%Wc%tt-%8len%97#cr%:7#%;7#8F %Cv%D8# %E~#%F~#)%G~#2%H~# $    < $>$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#<$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#Y$rq$st$D$H $7#sol$#eol$#som$7# col$7#sov$7#eoh$7#cap$#sl$<#  $^#8 $%#@$2$#F$# ${ #req$Y#rsp$Y#\uri$# $#$#BH$%#>$7#! R##%#W# #2: !a!^#!_,#c!`,#!a] + ,# -# .%#S /# E :4 ##Hq'hD# #G#~ %# L%#j%#}%#6#:!#,acl#0{#8#@#H=!#Psrv #\] %#`7 %#d` f"#hY#R #%##%#7#%#_%#S# %#J %##%#%#Л#? #R%#/%#-###%#ײ#&g##id#l#l%#, %#%#7#w7#}7#7# # 7### 7#p#yp# p#4$7#7#X7##r#### %#0#%#7#b7# <#p#p#p#p#p#p# ! p# p# Ip# %#cap%# T6# O>6#  %# o #  # e  v# m  v# J w#  w# x%# %# %# %# %# u%# %# :%# h # # %# R%# ## U## # # ]# ## ## %# o # %# $# 5  %# !%# "7# #7# >$"!# 2$"!#HN.E 7#^ 7#7#vp7>4un5{in66p2u7N#  3  #! #srv" #  >"J #~ K%#" L%#M%# N%# O#: P#q'R#S%# T%#$- T%#(4$U7#,6U7#0lV%#4, V%#8W%#<lX#@C!Y#H>[6#LT\6#\O>^6#l`%#|oa# bQ#@d #d #e#g f6#og~#h%# i%#;i%##j%# j%#6j%#k%#Tl%#Fm%#ido#p7#Z p7#q7#r7#ms7##t7#Vt7#gu# v #hw #yp#yp#bz7# {<#}p#}p#~p#~p#p#&# 7#p# p#p#Ip#M%#"!p ,z{#t0|#t1|#j8} #~ #%# (%#$%#(!G#len7#pos7# sid7#srv #oe#src#buf #!beu! 7#<#" srv"# %#~ %# A"Xact #bck #,f"act#bck#U#%#I %# %#%# %#%#0 %#  #map!# "#,NA"#L a##6a##I8a##'a##a##a# U## %#2%#%8%#9%# >%# %#T%#C!%#!-#! # $ ${ $D  %# G# G# ' G# # #  #$1% W#(u W#,, W#0 p#4I p#<@% px #sv Ǜ # ~#< ~# > 7# iid %#H %#sid %#W%  #% iid %#px #buf 7#sid 7# ptr %#bol %#% ' $ @% W% %F % %&  &]&,R;,N%#,O%#L,P%# ,Q%# '+ ,;uid,<%#gid,=%#,>%#4$,?%# $,@%# ,A%#,B%#Y,C%#},D%# `,E%#$,F%#(4,G#,',H#0J,I%#4,I%#8x,J%#<,J%#@,K%#D ,K%#He ,Lv#Lm ,Lv#,R&# ,S #g,T%#"6(4L%WXU#K5L%S#4L6(Q# 5L%R#5L6(V$lenL,W#>LWP%LS&(5 % XaZU'si p'bu S(5 %l( %h)ret %Q)max %d*(S4>pZZU'si= S"E*4%ZaU$fd%+si p+bu S+ret%Q+max%W%%l%B5%h%54%d,F"_,t4_,"\-)[[)fwdE%R.)((4%V/)E*`]]0V*V1_*/*i*]R^1z*1*2@3*V3*Q4*4*3*V5*8_Q_0*R0*P5*G_O_0*P1+6i*qh7tg7fg76*4h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6*#W%7nowV%:&V%6+="L%7nowK%:&K%*:+4aSbU'si S;t,05%`bQeU'fd%)si W)bu S(%p,F"d,"c,e4b/+*bc0*R0*P5*bc0*P1+/,t,cc1,/;,*c.c0*V0*P5*#c+c0*P1+/Y,E*`cc0V*S1_*5E*,d/d0V*S1_*6,*4D%:C%*-4Y`egU'siX V)ibZu W)ob[u S)fd\%p/-*!f:f0*R0*P5*0f8f0*P1+/R-*Df]f0*R0*P5*Sf[f0*P1+5*ff0*R0*P5*ff0*P1+*-?4gzgU'si R)ibu P*.4giU'si V)obu S(%P,"#h/.t,ThWh1,/Y.*^h}h0*W0*P5*rhzh0*P1+/w.E*hh0V*S1_*/.*hh0*R0*P5*hh0*P1+5*i,i0*R0*P5*&i*i0*P1+Ee ?EJ AE3 C D^Ejg S U@  01 -- -> ~#/ # #Z #  # #O # #z #  #$ #(# #,E #0( #4. ~#8 ~#< #@ ">#D #p#F@ $ #Gb (#H 1#L  7#T\ 8#X| :~#\! <#`   y  #  # : ~#   / 3iFcr D E# F#gBLGQ n #p #  - #ref !#xU4w x# y# z0# {0# '|0# r}0#  ~0# >0# -0#$ ux#(   b#    ~### bit~#u32"0?~* +#key, # H0wq1#rq2# ~ 3~#0 4~#4 50#8 6#< 7#@ 8~#D?)!  R# # ~# P# #2] R]# ]#4 # #)2>40Y? g  p# $S >*   # *# : q J # B #  q#  w !# ۺ# f #  # 7 B)8!H ~ !I0# " !J0# s!K#fd!L~# >!M0#exp!N0# _4!O# 4!P# K4!Q# 4!R#$ib!S #(ob!S #, p !T0#0 !U#4  !S >}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 { 0#4 @~#8 ( #< 7#@ 7#A W#D J#L #P  #T  #X4 /tstru#lenv~#E E  K  h z "# L"# "# "#fe" #be" # "~# >"~#$ R "0#(req" #,rep" #0si""#4 ":# m$":# "#srv"\# T"\# I "\# 6 ""#txn"# z "~# " # ""# 1""#  "w# "w# $"n"# "0#4   ]: Ln y  # !: # J k} auid ^y#gid _c# } `n# bux aJ  Lfd M~# ~ N~# L O~# > P:# Q#  R~# 4$ S~#  T0#  U#  V# s) W# @ X# & Y# D Z# { [0#  b} # I) c# T Q u m#  n~# K o~#  p~# q# r#  s~#$ %4 t#( <5 u#,  v#0  w#4 _ x#8 $ y#< ` z#@ ] {~#H  |#L  ~~~  ~CfA#bB #n&(?cbCn# sD# ~ E7#evF7# G~# H# I~# J#$ ~  J  ~#get~#put~# u~# #p7>4un5 in6p2u7#_(R ;(N~# (O~# L(P~# (Q~# + (;uid(<~#gid(=~# (>~# 4$(?~# $(@~# (A~# (B~# Y(C~# }(D~# `(E~#$ (F~#( 4(G#, '(H#0 J(I~#4 (I~#8 x(J~#< (J~#@ (K~#D (K~#H e (L#L m (L# (R# (S # g(T~# a ^# _%# c`%#aD]+ ,D# -J# .~# S/# P -%8len%90#cr%:0#%;0#F %Cv%D#  %Ew# %Fw# )%Gw# 2%Hw# U 0$!!!! ! !!!! ! < $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#$rq$;st$D$ H $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$ڬ#sl$# $W#8 $~#@P$ 2$0# F$#  $ #req$#rsp$#\uri$# $# $# BH$~# >$0#.E  0# ^ 0# 0# "\>I J\# ~ K~# " L~# M~# N~# O# : P# q'R # S~# T~#$ - T~#( 4$U0#, 6U0#0 lV~#4 , V~#8 W~#< lX#@ C!Y#H >[#L T\#\ O>^#l `~#| oa# b# @d\# d\# e# g f# ogw# h~# i~# ;i~# #j~# j~# 6j~# k~# Tl~# Fm~#ido# p0# Z p0# q0# r0# ms0# #t0# Vt0# gu# v # hw\# yi# yi# bz0# {/# }i# }i# ~i# ~i# i# &P# 0# i# i# i# Ii# M~# q'hDR # # G# ~ ~# L~# j~# }~# # :##,acl#0 {#8 #@ #H =##Psrv\#\ ] ~#` 7 ~#d ` $#h Y# R # ~# # ~# 0# ~# _~# S# ~# J ~# # ~# ~# c# ? # R~# /~# -&# # ~# ׋# &%#id# l# l~# , ~# ~# 0# w0# }0# 0# P# 0# #P# 0# i# yi# i# 4$0# 0# X0# # r# # # # ~# 0# ~# 0# b0# /# i# i# i# i# i# i#! i#i#Ii#~#cap~#T#O># ~#o #  #e  #m  #J p# p#x~#~#~# ~# ~#u~#~#:~#h D#D#~#R~#)&#U)&#]#]#]]#/&# /&#~#o #~#?&#5  ~#!~#"0# #0#>$Y##2$Y##Hb 3 # # # #!E #srv#"\# !D" "~# ":# ":# '":# "# "#  "#$ 1%"P#( u "P#, ,"P#0 "i#4 I"i#<!"px"Ɛ #sv"\# "w# <"w# >"0# iid"~# H"~#sid"~#" " "Ͷ#n""iid"~#px"ѐ #buf"0#sid"0# ptr"~#bol"~#""'"˄!"!"" "  "E ""E "HY#p ,z {#t0|#t1|# j8} # ~ # ~# (~#$ ~#(# :#len0#pos0# sid0#srv\#oe #src:#buf ##be u$  0# <#M$ srvM$# ~# ~ ~#\x$Xact"#bck"#,$act#bck#% ~# I ~# ~# ~# ~# ~# 0 ~# \#map$# S$#, Nx$# L %# 6%# I8%# '%# %#%\%&  ~# 2~# %8~# 9~# >~#  ~# T~# C!~#-& #& ?& O& #&5W~ijU$5X~D%&&i?j&''`&'(&x)'R*'jj+,'%&6'LjQj,G'P+R'*^'ijj+k'-'P".t/.__p-6'50t-^'="L~0nowK~1&K~2w'1 #'5#~jkU$5$~H35%~4s&\S4p' W5jk$5/~V$5/~p#(t5gk*mU6tf4ph p$5i(l$5jS$c)jW4ik~h%o((@lPl,(P+(%(6'll,G'P+R'7(ll.lent~'3j}c-(Ak~1j~0nowj~#R)]D~0mVmU85P85P353556mJm3 %3%9w)`mmU85S9>*a5m}nU4p S%(*>*m9n+O*%)Y*mn+j**t*mn+***mm+***n9n+*** n9n+*** nn,*P**9n[n,*Q-Y*"0t-t* ~0t}-* v0tu2*]1\*-*0t-*0t2*0t:S+:B +:D+;,] ;4 ;  ~ :&vk+:w~ +< :&Q~+:';0=now'<::+ (W_:(] >q'< : Q0:R0: U0: V]:W*$5@M=Ҥn(79!0Ea "0@;]&ic5int60>Ee?EJAE3CD^EjgS U@ 0gBLGQiFpr $D$E#$F#1 +-{- +- >,# /, # , # Z , # ,# ,# O,# ,# z,# ,#$ ,#( # ,#, E,#0 (,#4 .,#8 ,#< ,#@ ,">#D ,#p#F @,$#G b,(#H ,1#L ,7#T \,8#X |,:#\ !,<#` 7 6 B  ,y ,,# ,#: ,#I{B3$S> ## 8J#B#8#Hwtq6 7# o8#2>40Yt? g p#!ڽ#ۊ#f ܠ# #73 b3#CC  ~# C# C# bit#u32"0~*+I#key,#n#p# - #ref!# H0wq1#rq2#~ 3#04#450#86#< 7#@8#D KU4"w "x*#"y#"z0#  "{0#'"|0#r"}0# "~0#>"0# -"0#$u"K#([ )B)8&H~ &I0#" &J0#s&K#fd&L# >&M0#exp&N0#_4&O;#4&P;#K4&Q;# 4&R;#$ib&S #(ob&S #,p &T0#0&U#4 5 5[)  &S>#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#, #0#0{ #0#4@##8(#s #< #7#@#7#A#W#DJ#5#L #5#P# #T# #XA /#tstr#u#len#v#   s h #z%#L%# %# %#fe%Z"#be%Z"#%# >%#$R %0#(req% #,rep% #0si%b$#4 %#m$%#%#srv%&#T%&#I %&#6 %r$#txn%i#z %#%"#%$#1%$# %w#%w#$%8$#%0# y  ] Lny  #! # k auid^1#gid_#}`&# buxa  LfdM#~ N#LO#>P#  Q #R#4$S#T0#U#V#s)W%#@X#&Y+#DZ#{ [0#b #I)c#  TQum1#n#Ko#p# q# r# s#$%4t%#(<5u%#,vQ#0wQ#4_xQ#8$yQ#<`z#@]{#H|#L  % AQ AxCfA%#bB #&(?cbC#sD#~ E7#evF7# G#H#I#  J\#$W\ J #get#put#u# Q# A <_D`#?a[#setb[#clrc[# E@d[#}?e[#remfm#clogm#:4h# j8i#$FAj#($k#,Fl#0um#4n#8V V A m Va   bs   p7>4un5 in6p2u7#:0R;0N#0O#L0P# 0Q# + 0;uid0<#gid0=#0>#4$0?# $0@# 0A#0B#Y0C#}0D# `0E#$0F#(40G#,'0H#0J0I#40I#8x0J#<0J#@0K#D 0K#He 0L#Lm 0L#0R# 0S #g0T#! R###P# #23 a ^# _%#c `%# a]+,#-#.#S/# > 34 ##   .E 0#^ 0#0#K-)8len)90#cr):0#);0#F )Cv)D# )Ew#)Fw#))Gw#2)Hw#  (          < (I(l(݉#m_l(މ#u(߉#u_l(߉# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(IcD(H (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(c#sl(#  (W#8 (#@(2(#F(K# ( #req(#rsp(#\uri(# (#(#BH(#>(0#Q-( -(#idx(#val(# (# `t!&> I J&#~ K#" L# M#  N# O#: P#q' RZ"# S#  T#$- T#(4$ U0#,6 U0#0l V#4, V#8 W#<l X#@C! Y#H> [#LT \#\O> ^#l `#|o a# b\#@ d&# d&# e#g f#o gw# h# i#; i## j# j#6 j# k#T l#F m#id o# p0#Z p0# q0# r0#m s0## t0#V t0#g u# v`"#h w&# yi# yi#b z0# {<# }i# }i# ~i# ~i# i#& # 0# i# i# i#I i#M #`Z"q'hD R # #G #~ # L #j #} # #: %#,acl #0{ #8 #@ #H= %#Psrv &#\] #`7 #d` `&#hY #R # ĉ# # Ɖ# 0# ȉ#_ ɉ#S # ˉ#J ̉# # Ή# ω# Д#? #R ҉#/ Ӊ#- '# # ։# #& a'#id #l #l #, # # 0#w 0#} 0# 0# #  0## # 0# i#y i# i#4$ 0# 0#X 0# #r # # # # #0 # # 0#b 0# <# i# i# i# i# i# i# ! i#  i# I i#  #cap # T # O> #  # o #  Z"# e # m # J p#  p# x #  #  # # # u #  # : # h #  #  # R #  '# U '#  #  # ] #  '# '#  # o #  #  (# 5 #  !#  "0# #0# > $%# 2 $%#H,"3 '' #'! #srv'"&# N#D% %#%G# %G# '%G#%#%#  %#$1%%P#(u %P#,,%P#0%i#4I%i#<#%px%Z"#sv%&#%w#<%w# >%0# iid%ʉ#H%ʉ#sid%ʉ## %%#8$%iid%Љ#px%Z"#buf%0#sid%0# ptr%ԉ#bol%Չ#b$%'%N#%#%#r$[f" $ x$ $ 5$%p , z {#t0 |#t1 |#j8 }`"# ~`"# # ( #$ #(%  G#len 0#pos 0# sid 0#srv &#oe Z"#src #buf #% be Z"u %  0#< #& srv &# #~ #&;&X act $#bck $#,`& act #bck #O'  #I # # #  # #0 # &#map %#  &#,N ;&#L ['#6 ['#I8 ['#' ['# ['# [' &O''  ى#2 ډ#%8 ۉ#9 ܉# > ݉# މ#T ߉#C! #-' '( ( p(Y%*dow*#h1*#m1*#h2* #m2*#(*min*i#max*i#$*ˉ#$*̉#(*>*Ϡ#*Р#)*i*ȉ#*p(v$*ѷ(]%*(9)*ptr*str*reg*9)3)M%,**#val*(#ptr*)#$*0# len*ډ#$>*ۉ#() *p*i*ll*id*)a*)H)?*$0*i*#ptr*#len*#>*# ctx*)#*$*kw*# N **# )%*Y+# pA*t+# *0# E&* #* $ * +?)** Z"  * S+*S+A* *!#kw*"+#arg*%+# %*&# $*'#)*t+ S+ *_++%* *#kw*+#+?*!"+*%#str*$?*$],:noU%pxZ"&op&totW'Yl&cur&Q'7&V(M,&maxɉh)*vω+,:MopU%pxLZ"Q&srvN&R,,oo-,-,.,6;/~ :/B6:+,36i papU%pxhZ"R+B-"7{pppU%srvz&S&p|Z"V08p,,pp-,-,+-+8p^qU%srv&S&pZ"V08q,, qq-,-,$.k6`qrU%pZ"W&srv&S':V&actp&bckl1rr2w`1rr3t 4/88rtU5srv7&S2p9Z"W2grp:/P68es6W7bs7.,rr-,-,7.,rs-,-,(.8p R&R7.,mss-,-,7/!/st-//,:/st9G/P,Y/tt-g/$::/E:I;sH&06tvU5pZ"V2srv&S?:7|0,8vMv-,-,,/Mvv9 0W-04.1o8v8wU5s&Q3pZ"2grp/R70.1vv-<1)@F1P7 1S1vw-a1,l1w$w-z1)@1P:S17;s&3grp/:l16x;sw&:19~;s}&3grp/452=7r@wbxU5srvq&S2psZ"V2grpt/W68gw6W7Cx72,cwgw-,-,7 2,ww-,-,)(8p &P43\9pxzU5srv&W?6?62pZ"p2grp/l72,xx-,-,72,xx-,-,72!/{yy-//,:/{yy9G/PA3@zz87Q?f67F3!/zz-//,:/zz9G/P7r3!/zz-//,:/zz9G/V,/zz9 0S-0437k{c{U5sj&V733 {1{-3,:/ {1{9G/S, 41{\{-4: 48X;sW&:"4E9a;s`&45D8yp{W|U5srvx&S2pzZ"V68{6W7{74,{{-,-,74,{{-,-,(4@8p &R74, ||-,-,7536|H|-3,:/6|H|9G/P,5H|W|-%5:05v9R;sQ&456`|{}U5srv&S2pZ"V68|6W7\}75,||-,-,75,||-,-,(5X8p &P, 4)}\}-4469}FU5srv&S?6?62pZ"p7C6,}}-,-,7_6,}}-,-,7v6 4~~-4,3&F-3,:/&F-G/> 79PiU5pZ"V2srv &S?:!76,-,-,, 4"-4B7j7t&pU5pxsZ"5urisVCs8?uPp2pvS88wl88xhB89&cU5s P8?PT2txn8W2req V2msg8S2pxZ"P880L8+PR2lenPH88D2ctxX2pS)p8/0W1у3c)2hex0R18PiBb9X6&pU5s S8?PW3txn82msg8T2pxZ"V880P2lenPS2ctx X2p!Q1A89?LB=k:sƎU5sr 89u&p2errvV6Dout"79=;y-=9=P(92lenW7<:>·9.>W98>D)@C>S@N>@@Y>V@d>7~:p> ->9>W9>V)@>X@>R@>T7:>->9>V->(:@>Q@>P1OTE?7;?-$?9.?W(; @:?P@F?\@R?V7I;k?-|?,?-?,?9?P-?)H@_?S,?ɉ-?,?ɉ-@1ɉ@@P,?9?P-?7?=@9-0@9:@l(;`@F@W@R@h@^@d@j@V@v@`F@,7j<@p-@)@@Q@@R,k?p}-|?,?p}-?,?p}9?P-?7<@-@)@@PA<ЊE@7<k?Њ9|?P,?ӊ-?,?ӊ9?P-?,S1 -a17=@n-A-A,!/n}-//,:/n}9G/P7=>D9.>W98>P)@C>S@N>L@Y>V@d>H7=k?-|?,?-?,?9?P-?,/V9 0S-0.>8FGsF>GpF> > `> ,.p>65&Gpx4Z"/::4&H:6H{66*srv7&HT97&.>7&GpxZ"Guri/H?P*cH~7.?9z&GpxxZ"/>yGleny*h{0*l{0I*__v0Jk?"9B&;pAZ"=::A&3srvC&?T9C&?DS/I3sW&.?7S// 6`"J?Q6?= 5`"IJ??=~*C=]E0.?CS//BS/J@T?=S?3tUCJ@V:&;pZ"=::&3srv&?m&?T9&3grp/? :K60J@7&;grp/?S/3s&I?x7S/:@y:;grp/?9`":A%:;grp/;s&BA:ЎDU5s SAAHd3__v*>AuAHS3__v*>1S^3__v*>13__v'>AA 3__v'>1 3__v'>BB8_PۑU5s^ V2p`r$P2erraSB:DI6U5s 3fd2errP(C8# :DT2retP8>L1'8"'H2src(X7B@D6v9MDQ9XDS7CdDݓ9uDQ1ݓ@D@12__v=>P71CD-D(eC8#\:DW2ret]S8>]S(C82msg7CD9DQ9DP7CD+39DP-D7C@D`9MDQ9XDS7C@D9MDQ9XDS7D@D&9MDQ9XDS,@D89MDQ9XDSS7GHI%-[I,hI%-{I-I-I7GHI-@-[I,hI-@-{I-I-IA.H^? D%?D%1^?[D8RDPATH? L%?L%7HHI-[I,hI-{I-I-I,HIӟ-[I,hIӟ-{I-I-IAH ? ]%?]%AI? i%?i%)2begyV3endy1mz? %?%LhI i= hLI -= +=p +c= ,M2J:0ĢU5pxZ"S5l4  5l75dirC)B*VC$S+W1av? %?%MJ6ТU5pxZ"S5l4  5l75dirC)B*WC$S+V89&R1? %?%MdK6"U5pxZ"S5l4  5l75dirC)B*VC$S+W1ѣ? %?%MK80U5pxZ"S5l4  5l75dirC)B*VC$S+W1av? %?%N`8 ҤUOS+LpOB +LOD+LOv-LCLIL ~O-MCLO qbO&vuLxOwLPO.QLO/;0Qnow/Ee?EJAE3CD^EjgS U@ 0gBLGQiFer "D"E#"F#1 %-p- %- >&~# /& # & # Z & # &# &# O&# &# z&# &#$ &#( # &#, E&R#0 (&X#4 .&~#8 &~#< &#@ &">#D &#p#F @&$^#G b&(n#H &1#L &7#T \&8#X |&:~#\ !&<t#`   &Ry &&R# &X#: &~#p n   3 $S >   # #    J #B # #  w2>40Y? %ag p;#!ڏ#0#f F# # 7    b #  9   ~ #  #  # bit ~#u32 "0m~ * +#key ,9#n#p#m - m#ref!#< H0wq1D#rq2D#~ 3~#04~#450#86R#< 7#@8~#DLLL<U4!w !x#!ym#!z0#  !{0#'!|0#r!}0# !~0#>!0# -!0#$u!#(  B)8H~ I0#" J0#sK#fdL~# >M0#expN0#_4O#4P#K4Q# 4R#$ibS0 #(obS0 #,p T0#0U#40  S>}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@~#8( #< 7#@7#AW#DJ#L #P% #T+ #X_ /tstru#lenv~#p p 0 v  h zm#Lm# L#  #feC#beC#~# >~#$R 0#(req0 #,rep0 #0si=$#4 #m$#a#srv#T#I #6 M$#txne#z ~#x"#_$#1v$# w#w#$$#0#_  < ]e Lny  #!e # u k auid ^&#gid _#} `# bux au  Lfd M~#~ N~#L O~#> P#  Q # R~#4$ S~# T0# U # Vm#s) W #@ XR#& Y #D Z#{ [0# b #I) c#  T Qu m # n~#K o~# p~# q# r#  s~#$%4 t #(<5 u #, v #0 w #4_ x #8$ y #<` zm#@] {~#H |m#L   ~~ ~  ~  CfA #bB0 #&(?cbC#sD#~ E7#evF7# G#H#I~#  J#$   J ~#get~#put~#u~# #G-$8len$90#cr$:0#$;0#F $Cv$D# $Ew#$Fw#)$Gw#2$Hw# #    < #E#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#E_D#H #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#_#sl##  #W#8 #~#@#2##F#G# #6 #req##rsp##\uri## ####BH#~#>#0#V! R##~#P# m#2X a^#_%#c`%#ag]+,#-#.~#S/#  $4 #6#00V$HIwq'hD # F#GF#~ ~# L~#j~#}~#a#: #,aclm#0{m#8m#@m#H= #Psrv#\] ~#`7 ~#d`  #hY#R #~##~#0#~#_~#S# ~#J ~##~#~##? #R~#/~#-F"##~#m#&!#id#lm#l~#, ~#~#0#w0#}0#0# w# 0##w# 0#i#yi# i#4$0#0#X0#F#rF#F#F## ~#0#~#0#b0# 1#i#i#i#i#i#i# ! i# i# Ii# ~#cap~# Ta# O>a#  ~# o #  C# e  # m  # J p#  p# x~# ~# ~# ~# ~# u~# ~# :~# h # # ~# R~# R"# UR"# a# a# ]a# X"# X"# ~# o # ~# h"# 5  ~# !~# "0# #0# >$# 2$#H.E 0#^ 0#0#p7 >4un5< in6ap2u7# !53  m#!p #srv"# >"J#~ K~#" L~#M~# N~# O#: P#q'RC#S~# T~#$- T~#(4$U0#,6U0#0lV~#4, V~#8W~#<lXm#@C!YL#H>[a#LT\a#\O>^a#l`~#|oa# b#@d#d#e#g fa#ogw#h~# i~#;i~##j~# j~#6j~#k~#Tl~#Fm~#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guD# v#hw#yi#yi#bz0# {1#}i#}i#~i#~i#i#&w# 0#i# i#i#Ii#M~#5p ,z{#t0|#t1|#j8}#~#~# (~#$~#( <#len0#pos0# sid0#srv#oeC#src#buf+ # beC uC 0#<m#v srvv # ~#~ ~# Xact#bck#, act#bck#!~#I ~# ~#~# ~#~#0 ~# #mapC # | #,N #L !#6!#I8!#'!#!#!!@" ~#2~#%8~#9~# >~# ~#T~#C!~#-@" L" h" x"6 )#D ~#<# <# '<###  #$1%P#(u P#,,P#0i#4Ii#<#pxC#sv#w#<w# >0# iid~#H~#sid~## ͘#$iid~#pxC#buf0#sid0# ptr~#bol~#=$ ')# Π# ַ# M$ _$p S$v$p e$"$Q;+~ U#si*Q$$%$P%$R&$Ak~'j~(nowj~) %:5:U#si4R)k%2;C@ݥU#siBQ#msgBk%S*U%v%K%%R$v%%%Rq% 6 +%0~(buf}0 )T&;TU#siSS#msgSk%Q*%T&%a&P*%v%.,%*&m&.3,z&*@&&@U%&Q%&P$&OS%&P,&$&UW,&+m&D;(buf0 +&'(buf0 &&#W~(nowV~'&V~&&="L~(nowK~'&K~+&%(buf0 -S%&e-B %&-&v'-w~ @'. -'Q/'-(;0- )Q0-)R0- )U0- )Va-)W'D5TDyr(;0Ea  "0@;] &ic 5int 60 >Ee ?EJ AE3 C D^Ejg S U@  0gBLGQiFpr !D!E#!F#1 +-{- +- >,# /, # , # Z , # ,# ,# O,# ,# z,# ,#$ ,#( # ,#, E,h#0 (,n#4 .,#8 ,#< ,#@ ,">#D ,#p#F @,$t#G b,(#H ,1#L ,7#T \,8#X |,:#\ !,<#` 7  ,hy ,,h# ,n#: ,#1{  *  3 #3k#4# #5##6# #7# #8#I#9#`!#:#NC", "-#".#9!"/#s"0N#  $S >   _# #   J _#B # #  wtm,wx#y#:z#B{# |#}#~#2#\# #$#(2>40Y? g p#!_#ۦ#f ܼ# # ,7 O bO# __ ,  ~4# _# _# bit#u32"0~*+e#key,# n #p #7 - #ref !# H 0wq 1#rq 2#~ 3#0 4#4 50#8 6#< 7#@ 8#D7gU4w x$#y#z0#  {0#'|0#r}0# ~0#>0# -0#$ug#( w E B)8%H~ %I0#" %J0#s%K#fd%L# >%M0#exp%N0#_4%OW #4%PW #K4%QW # 4%RW #$ib%S #(ob%S #,p %T0#0%U#4Q Q wE   %S> }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0{ 0#4@ #8( #< 7#@ 7#A W#DJ Q #L Q #P #T #X]  / tstr u#len v#     h  z$#L$# $# $j#fe$+ #be$+ #$# >$#$R $0#(req$ #,rep$ #0si$3"#4 $#m$$#$#srv$#T$#I $#6 $C"#txn$M#z $#$n #$U"#1$l"# $w#$w#$$ "#$0#   & #J&!# &"#&# #  ] Lny  _#! # * k] auid^1#gid_#}`&#p buxa* w LfdM#~ N#LO#>P#  Qd#R#4$S#T0#Uj#V#s)W#@X#&Y#DZ#{ [0#b] #I)c#d TQum#n#Ko#p# q_# rT# s#$%4t#(<5u#,v#0w#4_x#8$y#<`z#@]{#H|#Lwp p  dCfA#bB #N&(?cbCN#sD#~ E7#evF7# G^#HT#I#  J#$ ^ j J #get#put#u# "#d! R###P# #2T a^#_%#c`%#a!]+,#-#.#S/# _ T4 ##5-)8len)90#cr):0#);0#F )Cv)D# )Ew#)Fw#))Gw#2)Hw# (    < (3(l(݉#m_l(މ#u(߉#u_l(߉# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(3MD(H (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(N#sl(#  (W#8 (#@(2(#F(5# ( #req(#rsp(#\uri(# (#(#BH(#>(0#".E 0#^ 0#0# 1 >IJ#~ K#" L#M# N# O#: P#q'R+ #S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lX#@C!Y#H>[#LT\#\O>^#l`#|oa# b#@d#d#e#g f#ogw#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v1 #hw#yi#yi#bz0# {<#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M#1+ q'hDRj# #G#~ # L#j#}##:##,acl#0{#8#@#H=##Psrv#\] #`7 #d` y$#hY#R #ĉ##Ɖ#0#ȉ#_ɉ#S# ˉ#J ̉##Ή#ω#е#? #R҉#/Ӊ#-p&##։##&z%#id#l#l#, ##0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0##r#### #0##0#b0# <#i#i#i#i#i#i# ! i# i# Ii# #cap# T# O>#  # o #  + # e  "# m  "# J p#  p# x# # # # # u# # :# h # # # R# |&# U|&# # # ]# &# &# # o # # &# 5  # !# "0# #0# >$5## 2$5##H4n 3 '' #'! #srv'"# !D$ $#$G# $G# '$G#$#$#  $#$1%$P#(u $P#,,$P#0$i#4I$i#<!$px$+ #sv$#$w#<$w# >$0# iid$ʉ#H$ʉ#sid$ʉ#! $$# "$iid$Љ#px$+ #buf$0#sid$0# ptr$ԉ#bol$Չ#3"$!'$!!$Ζ!!$֭! C"w 7 U" I"l" Q ["H"p7!>4jun5 in6"p2u7y"#5#p ,z{4#t0|4#t1|4#j8}1 #~1 ## (#$#(#G#len0#pos0# sid0#srv#oe+ #src#buf ##be+ !u# 0#<#)$ srv)$# #~ #T$Xact"#bck"#,y$act4#bck4#h%#I # ## ##0 # #map## /$#,NT$#L t%#6t%#I8t%#'t%#t%#t%h%% ى#2ډ#%8ۉ#9܉# >݉# މ#T߉#C!#p&- &#'#z(#5)# >*#-+u'#,'#-p&#%" v& & & &E 1$1%#kw1&#N 1-'#'N+ + &/'1516#kw17/'# >'& u' u'###>'' '##?#{''-R;-N#-O#L-P# -Q# [)+ -;uid-<#gid-=#->#4$-?# $-@# -A#-B#Y-C#}-D# `-E#$-F#(4-G#,'-H#0J-I#4-I#8x-J#<-J#@-K#D -K#He -L"#Lm -L"#-R'# -Sp #g-T##j,X<<BU$=:N~$k;: $;:+ $2';+ %err;$;&)' >%'>%&e+(su? ~)@S*T*s' ^%'^%+s'[^)R^P*x*' b%'b%**ç֧' f%'f%**ާ' q%'q%&*8)Crj,P*+6`' Z%'Z%+6`'[Z)RZP,Q+p,h-,.,h-,-,-,/h)!g,P*+ŨҨ' %'%*+ڨ' %'%&+'4$.p, -,., -,-,-,,&,p,0P-,.,0P-,-,-,,G,,Pi-,-,-,/)&0~(resP 0,n1m0, -1+1p+N1,2-;PjU%msg-$   3u.5<gpU4sf 4pxf+  4urifp&R5reph d5svi`5svsi\5msgj h&-6x; *.u6u'S7lenv+18 %8%+18[6RP&D.6;4u.0/06$0P&`.H6;u.L/x6$0P . 33/;HU4sG V4repG W4uriGp&7pxI+ 5msgJ h5upK0S,/3/MO-@/,/3/uw-@/.L/-]/9L/|+:buf ;g/;U:nTP2/&<5U%s V%rep W%urip&11P*07__v>* 17__v>/8j;;1M<[:tZ=2{<vP]U4su 4repu  ?w25msgx @e&15es2~,13/-@/&028F<6;~.2-2-2-2-2>2~/A2~A2Q&v2X5pn35tm.3 8>#3~>/3P.3/>E-@/ 2 5#B3k<?Cout=-1 =Cerr>21->Cptr>7end@7cA7 3 -D;3Cnow;3Ctm@3 <E; `rUF*Kf3l3 >Fv*L~33 ~F*M~3FS+3pFB +3F&v3FwF -[ 3G FQ3 4GF`4 4?q'<+ F.;0Hnow.GF+ -W'Hpid-YFP-ZF-] F/F/F$ 0F Q0FR0FS0F)T0F U0F VFW 568''6%Hg(=!0Ea  "0@;] &ics 27 5int 60 >Ee ?EJ AE3 C D^Ejg S U@  0g BL G QiF< >= 0r #D#E##F#1 +-/- +- >,# /, # , # Z , # ,# ,# O,# ,# z,# ,#$ ,#( # ,#, E,#0 (,#4 .,#8 ,#< ,#@ ,">#D ,#p#F @,$#G b,(#H ,1#L ,7$#T \,8$#X |,:#\ !,<#`5 7@ :$W c $ ,y ,,# ,#: ,#jc3$S> ##" YJ#B#Y#iwq6 7# o8#Lny  #!#k 2> 40Y? g p#Z!##f # Z#j7 b#j  ~r# # # bit#u32"0!~*+#key,#FnF#pF#!u - !#ref!F# H0wq1#rq2#~ 3#04#450#86#< 7$#@8#D uU4"w "xK#"y!#"z0#  "{0#'"|0#r"}0# "~0#>"0# -"0#$u"#( B)8$H~ $I0#" $J0#s$K$#fd$L# >$M0#exp$N0#_4$O#4$P#K4$Q# 4$R#$ib$S #(ob$S #,p $T0#0$U$#4    $S>}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#, 0#0{ 0#4@#8( #< 7#@7#AW#DJ#L #P #T #X /tstru#lenv# $  $ *  h z!#L!# # 0#fe#be## >#$R 0#(req #,rep #0si!#4 "#m$"##srv#T#I #6 !#txn#z #?#&!#1=!# ‚#Â#$ #0#   ]# auid ^<#gid _&#} `1#6 bux a = Lfd M#~ N#L O#> P"#  Q*# R#4$ S# T0# U0# V!#s) WF#@ X#& YL#D Z$#{ [0# b# #I) c#* T Qu mR# n#K o# p# q# r#  s#$%4 tF#(<5 uF#, vr#0 wr#4_ xr#8$ yr#<` z!#@] {#H |!#L= 6 F 6br *bCfAF#bB #&(?cbC#sD$#~ E7#evF7# G$#H#I#  J}#$$x} J #get#put#u# #* ! R###P# !#2  a ^$# _%#c `%# ao]+,o#-u#.#S/:# *{ 4 F##  -'8len'90#cr':0#';0#QF 'Cv'DQ# 'E#'F#)'G#2'H# &    < &W&l&ݔ#m_l&ޔ#u&ߔ#u_l&ߔ# v&#v_l&#U&l&#v_l&#c&#c_l&# r&#r_l&#r&rq&st&D&H &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&U#  &W#8 &#@&2&#F&# & #req&r#rsp&r#\uri&# &#&#BH&#>&0#.E 0#^ 0#0# >IJ#~ K#" L#M# N# O#: P#q'R#S# T#$- T#(4$U0#,6U0#0lV#4, V#8W#<lX!#@C!Y#H>[#LT\#\O>^#l`#|oa# b}#@d#d#e#g f#og#h# i#;i##j# j#6j#k#Tl#Fm#ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# v#hw#yi#yi#bz0# {G#}i#}i#~i#~i#i#&# 0#i# i#i#Ii#M#q'hDR0# #G#~ # L#j#}##:&#,acl!#0{!#8!#@!#H='#Psrv#\] #`7 #d` '#hY#R #Ĕ##Ɣ#0#Ȕ#_ɔ#S# ˔#J ̔##Δ#ϔ#Ѐ#? #RҔ#/Ӕ#-9)##֔#!#&(#id#l!#l#, ##0#w0#}0#0# # 0### 0#i#yi# i#4$0#0#X0##r#### #0##0#b0# G#i#i#i#i#i#i# ! i# i# Ii# #cap# T# O>#  # o #  # e  %# m  %# J p#  p# x# # # # # u# # :# h o# o# # R# E)# UE)# # # ]# K)# K)# # o # # [)# 5  # !# "0# #0# >$u&# 2$u&#Hr?3 %% !#%!$ #srv%"# D #h# h# 'h###  #$1%P#(u P#,,P#0i#4Ii#<g px#sv#Ȃ#<Ȃ# >0# iidʔ#Hʔ#sidʔ#~ L# iidД#px#buf0#sid0# ptrԔ#bolՔ#!!'!g !~ ! &! $ ! =! $ ,!!Y%)dow)#h1)#m1)#h2) #m2)#!)min)i#max)i#$)˔#$)̔# ")>)#)#@")i)Ȕ!#)͡!!v$)!!]%)C!j")ptr)$str)reg)j""M%,))!#val) "#ptr)@"#$)Q# len)ڔ#$>)۔#(# )p)$i)ll)id)#a)#H#$p#$0)i)#ptr)#len)#>)# ctx)"##$)kw):# N )## )%)$# pA)$# )0# E&) ## E # Lp"#&$  $ $ &$ $,$$A) )!!#kw)"$#arg)%$# %)&# $)'!###$ $ #$$%) )!#kw)$#$p# "$)%#str)$p#$Z%acl)* )+!# u),# )B)-!# ).# )/0#%%OB)> )?!# _)@!#pol)A# )B0# -)C#%p7!>4un5in6%p2u7%#u&p ,z{r#t0|r#t1|r#j8}#~## (#$#(&h#len0#pos0# sid0#srv#oe#src"#buf #'be!u6' 0#<!#i' srvi'# #~ #'Xact%#bck%#,'actr#bckr#(#I # ## ##0 # #map6'# o'#,N'#L (#6(#I8(#'(#(# ( (3) ٔ#2ڔ#%8۔#9ܔ# >ݔ# ޔ#Tߔ#C!#-3) ?)[) k) `%)E 1$1%#kw1&:#N 1-)#)    ))1516!#kw17)# *q) N*/R;/N#/O#L/P# /Q# ++ /;uid/<#gid/=#/>#4$/?# $/@# /A#/B#Y/C#}/D# `/E#$/F#(4/G#,'/H#0J/I#4/I#8x/J#</J#@/K#D /K#He /L%#Lm /L%#/R *# /S6 #g/T#+=($(%!#C(&k)#('# ,L> == >#= ?R#%>,= F!  G]!> H+!> I]d,= Bop D]#v J,#&-=nU'fdmV(>mS(d=m-(#m-)>oX)>pW*retqP)*>t+F-,__s~$/-~!~0!~>!~7,__u~-,__c~w-p)B>>,H)G>>,.p*__s$R-!0!>!7,__u-,__cw-~-&k.< 9U( 0V( (/>/@=#*fdS*errd*msg:`0k.fi1x.2.e"T3fdS4.Q=(@U5 '*R6 )0S7err*V8.<:U5 90Q8/=HQU5 G0Q90z=g`U:sf$ V:reqf W6Bh0S6<ip;/"0<30R<>0Q=/7retR;/J0351W0;/J058J0Ak?j3nowj2c0D;3buf 2|0h(3buf >0#W3nowV?&V>0="L3nowK?&K43=8U5=5k; 5;52':err57ptr:l7val0p6[>Q+1@ %@%+1@ %@%=26h6%>d7polQ6Ck)S@B0+.27@ %@%+T2BV@ %@%=2@ %@%.@[/6RP+2@ %@%-%7aclZ%P6u:Q;23<3P;33Pg<3P;.33<3P;G33<3P;`33.B<3P;w33as13;33130313>32:?q'1404<2@kU:px0:l40$ P:l70$:dir05)B1&$5$1$R4C5<FpPU:pxD:l4D$ P:l7D$:dirD5)BE&$5$E$6 Gp6<>GV6j=GR6H/S/= /r=.6 fQ68fl6=fh6&=fd6=f`A,=PUBv*Lc5i5 B*Mc5BS+5BB +5B&v5Bw5CB-Q5Dq'<B.;0Enow.Se?SJAS3C7DlEjgS7 U7@ 0gBLGQiFer 'D'E#'F#  n # p #e - e# ref !#RU4&w &xR#&ye#&z0#  &{0#'&|0#r&}0# &~0#>&0# -&0#$u&X#( h  %%#u%#Z%># len% ># @%!>#D%"#h2L40Y? g p#$SL[ '#[# k J'#B##  w!'##f # # E 0Ln!y ! '#!!0# @ k hp 7 > 42un 5in 6p 2 u 7@# b#   ~### bit>#u32 "08~ * +# key ,# H 0 wq 1# rq 2#~ 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#}`#  buxa L fdM>#~ N>#LO>#>Pk#  Q #R>#4$S>#T0#U#Ve#s)W%#@X#&Y+#DZ#{ [0#b#I)c#  TQum1#n>#Ko>#p># q'# r# s>#$%4t%#(<5u%#,vQ#0wQ#4_xQ#8$yQ#<`ze#@]{>#H|e#L%>>> A Q> A,R;,N>#,O>#L,P># ,Q>#  + ,; uid,<># gid,=>#,>>#4$,?># $,@># ,A>#,B>#Y,C>#},D># `,E>#$,F>#(4,G#,',H#0J,I>#4,I>#8x,J>#<,J>#@,K>#D ,K>#He ,Lh#Lm ,Lh#,RW# ,S#g,T># B)8(H~ (I0#" (J0#s(K# fd(L># >(M0# exp(N0#_4(O #4(P #K4(Q # 4(R #$ ib(S) #( ob(S) #,p (T0#0(U#4    )  (S> }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0{ 0#4@ >#8( #< E#@ E#A e#DJ #L #P ]#T c#X X / t str u# len v>#i i ) o h  z e#L e# # # fe # be # ># > >#$R 0#( req ) #, rep ) #0 si z&#4 k#m$ k# # srv D!#T D!#I D!#6 &# txn #z ># $# &#1 &# …# Å#$ P&# 0#X ] ) >#J)!># )">#)#]#  t]-+8len+90#cr+:0#+;0#F +C v+D# +E#+F#)+G#2+H# tO*    < * * l*># m_l*># u*># u_l*># v*># v_l*>#* l*># v_l*># c*># c_l*># r*># r_l*># %*rq*Zst*D*H *0# sol*# eol*# som*0# col*0# sov*0# eoh*0# cap*# sl*#  *e#8 *>#@o*2*O#F*# */ # req*%# rsp*%#\ uri*# *#*#BH*>#>*0#u! R##>#^# e#2z  #a#^##_%#c#`%##a[]"+",[#"-a#".>#S"/o# g 4 ##1 --K- -->.>#/. #. #Z . #  .#.#O.# .#z.# .#$.#(# .#,E.#0(.#4..>#8.>#<.#@."L#D .#~#F@.$#Gb.(#H.1#L .7#T\.8#X|.:>#\!.<#`.y ..# .#: .>#R  K  3C fA%# bB) #W&(? cbCW#sD#~ EE# evFE# Gg#H#I>#  J#$ g 2 J ># get># put>#u># 8#mHq'hD# #G#~ ># L>#j>#}>##:I"#, acle#0{e#8e#@e#H=g"#P srvD!#\] >#`7 >#d` ##hY#R #>##>#0#>#_>#S# >#J >##>#>#l#? #R>#/>#-ԏ$##>#e#&$# id#le#l>#, >#>#0#w0#}0#0# # 0### 0#w#yw# w#4$0#0#X0##r#### >#0#>#0#b0# 1#w#w#w#w#w#w#! w#w#Iw#>#cap>#T#O># >#o # #e  h#m  h#J ~# ~#x>#>#># ># >#u>#>#:>#h [#[#>#R>##U###]#$# $#>#o #>#$#5  >#!>#"0# #0#>$!#2$!#H8.E 0#^ 0#0# G ~3  e#!i # srv"D!# D!>"JD!#~ K>#" L>#M># N># O#: P#q'R#S># T>#$- T>#(4$U0#,6U0#0lV>#4, V>#8W>#<lXe#@C!Y#H>[#LT\#\O>^#l`>#|oa# b#@dD!#dD!#e#g f#og#h># i>#;i>##j># j>#6j>#k>#Tl>#Fm># ido#p0#Z p0#q0#r0#ms0##t0#Vt0#gu# vJ!#hwD!#yw#yw#bz0# {1#}w#}w#~w#~w#w#&# 0#w# w#w#Iw#M>#~!p ,z{# t0|# t1|#j8}J!#~J!#># (>#$>#(I"<# len0# pos0# sid0# srvD!# oe# srck# bufc# g"be u" 0#<e#"  srv"# >#~ >#D!"X actP!# bckP!#,# act# bck##>#I ># >#># >#>#0 ># D!# map"# "#,N"#L  $#6 $#I8 $#' $# $# $D!#$ >#2>#%8>#9># >># >#T>#C!>#!-$ $ $/ f%D  ># <# <# ' <# 7# 7#  7#$1% ^#(u ^#,, ^#0 w#4I w#<% px # sv D!# ȅ#< ȅ# > 0# iid >#H ># sid >#%  ͐#P& iid ># px # buf 0# sid 0# ptr ># bol ># z& ' f%  % % & G&i &&i  &"&> U#i V#!D!S$'>/U%s.i V&txn0'p&fe1l'2'R'c)2'S(c''Nj)'*'P+|'M&h[S,'(-ji,'@-jo.6&hUS/'8F>0sF'0pF''~'1?>U$M(t>U%si V'i?eQR2(>>U%si V%si S&req) P&rep) Q3(+)()(4X5(P6(J^7tv1I(7tv2I(8retK^(<2)!?> OU%si V%si W(Q))*)P))(m)'0)')'3')')'/)="L>0nowK>9&K>"1*?=PXU:s<i V:si< W;req>) p;rep?) S(*1*r)>*)I*31*)>*)I*"+>f` U:sei V:sie S(*()()(4x5(P(*(j)()(45(P,+=7q>P3+#r)+3+*6* ,Q),(F+()()(45(P(w++)+3+* ,R),(+'%)')'(+(IO)()(45(P(+(,)5,3(,)5,<+.(0s'D!<", %00ctr/",0inc/0U:si Q>V1(2U:t1;s3i V=z)4>p=)50l=)50h?;)?(?' ,- @>03V1/6)c1,@-P =>0R3V1(+)c1(W-o1)|1(-1k)1)1(-15*1R*1W315Q*1R*1W(-1x)1*1S(-1)1)1(.1)1)1(.o1Ye)|1(I.1|)1)1.|51P(v.1)1)1.51P(.1)1)13(`x*(W)(4 5(P(.2)2(.2)2(.2 )'2+/<`@>0(//2)'2(F/2)2(f/'*'S*'P,~/ ;len*>P(/(0h)()(.0h5(P(/32)D23N2)_2(/i2)z232)2(>02)232)232*2P(U02F)2(l02gj)2(03t*3P*#3Q(03*3P*#3Q(03*3P*#3Q(?127)2(13*3P*#3W("13*3P*#3W33**3P*#3W.8len>0t1t>0t2t><1'c0bufb) 9i?b0-'d0A2>7si 7si <2#(0buf) <32'0buf) /N2"0t/i2 ~0t}/2 v0tu<2 ]9 \2/20t/20t<20t<3'M0bL) //3Ak>9j>0nowj>"3b>pU:si Q:si P=p >P;err>S;fin>RBR %%B+ ,WB y>B,]cBS-3BB -3B&v3Bw> 4C B/Q3B;0Dnow<<B $B0#Eb ( E$ )e B1>B Q0BR0B U0B VBW2=gO< p(N?d-8len9d#cr:d#;d#EF CvD# E#F#)G#2H# % 3B?3p U len3 cr3 :W \?3 e%V new3Q intk 7P|(?Ea "%@;]&^cint6%>:e?:JA:3CDSEjgS U@ % 9r DE#F# 7 [JG[# k9 ?JDgBLGQS 3   # #   J #B z# # " w( 234%Y-? 8tg pN#!ڗ#C#f Y# # , 1 -g- - >s# / #  # Z  # # # O# # z# #$ #( # #, E#0 (#4 .s#8 s#< #@ "3#D #e#F @$#G b(#H 1#L 7#T \8#X |:s#\ !<#`y # #: s#t  m  3 b#  `  ~# # # bits#u32"%~*+#key,`#n#p#: H0wq1k#rq2k#~ 3s#04s#45%#86P#< 7#@8s#DJJJ:U4w xg#y#z%#  {%#'|%#r}%# ~%#>%# -%#$u#(  B)8H~ I%#" J%#sK#fdLs# >M%#expN%#_4O#4P#K4Q# 4R#$ibS. #(obS. #,p T%#0U#4.  S> }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0{ %#4@ s#8( Q #< ,#@ ,#A L#DJ #L #P ] #T c #XE E . K h 4 W t ] Lny  #! # k auid^#gid_v#}`# buxa  LfdMs#~ Ns#LOs#>P#  Q #Rs#4$Ss#T%#U #V#s)W #@XP#&Y #DZ#{ [%#b #I)c#  TQum #ns#Kos#ps# q# r# ss#$%4t #(<5u #,v/ #0w/ #4_x/ #8$y/ #<`z#@]{s#H|#L   ss s  / s  V CfA #bB. # &(?cbC #sD#~ E,#evF,# G #H#Is#  J #$ 5    <_D`#?a #setb #clrc # E@d #}?e #remf #clog #:4h# j8i1#$FAjC#($k1#,Fl1#0um"#4ns#8 s s s    s 1s!C7qp7>4un5t in6tp2u7I# R;Ns#Os#LPs# Qs# -+ ;uids#4$?s# $@s# As#Bs#YCs#}Ds# `Es#$Fs#(4G#,'H#0JIs#4Is#8xJs#<Js#@Ks#D Ks#He Lq#Lm Lq#R# S #gTs#x?'s4Ufd& Rdir&sQ/ R(P?,s@`Ufd+ Pdir+sR?2s`Ufd1 Pdir1sR8@@8sUfd7 Rdir7sP!ret9sP R:Px?AsUfd@ Pdir@sR!retBsP" RCP#?JUfdIsP#o?S UpRexpRsR BHTsS!fdUsW!iUsQ Vh ?Wsd 4@XsV ?XsS!fdsYs` Z_$o RP$ RP%&&'&&(Aks)js*nowjs(&s*nows*expsn@sUpV+ @J+?[+@l+?} b?sS#?UpS?sUp#@|U!pR,S,B ,*rs  ,Et,&v0V ,ws T- , QC,;%,+ W,s, Q%,R%, U%, VV,Wk  k ?L +@T&gR; (@intC@C#SZSE@T@,V@0a!ՂEa ";]&c6>e?JA3CD jgS U@   S _ %iF p gBLGQr #D#E##F*#24Y? g p#$@SE #E#US J#B##Sw!##f # #S1 -- ->%#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.%#8%#<#@"#D ##F@$#Gb(#H15#L 7K#T\8K#X|:%#\!<#` Ky # #: %#  S S3( b(#88S  ~ #8#8# bit%#u32"~*+>#key,# n #p #  - #ref !# H 0wq 1#rq 2#~ 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @U4"w "x#"y#"z#  "{#'"|#r"}# "~#>"# -"#$u"@#(PS B)8 H~ I#" J#s KK#fd L%# > M#exp N#_4 O0#4 P0#K4 Q0# 4 R0#$ib S #(ob S #,p T#0 UK#4 * * P    S> }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0{ #4@ %#8( h #< #@ #A #DJ *#L *#P t #T z #X 6 / tstr u#len v%#    h h  z #L # # #fe 5#be 5# %# > %#$R #(req  #,rep  #0si =!#4 U#m$ U# #srv #T #I #6 M!#txn W#z %# x# _!#1 v!# # #$ !# ؂#   n  S] Lny  #! # Sk auid^#gid_u#}`# buxa  LfdM%#~ N%#LO%#>PU#  Q #R%#4$S%#T#U#V#s)W#@X#&Y #DZK#{ [#b #I)c#  TQum&#n%#Ko%#p%# q# r# s%#$%4t#(<5u#,vF#0wF#4_xF#8$yF#<`z#@]{%#H|#L   % %   %6SF% 6mCfA#bB #&(?cbC#sDK#~ E#evF# G#H#I%#  JQ#$LS Q J %#get%#put%#u%# ,# v@%#@M#p7>4un5 in6p2u7#! R##%#Z# #2 X a ^K# _w#c `w# a%]+,#-#.%#S/j# c  X4 ##    9-&8len&9#cr&:#&;#F &Cv&D# &E#&F#)&G#2&H# %          < %7%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%7QD%H %Ԃ#sol%#eol%#som%ׂ# col%؂#sov%؂#eoh%ق#cap%Q#sl%#  %#8 %%#@ %2%#F%9# % #req%#rsp%#\uri%# %#%#BH%%#>%#,.E #^ ##;!S>IJ#~ K%#" L%#M%# N%# O#: P#q'R5#S%# T%#$- T%#(4$U#,6U#0lV%#4, V%#8W%#<lX#@C!Y#H>[#LT\#\O>^#l`%#|oa# bQ#@d#d#e#g f#og#h%# i%#;i%##j%# j%#6j%#k%#Tl%#Fm%#ido#p#Z p#q#r#ms##t#Vt#gu# v;#hw#y#y#bz# {_#}#}#~#~##&# ## ##I#M%# ;5q'hDR# #G#~ %# L%#j%#}%##:|"#,acl#0{#8#@#H="#Psrv#\] %#`7 %#d` B##hY#R #%##%#ǂ#%#_%#S# %#J %##%#%#й#? #R%#/%#-$##%#׼#&C$#id#l#l%#, %#%##w#}## # ### ##y# #4$##X##r#### %#0#%##b# _#######! ##I#%#cap%#T#O># %#o # 5#e  #m  #J # #x%#%#%# %# %#u%#%#:%#h ##%#R%#$#U$###]#$# $#%#o #%#$#5  %#!%#"# ##>$!#2$!#H   x3 $$ #$! #srv$"# ) D  %# # # ' # # #  #$1% Z#(u Z#,, Z#0 #4I #<  px 5#sv # #< # > ɂ# iid %#H %#sid %#  #! iid %#px 5#buf ҂#sid ӂ# ptr %#bol %#=! ' )  Π  ַ M!PS A _! S! v! * e!H!p ,z{ #t0| #t1| #j8};#~;#%# (%#$%#(|"#len#pos# sid#srv#oe5#srcU#bufz #"be5u" #<#" srv"# %#~ %# #Xact!#bck!#,B#act #bck #1$%#I %# %#%# %#%#0 %# #map"# "#,N##L =$#6=$#I8=$#'=$#=$# =$  1$$ %#2%#%8%#9%# >%# %#T%#C!%#- $  $$S $ S"9%@ U##%$__s"K%$__s#K&^%@(oU'sig'%S&%@BpU'sigA%P(@AMR"%_@] U)sig^%R*@^%V**_%P*L@`l~ W+S% +B %+D%+&v& m+w%A&,S+'Q0&-% p&WS-@`& &%S-@& -@l <T6 (\A0Ea "0@;]&ic5int60>Ee?EJAE3CD^EjgS U@ 01 %-&- %->&#/& #& #Z & #  &#&#O&# &#z&# &#$&#(# &#,E&+#0(&1#4.&#8&#<&#@&">#D &#p#F@&$7#Gb&(G#H&1#L &7#T\&8#X|&:#\!&<M#` 7    &+y & &+#  &1# : &#&G]3 n #p #]  - ]#ref !#iFg BL G Qr D E# F#2>40Y? Mg  p'#$S>  X# #  JX# B# #w( !X# # f 2#  (#87 [  b [#kk8  ~ @# k# k# bit #u32 "0~ *  +q#key ,#j H 0wq 1#rq 2# ~ 3#0  4#4  50#8  6#< 7#@  8#Dzz zjU4w x# y]# z0# {0# '|0# r}0#  ~0# >0# -0#$ u#(/ B)8H ~ I0# " J0# sK#fdL# >M0#expN0# _4O# 4P# K4Q# 4R#$ibS^ #(obS^ #, p T0#0 U#4  /^  S >}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 { 0#4 @#8 (G #< 7#@ 7#A W#D J #L  #P S #T Y #X /tstru#lenv#  ^  G h z ]# L]# z#  #fe#be# # >#$ R 0#(req^ #,rep^ #0si #4 # m$# #srv# T# I # 6 !#txnD# z # .# !# 1,!#  w# w# $ # 0# M j ] Ln y  X# ! # k auid^#gid_# }`# buxa  LfdM# ~ N# LO# >P# Q # R# 4$S# T0# U # V]# s)W # @X# &Y # DZ# { [0# b # I)c#  TQ um# n# Ko# p# qX# rM# s#$ %4t #( <5u #, v%#0 w%#4 _x%#8 $y%#< `z]#@ ]{#H |]#L     % LCfA #bB^ #&(?cbC# sD# ~ E7#evF7# G# HM# I# J0#$+c0 J  #get#put# u# #!  R# # # P# ]#26 a ^# _%# c`%#a]+ ,# -## .# S/# ) W4 # i# c cW.E  0# ^ 0# 0#p7>4cun5j in6p2u7#&-"8len"90#cr":0#";0#wF "Cv"Dw#  "Ew# "Fw# )"Gw# 2"Hw# !          < !}$!l!݉#m_l!މ#u!߉#u_l!߉# v!#v_l!#{!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!$>D! H !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!>#sl!{# !W#8 !#@! 2!# F!&#  !d #req!#rsp!#\uri!# !# !# BH!# >!0#!>I J# ~ K# " L# M# N# O# : P# q'R# S# T#$ - T#( 4$U0#, 6U0#0 lV#4 , V#8 W#< lX]#@ C!Yz#H >[#L T\#\ O>^#l `#| oa# b0# @d# d# e# g f# ogw# h# i# ;i# #j# j# 6j# k# Tl# Fm#ido# p0# Z p0# q0# r0# ms0# #t0# Vt0# gu# v# hw# yi# yi# bz0# {# }i# }i# ~i# ~i# i# &o# 0# i# i# i# Ii# M#q'hDR  # 2# G2# ~ # L# j# }# # :+"#,acl]#0 {]#8 ]#@ ]#H =I"#Psrv#\ ] #` 7 #d ` "#h Y# R # ĉ# # Ɖ# 0# ȉ# _ɉ# S# ˉ# J ̉# # Ή# ω# .# ? # R҉# /Ӊ# -q$# # ։# ]# &##id# l]# l# , # # 0# w0# }0# 0# o# 0# #o# 0# i# yi# i# 4$0# 0# X0# 2# r2# 2# 2# # # 0# # 0# b0# # i# i# i# i# i# i#! i#i#Ii##cap#T#O># #o # #e  #m  #J p# p#x### # #u##:#h ###R#}$#U}$###]#$# $##o ##$#5  #!#"0# #0#>$!#2$!#H@.3    ]#  ! #srv "# D # # # '# # #  #$ 1%P#( u P#, ,P#0 i#4 Ii#<V px#svǷ# w# <w# >0# iidʉ# Hʉ#sidʉ#m  ͈# iidЉ#px#buf0#sid0# ptrԉ#bolՉ# 'V m !/ !  ! ,! !!p ,z {@#t0|@#t1|@# j8}# ~# # (#$ #(+" #len0#pos0# sid0#srv#oe#src#bufY #I"beun"  0# <]#" srv"# # ~ #"Xact2!#bck2!#,"act@#bck@## # I # # # # # 0 # #mapn"# "#, N"# L ## 6## I8## '## ## # #k$  ى# 2ډ# %8ۉ# 9܉# >݉#  މ# T߉# C!#-k$ w$$ $d $OB)#?]#_#@]#pol#A##B0#-#C#$`%Y%#dow##h1##m1##h2# #m2##%#min#i#max#i#$#ˉ#$#̉#%# >#2# #2#%#i#ȉ##`%v$#ѧ%]%#%)&#ptr#str#reg#)&&M%,# #]#val#%#ptr#%# $## len#ډ#$ >#ۉ#(& #p#i#ll#id#&a#&H&/'$0#i##ptr##len## >## ctx#&#'$#kw##N #'#)%#I(#pA#d(# #0#E&# #'  ' /&''   ' C('C(A##!]#kw#"(#arg#%(# %#&#$#']#&'d( C( 'O((%##]#kw#(#(/'!"(#%#str#$/'$)acl#*#+]#u#,#)B#-]#  #.##/0#T)B#3#4]#acl#5T)#neg#6# ()eB#9#:]#fA#;]#%))u'#)B()#)&)*C<  U'px:'l4:  'l7:'dir:()B;'($;C(P&*FDG  U'pxE'l4E  'l7E'dirE()BF'($FC(P&*AT  U'pxR'l4R  'l7R'dirR()BS'($SC(P)E+C`  U( _(0D_' ($0_ )+Ag  U'pxe'l4e  'l7e'dire()Bf'($fC()+Bm ' U($lC((0Dl' )+,YDt0  U($sC(S(0Ds'Q*1u),B R U($C(V(0D'P+AS,ret- R +BS),C`  U($C(S(0D'Q*1)-}B % U($C(P(0D'V*1)-gD0  U($C(S(0Dǰ' *1ɉ.endW.cS/- +ԉR-  *ԉ&R.C LU($C(W(0D'R(*s+lAl+1h.cW.endd.psV.plS/=. 0 1!2 P3.APfU4$C(P40D'R3..B(pU4$'C(P40D''R3.8D.U4$-C(40D-' 3D/XB6)U4$5C(R40D5'Q5s7D/R23/BD0mU4 CS40DC'W4$0C 6lenE7/T)U4u=W4Z=V5acl?T)S-0 A%0A%3o5CK(U8kwJ0@L2 BMP5kwlNt4W75+D_ U8pat^'S;5Ds'qU4)Br'W<50=5-0>6P>6V?6Al@Zk6patm'6tmpm'36B'-U4=VABA BA'D2)B'\2A(X20D'S2$0`2AW5argT/6!6end0C-5retR3\7AT)0U8aclT)2)B'S2A'V-bm0j37CT)U4=V4OCWAB 6AA#AC2DT)R2A'S2uV38CDT)U4tBCW4OCC ABlAAiACgw2DFT)R2AG'S2uHV2@IV-0 L%0L%39IBr$U4Cq$2ICs9W2Cs9p2FAt9P2uDt9SZ))3%:YC$ U4=4OC 8polPABA@CkA=Ak5arg`5negW2DV2DT)\2B9S2C9X2C$T-0 %0%-0[2RP35;CdU4C$P8px 8l4 8l78dirAC8?2IC92FA92)B'S5aclT)P20D'W2$&28C2D2@-2?6__s 3;AaT)pU4C`$P4A`0V2ICb9S2FAc9R5acldT)PBAUC$K;; >Cv$L;; ~C$M;CS%;CB %;C&v<LCw9<DC'Q(<V<V< 0E@m<S F<+A/j( << )FB)<@R <2E%vj(&bX"(D0Einta "0@;]&wc60>Se?SJAS3C7DlEjgS7 U7@ 0gBLGQiFer  D E# F# n# p#e - e# ref!#RU4w xR#ye#z0#  {0#'|0#r}0# ~0#>0# -0#$uX#( h n 2L40Ys? ~g p#$SL ##  @J#B#@# P w!#ۉ#f ܟ# # E 1 -C- - >># / #  # Z  # # # O# # z# #$ #( # #, E#0 (#4 .>#8 >#< #@ "L#D #~#F @$#G b(#H 1#L 7#T \8#X |:>#\ !<#`y # #: >#J  C  3   b #  6   ~ #  #  # bit >#u32 "0j~ * +# key ,6# H 0 wq 1A# rq 2A#~ 3>#0 4>#4 50#8 6#< 7#@ 8>#DjB)8H~ I0#" J0#sK# fdL># >M0# expN0#_4O#4P#K4Q# 4R#$ ibS0 #( obS0 #,p T0#0U#40  S> }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0{ 0#4@ >#8(  #< E#@ E#A e#DJ #L #P % #T + #X_ / t str u# len v>#p p 0 v  h  z e#L e# # # fe # be # ># > >#$R 0#( req 0 #, rep 0 #0 si #4 #m$ # P# srv #T #I #6 # txn #z ># # #1 # …# Å#$ כ # 0#_  < ]e Lny  #!e # u k a uid^&# gid_#}`# buxau  L fdM>#~ N>#LO>#>P #  Q #R>#4$S>#T0#U #Ve#s)W #@X#&Y #DZ#{ [0#b #I)c#  TQum #n>#Ko>#p># q# r# s>#$%4t #(<5u #,v #0w #4_x #8$y #<`ze#@]{>#H|e#L   >> >  >  C fA # bB0 #&(? cbC#sD#~ EE# evFE# G#H#I>#  J#$   J ># get># put>#u># #0p7>4un5< in6PIp2 u7#! R##>#^# e#2I a^#_%#c`%#a0]+,0#-6#.>#S/h# < j4 #|#vvj-#8len#90#cr#:0##;0#F #C v#D# #E##F#)#G#2#H# ]"          < "" l"># m_l"># u"># u_l"># v"># v_l">#" l"># v_l"># c"># c_l"># r"># r_l">#3"rq"hst"D"H "0# sol"# eol"# som"0# col"0# sov"0# eoh"0# cap"# sl"#  "e#8 ">#@}"2"]#F"# "6 # req"3# rsp"3#\ uri"# "#"#BH">#>"0#.E 0#^ 0#0# s!>IJ#~ K>#" L>#M># N># O#: P#q'R#S># T>#$- T>#(4$U0#,6U0#0lV>#4, V>#8W>#<lXe#@C!Y#H>[P#LT\P#\O>^P#l`>#|oa# b#@d#d#e#g fP#og#h># i>#;i>##j># j>#6j>#k>#Tl>#Fm># ido#p0#Z p0#q0#r0#ms0##t0#Vt0#guA# v#hw#yw#yw#bz0# {1#}w#}w#~w#~w#w#&}# 0#w# w#w#Iw#M>#q'hDR # #G#~ ># L>#j>#}>#P#:"#, acle#0{e#8e#@e#H=""#P srv#\] >#`7 >#d` "#hY#R #>##>#0#>#_>#S# >#J >##>#>#A#? #R>#/>#-J$##>#e#&## id#le#l>#, >#>#0#w0#}0#0# }# 0##}# 0#w#yw# w#4$0#0#X0##r#### >#0#>#0#b0# 1#w#w#w#w#w#w# ! w# w# Iw# >#cap># TP# O>P#  ># o #  # e  0# m  0# J ~#  ~# x># ># ># ># ># u># ># :># h 0# 0# ># R># V$# UV$# # # ]# \$# \$# ># o # ># l$# 5  ># !># "0# #0# >$!# 2$!#H3 !! e#!!p # srv!"# D  ># <# <# ' <# 7# 7#  7#$1% ^#(u ^#,, ^#0 w#4I w#<(  px ƽ# sv lj# ȅ#< ȅ# > 0# iid >#H ># sid >#?  ͐#  iid ># px ѽ# buf 0# sid 0# ptr ># bol >#  ' ˱ (  ?   p   p  H!p ,z{# t0|# t1|#j8}#~#># (>#$>#("<# len0# pos0# sid0# srv# oe# src # buf+ #""beuG" 0#<e#z"  srvz"# >#~ >#"X act !# bck !#," act# bck##>#I ># >#># >#>#0 ># # mapG"# "#,N"#L ##6##I8##'######D$ >#2>#%8>#9># >># >#T>#C!>#-D$ P$ l$ |$6 "$Dp U#u# 0V#>0$DS$GR$~*W%G 0&S%Dp !U$~D>\$GS'out ("$)R$V"%DU!l!U#DTS)retVP*%Djp!!U#DiV$)kP$kS"&D!"U#DS( "%j*O&D""U$GS$ ^V$^W$D>p+S\&+B \&+D\&+&v&+w> &, +$Q&$De(Z#"(EEa @;]&Scint3CzDHEjgSz Uz@ %r  D E# F# $S 36   # 6# F 1 -Q- - >h# / #  # Z  # # # O# # z# #$ #( # #, E"#0 ((#4 .h#8 h#< o#@ "3#D #Z#F @$.#G b(>#H 1#L 7#T \8#X |:h#\ !<D#` "y "# (#: h#Q >  T 3"B)8H~ I%#" J%#sK# fdLh# >M%# expN%#_4O4#4P4#K4Q4# 4R4#$ ibS#( obS#,p T%#0U#4..T" S> }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0{ %#4@ h#8( #< ,#@ ,#A A#DJ .#L .#P #T #X:h  ]hhC fA# bB#{&(? cbC{#sD#~ E,# evF,# G#H#Ih#  J#$    .E %#^ %#%#<)E %"#Uctr<R!%V$E!%Qage"%PB ##T^iE8%a7%b7%D:% #f#Uctr9<SE9%Vn9%;%Q$E;%Rage<%PBG#Q#T^{DX%p##UctrW<SEW% nW%Y%Q$EY%RFZ%ageZ%PB##T^SFB &vwh  Q :%!now <bC\?.%#(kEEinta @;cEj b#k y  ~# # # bit3# E#$U W Z#l$8"e$R ## ##+7 T##f #$+7 s$$ T7$<$f A$C$+7 'sI$L$ @TQ$T$fQsY$\$ vss$v$s$$ EE\E%[E%E%EE xE DbE:EDtagO Jy3sE3:E@E tagO E$.%UsubnewV ~$$WP"R&2 .s$$C$$CP Z$$+ qs$$h"Q T$$fR %%+7 s %%s%%_EsubnewZ7ERE_E_IE_ P)!]E3 W])0%(EEinta @;cEj b#k y  ~# # # bit3# u32"% s32#3 ;~* +#key,#oEo0%&U unewo .{9%%p"VlShT%%f"&2%%%%%%P_"&&C&O&?  NEo unewooldo]E%:E0FLF REE IE F! REF EF IEG 'FG!"ret]N #bEu$:E%tag &y&3#@E$ %tag &#FF 3%x 3"r 3#9Fo&'U unewo #&S'5pAq"MVYleSqh}dT&&f#''0'8'A'E'P(#s'v'''#7Fo$ u%newo"oldo ]E% :E 0F3 LF RE E IE F! RE E IE 'F!"retN~E#o({(U "uPx"Vj~(('@#SPRT((fE{o zuxz|o:E}y~H F(o()U 'uPx'V4H((Yd'x#mSxPWRT((f Fo uxo:Ekeyy3F1o ))U 0uPx0W2o(:E3VT6)9)f3))APM3))APM)N$~*$]E%_*`*)(WFEa @;]&Scs2,int3CDHEj@ %<3=%1 -w- ->s#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.s#8s#<z#@"3#D #Z#F@$#Gb(#H1#L 7#T\8#X|:s#\!<#` y  #  # : s#~  w  3 $S 3&   # &# 6 4%? 6gg  pA#5B)8 H ~ I%# " J%# s K# fd Ls# > M%# exp N%# _4 OG# 4 PG# K4 QG# 4 RG#$ ib S#( ob S#, p T%#0  U#4AAg5  S > }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#, %#0 { %#4 @ s#8 ( #< ,#@  ,#A A#D J A#L A#P  #T #XMh  ]ss C f A# b B#&( ? cb C# s D# ~ E,# ev F,# G#  H#  Is# J#$   L>= =>L# =?#=F G>H>I-= B opD# vJ#fF"s)`*UB>#hfd$sP#__s&S&&%&3&,__u&__c&asSB & v ws  QDaa \/`*(FEa "%@;]&^cint6%>:e?:JA:3CDSEj@ % 0F"fd#s# G$l# }F%l# 7 RJ GR# b0 ?J;gBLGQS 3   # #    J # B z#  #  w 234%Y$? /kg  pE# !ڎ# :# f P#  # , 1 -^- ->s#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.s#8s#<#@"3#D #e#F@$#Gb(#H1#L 7#T\8#X|:s#\!<#`y  #  # : s#k  d  3 b#  W ~### bits#u32"%~* + #key,W#n#p#1 H0wq1b#rq2b# ~ 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1U4w x^# y# z%# {%# '|%# r}%#  ~%# >%# -%#$ u#(  B)8H ~ I%# " J%# sK#fdLs# >M%#expN%# _4O# 4P# K4Q# 4R#$ibS% #(obS% #, p T%#0 U#4%  S >}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 { %#4 @s#8 (H #< ,#@ ,#A L#D J#L #P T #T Z #X< < % B h + N k ] Ln y  # ! # k auid^#gid_m# }`x# buxa  LfdMs# ~ Ns# LOs# >P# Q # Rs# 4$Ss# T%# U # V# s)W # @XG# &Y # DZ# { [%# b # I)c#  TQ um # ns# Kos# ps# q# r# ss#$ %4t #( <5u #, v& #0 w& #4 _x& #8 $y& #< `z#@ ]{s#H |#L   ss s  & s  M CfA #bB% # &(?cbC # sD# ~ E,#evF,# G # H# Is# J #$ ,    <_ D`# ?a #setb #clrc # E@d # }?e #remf #clog # :4h# j8i(#$ FAj:#( $k(#, Fl(#0 um#4 ns#8 s s s      s  (s : .hp7>4un5k in6kp2u7@# R ;Ns# Os# LPs# Qs# $+ ;uids# 4$?s# $@s# As# Bs# YCs# }Ds# `Es#$ Fs#( 4G#, 'H#0 JIs#4 Is#8 xJs#< Js#@ Ks#D Ks#H e Lh#L m Lh# R# S # gTs#o?*s`**Ufd) Rdir)sQf** R+P?/s**Ufd. Pdir.sR?5s**Ufd4 Pdir4sR/@@;s*+Ufd: Rdir:sP!ret:e?:JA:3CDSEj@ % gBLGQS 3O   # O# _  J #B z# #  w 234%F;LY? g p#H!##f # H# X, 1 -c- - >s# / #  # Z  # # # O# # z# #$ #( # #, E:#0 (@#4 .s#8 s#< #@ "3#D #e#F @$F#G b(V#H 1#L 7#T \8#X |:s#\ !<\#` :y :# @#: s#c V  l 3 b#  l  ~t# # # bits#u32"%#~*+#key,#HnH#pH## H0wq1#rq2#~ 3s#04s#45%#86#< 7#@8s#DN~U4w x#y##z%#  {%#'|%#r}%# ~%#>%# -%#$u~#(  \B)8 H~ I%#" J%#s K#fd Ls# > M%#exp N%#_4 On#4 Pn#K4 Qn# 4 Rn#$ib S#(ob S#,p T%#0 U#4hh\  S> }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0{ %#4@ s#8( #< ,#@ ,#A L#DJ h#L h#P #T #Xth   ], Lny  #!, # < ko auid^#gid_#}`# buxa<  LfdMs#~ Ns#LOs#>P_#  Qv #Rs#4$Ss#T%#U| #V##s)W #@X#&Y #DZ#{ [%#bo #I)c#v  TQum #ns#Kos#ps# q# r# ss#$%4t #(<5u #,v #0w #4_x #8$y #<`z##@]{s#H|##L   ss s  sv   CfA #bB#` &(?cbC` #sD#~ E,#evF,# Gp #H#Is#  J| #$ p & v a <_D`#?a{ #setb{ #clrc{ # E@d{ #}?e{ #remf #clog #:4h # j8i #$FAj #($k #,Fl #0um#4ns#8v sv s sa  v    s   s     p7>4&un5 in6p2u7 #ZR;Ns#Os#LPs# Qs# + ;uids#4$?s# $@s# As#Bs#YCs#}Ds# `Es#$Fs#(4G#,'H#0JIs#4Is#8xJs#<Js#@Ks#D Ks#He L#Lm L#R# S #gTs#>ptr:fd;su32<u64=F 7G8#>#G]G*G+%#fd,%#|F"s`//U  "sS!"S?Us//U"fdTv Q"dirTs #J+Gg/0U$ofsh!EGisQ!GjsS!jsR%chgksp%fdksW&JQ00'[S(f(p'zV)\00*S+dG#s,G#s-op#s-fd#s,G#.#/F00U"fdv Q LGsS%ptrR7?s0E1U"fdv p"dirs %ofsV!GS!LGR?sP11U"fdv p"dirs %ofsV!GS!LGR/?11U"fdsW%ofsļS/|!TG?s%evD s !Fc0lfA 7(GEa "%@;]&^cint6%>:e?:JA:3CDSEj@ % gBLGQS 3O   # O# _  J #B z# #  w 234%F;LY? g p#H!##f # H# X, 1 -c- - >s# / #  # Z  # # # O# # z# #$ #( # #, E:#0 (@#4 .s#8 s#< #@ "3#D #e#F @$F#G b(V#H 1#L 7#T \8#X |:s#\ !<\#` :y :# @#: s#c V  l 3 b#  l  ~t# # # bits#u32"%#~*+#key,#HnH#pH## H0wq1#rq2#~ 3s#04s#45%#86#< 7#@8s#DN~U4w x#y##z%#  {%#'|%#r}%# ~%#>%# -%#$u~#(  \B)8 H~ I%#" J%#s K#fd Ls# > M%#exp N%#_4 On#4 Pn#K4 Qn# 4 Rn#$ib S#(ob S#,p T%#0 U#4hh\  S> }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0{ %#4@ s#8( #< ,#@ ,#A L#DJ h#L h#P #T #Xth   ], Lny  #!, # < ko auid^#gid_#}`# buxa<  LfdMs#~ Ns#LOs#>P_#  Qv #Rs#4$Ss#T%#U| #V##s)W #@X#&Y #DZ#{ [%#bo #I)c#v  TQum #ns#Kos#ps# q# r# ss#$%4t #(<5u #,v #0w #4_x #8$y #<`z##@]{s#H|##L   ss s  sv   CfA #bB#` &(?cbC` #sD#~ E,#evF,# Gp #H#Is#  J| #$ p & v a <_D`#?a{ #setb{ #clrc{ # E@d{ #}?e{ #remf #clog #:4h # j8i #$FAj #($k #,Fl #0um#4ns#8v sv s sa  v    s   s     p7>4&un5 in6p2u7 #ZR;Ns#Os#LPs# Qs# + ;uids#4$?s# $@s# As#Bs#YCs#}Ds# `Es#$Fs#(4G#,'H#0JIs#4Is#8xJs#<Js#@Ks#D Ks#He L#Lm L#R# S #gTs#>ptr:fd;su32<u64=F 7G8#>#E?He%#s1%#zFEs 7G7U EsS ES!GP77U"fdv S!IH77U"fdsS#pos%V?s7"8U"fdv P"dirsQ#retsPY?s088U"fdv S"dirs $\Hz8#i%P%?s89U&fdv S&dirs '\H8(i%R)?& 9<9U&fd%sS)U&p8 &exp8sp*2H:%*G;%*BH<sl(eo<sh(fd=sP*EG=sQ*>sd* H?s`*F@sW**HAs\'G(v9+#*c*OsW,:";-S-Q../:";0X+4$(esQ,\=!=-S...%1q'=E=00S,<y>>.M.X2d>>.u.3FGs4GGs4GG4GGs4&Gs5G3<dGFs4GFs6opFs6fdFs4GF5F3dAks4js6nowjs3&s6nows6exps%@2s>?U&p1 S'HL?' HN?'FP?' GS?)?]@@U&p\ S%>?ts@@U&ps (fdusP%gFs@@U&p )@@AU(p R7SX7B 7*rs  7Et7&v 7ws 8 7Q7;%7+ WZ7s7 Q%7R%7 U%7 Vn7W Gs Gs iHs H H% G TGs#evKGi(HintEja @;]&dc3C/DYE6@ 1 -G- ->!#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.!#8!#<y#@"D#D #k#F@$#Gb(#H1#L 7#T\8#X|:!#\!<#` y  #  # : !#N 6 G 6 3HI!HJ(HMdHNRHH}H  $tHElowE#E#CPsNllOHP$9HgUnfVWdfPQ'9ͭKU_8$judtpVRWlhWPQX$ RPP#HUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Hm1m0 C!S;!B ;\j/(HintEja @;]&dc3C/DYE6@ 1 -G- ->!#/ # #Z  #  ##O# #z# #$#(# #,E#0(#4.!#8!#<y#@"D#D #k#F@$#Gb(#H1#L 7#T\8#X|:!#\!<#` y  #  # : !#N 6 G 6 3HI!HJ(HMdHNRHH}H  $tHElowE#E#CPsNllOHP$JH[UuZvZPQw\pJ\fplp${`VW\DRPPXT8$P'LFIP4HUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: H!m1m0"C#SL#B L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; ' @ ': ; I (: ; I ).? : ;' @ *: ;I +4: ;I , U-: ;I .4: ;I /4: ;I0 U1121314.? : ;' I 5: ;I64: ;I71 8.: ; ' I 9: ; I:.: ; ' ;: ; I<.: ;' @ =.? : ;@ >1?.: ; @.? : ;' I@ A4: ; I? < B!C4: ;I? < D4: ; I? < E4: ; I?  F4: ; I?  G4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I  : ; % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 2 : ;34: ;I4 : ;5 : ;I64: ;I 7 U8.? : ;' I@ 9: ;I :: ;I ;1 <41 =.: ; ' I >: ; I?41@.: ;' I A: ;IB4: ;IC D4: ; I? < E4: ; I?  F4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U14: ;I 2 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I*4: ; I+ ,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;.? : ;' I@ < =41 >.: ; ' ?.? : ;I@ @41A B4: ; I? < C!D4: ; I? < E4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1.1 /.: ; ' I 0: ; I1: ; I 2 U34: ; I? < 4!54: ; I? < 64: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F.: ;' @ G4: ; I? < H!I4: ; I? < J4: ;I?  K4: ; I?  L4: ; I M4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I 34: ;I4.: ;' @ 5: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH4: ; II J.: ;' I K : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I. /.: ; ' I 0: ; I1.? : ; I@ 2.? : ; ' I@ 314 U541 6.: ;' I 7: ;I84: ;I9: ; I:: ;I ;4: ;I <.: ; ' =4: ;I >.? : ;' I@ ? : ;@4: ;IA.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? <  < src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hdd9,V # +9,VV9,Vj:Ve%9^a;dKY#lq [a9+V0co>rzq< +w 9(WVVVVVUrGr<:t=_g'Yf՜Wu,8VdFGsuOf39M939M{79I979Ig-9exU59K959KsƠȎWr ՠIrdVH,Kȏ.d-)-WT ȂɑVTn~U9PDSs~GI&d8H~c@999H cU"G2yG~c~+~9 +w qw9~c~+~9@c~+~99~qVe9+~UVUVT,RU wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWdVWƸʳ~.7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+t<7e5=D-8,8:dz9W=scW)-b Ȏy9.yqn=5=+nU  ;%urrVg ׀8Hdh  8rr0˸V-rsU s csU+rd5 (V8:VXYXWW~ V^<d32R<RYU9U#rqq4c~9vqUU gVkU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.h HTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.h`GHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊh srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.hUd8,J:,1|8,YJJ:1n8,fe$f͓8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8, src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h;|t*:V*,:eU,I;,qs{>>V: fsU *rey2GdT԰GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ>:V8, s+ UtqIH"Gi# f6,6-nJmqU:*J:8dede9 9W/FtGw;7eu+WHs}G*:5rU)t4 9t+0Vrhd*: 5/~:U@y9>l?rqd++rcHsVrxncre cƒ+,cV qw3W<ude }+}+:}+9}9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg*h:*IH,l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.h@d8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӑ5gd;6d*GnX<;)-a;,HVVW,t #z+fm;)-a;,HVVW,rc%#z+<`>jXr;)-a;,HVVW,t oc:8HY5hdnf%V;,sHzU c, ye,H srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hglobal.htime.huŪ~|<:;juŪ~<,;iG R<:;XRh@XRh9 tq9c">T:;)Wcgm:drwJ,S,Wuc0dpH Tf#~9T(\x9#W2--Ӡ:Rt:s;a;H`I%;hAUdU 7WU v<8:j"GG9cG>dbdq09bQ srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.hPG GfU9aG@y+@ GVeuA%GdS;Td;tr*d,fwq>qQ=8-`G,$+hUzG?|G+(Gc+~U=zG9qxqzG?G|9e99sY*GVSqbqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:ml srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h0%:ydH;Hrq:8d:W U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h@%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV z src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,O src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hstat.hport_range.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hcfgparse.hgrp.hacl.hstat.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@U)~UAKd83R9.Tg\T:bea;7ecI~,8-8~9H1t8dgGH~,ƸƝ:TV!9y@c9cV)8~-8I8cs8Zs8js8*<HK:H8d8dW7jG'GS'.8Gb9lcg&&HyUe*r8J8n8t8s8GGG GKTIT GdHrt8.8ls8G99U = *d:8:8:bd"@T6db=aer5:;:~&wc&:,8dx9xcc:;db-qI8-?Վ8V8b:x9w9G96:bl98-?Վ8V8b:x9w9G96:bmcԎ8s8J8wt8~I8b:8t8,L'$TI* $:p: c7,::7;XH8 s8-qc-8cs82GJ##JI}81}8dz~8v q8J8)tz GG GG0GNe7"0_9f_9!deD8e7"0_9f_9!deD{'~,8dx9xc;c8&:,d68cLd#-9)V--c,8kI8,pcI8dc(:f6f7d,8d8:VHO wUbd$ .9 G%&uSe7;aem&~Hg5g6<6XaeV.;-bd,.z9Hsvs8(8e[H7ddr|t8 9&+,8vr8,8H,8(8 8GH'$TI* $d~'I|U&dcr8|8t,8GH,8s8"r8oՎ8}9,8 G G GH|UH,8dVW8,8(8e[H7ddr(:e8H8a(8 8~(:,{,8Վ8ydH't4s8  GN'8ns8* (:.8G8,8V 8,8d8#VW7dl8w8,-8sVW7d`8,x;UGM%',s8vs8 8,[&rWuV8g8&V8f659U9 c ~r6dd8dI'8,Hks8I'8,Hks8I'8,Hks8I'8,Hks8I'8,Hks8I',s88,&js8t8xH8)I'ds8I',s8vs8 8,&W8I'8,[Hks8V8xH8I'8,[Hks88xH8I'8,[Hks88xH8I'8,[Hks88xH8I'8,[Hks88xH8H'M8rls8 H8yr8 %,t8&8,&W8~8I'8,&W8hs8I'8,&W8hs8I',s88,&W8gs8o8xH83I'8,&W8hs8V8xH8I'8,&W8hs88xH8H'Mms8 H8yr8 =&hhchU9*b,~ ~8GpG=z9rvs*8,uH8vde8ze8 8&8,hdbg_=5g"c*8x83#8mَ8j8Hd/Վ8Q:8:b:u%e8#V8d cw9:o9s8o@@@l8d8#e[Vsd w9kycjy9@ycvs8$8#8=z9rvo'8u8uՎ8s8x@czVb:zGVb:#Gb *8x8 8f*8x8b*8x8 q6S8~$e7`e b;+L'IIZN&bpdVd,,d G1 9w9dtn0t+9I '~q6t?(|9{cUrHV{R{Ӝ'UN+4GL+6G::8u*`Ry:p.& qwU b $,&zcoUqpqU9rrq:ry9;}x9GoUm+mc~98,V+x93y+o99yU ~ srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includequeue.cqueue.htime.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hqueue.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.hP&cJW@#re)Jj9d8V,9::8H<DUQ/+Qc uc +,d8:~G8,z* G:f:b;af ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d ~  srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.h 9:iEas,Sd=cc~'$#sv, G~9,~qUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zU<D%Vq 9t+ cK~HM1>@yq2~+( )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`Gm+n+q{:|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcxqO92+N+4+L+1xN+6Gc9~zdH-,8: zcdH-,8:,pyY+~=qyqyqczqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd 0 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6:7/JU,k}qr:T:ckDGI7-v::8e :rt:/V8:a:[r8k>rV%+8d}I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎W:vqe 9vUd X+Jr~:b:;7:,`:b:;7:,iwUA+T:8:'Xb:8,d$ ~$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^!Gy+ %z_S9-9S+-9!9^!9^!+^U!+^9!9^c!+^q*r!Vi8rV8:H:8dqUA+l 4'4dpUdjmUY*Gcooco95c,6rsԀd Ŏ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrkmY*G~c+~++vGE +c7-UmqRd`c`U q_9 G_9 9H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrilvq qm?z9hUhqFq:9q9 V;%;8pHZ,@y+@y9@⎸d :pyH=53x9<Tld28,.78;+ wU5=g*Z}s 9s9: qV;V:jy9@⎸dd8y+d8 UVd[<6/540l=d:8eaX++t+;7db 9t+ 9'xq 9z9ccc?c9c+9cqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU $ srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hport_range.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hstandard.htime.hglobal.hproto_http.htask.hnPAh cv9 dft**sHFcd~e9dcn[*ddl++xU~?z9.ԜhG:IGHdHw rtc + :8,H:8 9w+dp@(deU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95V;96;ԀddH40P G;ǙfrrdpVpy92fq'Er8;U=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f{GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:Z9&9H8,8:^>:8:Up9t ;I7; 9 +t9 +w,V:=C/:0,=5)$ӎ*=8z9*J`t%+`,W-+RFrJvGdr)+ VH:T1:*rt:8: 50Sq:qtf-rs:<6<`VdƸ6fKdQ!i x]:rsv9 +uqJsgV|W2rsl9+kqK8cuG cfVu)LwUcrs 5/lJ8V1rs 5/lJ8V+d r srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.h*@c+9Y9*GBc,'XY9:rs G;q<7snssdyU<7snssdAUT Gq:Y<7snssdUU++:*dvGE++9vGR  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h;STd8d"؎8Fe/Sc+V98&U`95 ,=\92~=pcU!8,aUGG~d9~,v2c/S9-9U5x+j`% Ud m@7zq:9{U@++o+[| $#zc 'Sg o,8[?W 9%'d*i>4}0v+u;d8J<:pg5=,;+47-*}FY,8E 9F#-K T̎*#U&F L IG *$*J&~c:plA3;d*?:c 9RL,b9N }<Gq~G~d*- ~zlis#/dK|+|Uq}';sdȓ97*}cq}B-G0zc?H+@4> +*ed Gd q:*}0+|9}}lish ϒ$izd Gzd G+UgIGԀ*V+*e++9qGHR:6<~nsxw+~cV '$ 8'$ 0 3v' U#'>8zwwzzwzzP=<Gw=<Pe7bd~:b,+s&67e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g= m <9,+ 9krI+v9 qd $ srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#9,~qUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~+9~9+~+  9D}]u!GN4vpI:p 7-TIT  *7b<H?|&8:8&:RUq&|b,9UU|q8:8F:|8:8:8'|:,|9:*9d0(:p-V q=,::7VV Ursf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzcdH-,8:xdH-,8:,p{rdT:Vrsb~~q9z%W+e6} qxu{qJy=:LGr c}h9Ǝd-H?:?zzGGr~bdrds{3r}dԀd9e}H  +<dyƨ_cf)w>9B9 n f99b 8V1c7s O197e:{|dqY*GdUY*GhY*G_:qY*GdUY*GhY*j~HkH~Vkez?wqx6qq6|q#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.h&9::8:-J:8:-JG;#HII7;HI<b+:x usU 9T,T,+d8)),zc1sOXZPYMG f *[crH8:+(BrrP>8dtXX RGx*srb:ddS-  `.Wgrtrrrrrrrrr srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd:GH-, GdwɜQ 9vJZerUy+ru;xc^0rƎsz Uy+ srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.h ;9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h#cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.h0%yqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h)!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.hpoll.h`*)9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud +8:)WWS;|;);-l9_:Tif9i9 8,*z9P>TfEt6XJX R Gz*srT:ddS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.h`/!G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;HrtzU?HXr q~G,as@drrc?lqp~fG~q *G ńP>pdWJ6XX8VJ8YRGu*s[,GHW⸸dzk9.*IV 9,e `.*Krtrrrrsrrr srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.h 7G,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9;)H-U,TV  ;7W)7W=7+՜|4f9 vc: qTV*R<(bbc"~;;S/ 7W,}9c}cGVl$VV$p:T}f9}9 T9`qqq>ae6XJ8YRGfGr,fq!rT:dǸd39.*IV 9,e `.*Krtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.h}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$ .z  f.). <.e. D..1.. !.*.x..x.. %.-. 5.. .. $.e. 2.-. O.. ".. .. /.. d.W. .o. .6. '.4. .u. >.. j.]. %.. .. ).D. 1.;. .. T.. .#. 0.q. .6. 1.. O.. T.s. %.r. .1. .. /.+. /.. <.*. q.. +.. +.. +.. +.. +.. <.Q. @.X. <.. +.. +.. +.. +.. +.. C... .. +.. +.. <.j. +.E. +.D. C.. 2.0..D..}. B.\. [.\. .<.  .D. .N. ..0. ... ... f.. .. .X. /.. l.Q. 7.. k.=. 0zb  '.<   .3 . A.  | 0: pR | 4TЍj !.8. 0T@ 8.4TЎ 7.`T` E..D. Q.0.V.N.  .XT 6 ..D. \.3.S.,. XT`L ..D. \.?.6.  .TT- ..D. \.'.6. LT @... .[.<Th ^. -..Tpv   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8TT g..| ("P $"(  ." } 8" .:.8"_  ..," .| 8,$Ъ` . ".t,$0  .?. ].. .l. ..0#..C. ,$J ,$S ,,$p| ?.,,${ ?.,$p $,$ .| %7 %* T%  .... @.. .D% Y a.Y. .B. T% <.5.... .0%`z ".l%5 J........+..L%   _...=..H% .%. ... ,%p .,%S .<%p [..d.|%P5 .J. ...  . . ... )..t%g  .2. ... 3.l....  .$% .| (* Q p(*T  . K.........<(*  ?...0(*  U.0(* .0(*p0 =.0(*: A.$(* .| 4,9 ..0,@t  .0,c .0,0 /.(,\ 8,  ^..4,+ . . 0, .$,E (,a (, <,P  .n.3.X,. 0.....2..D, E  w.. .. 0,p .(,0 (, D, .S.:.a. 8, G.a. 0,$ .8, . .8, R. ..0,@  .4,  %. .<,p  . k.. L, b. .. 8..0,0 Z.X, .. .. L.. -.0,@ I.X, t  .0. .&. .. .<,$ . .. L,& [. n.. 5.3.0,p( U.<,) E. &.*. ,)  G.F. G.Y... .R. !.. . . j. .W. m. .R. g.;. ].<. P,64  ..F. ... J... S. . .@. .. .G. _./. .. ...q.X. [.4.. ".>. w.q. *..b. .._. q..e. s.x.&. .<,O\  ..&.,PPD ,,Po =.,,QA  .(,`QY (,QY (, Re ,R: ,,Rs 5.,,PSv 5.0,S *. ,,TE ;.,,T? 5.0,U_ -. ,,pUE ;.,,U? 5.8,V *. ^.,,VE ;.,,W? 5.(,@Wd $,W .| (9WC D9 XA M. {. .C.,9pZx I.T9Z .J. .\.1.$.,9a 8.89`b ..09`e 1.$9gj '.09gW .| $<i .<<j) %..P.0<kJ .$<0m& .$<`mM ,<m .| (8=n  8=o 8= pA (8=ppr (8=pn <8=`qb ...08=rA $.08= t x.08=t u.(8=v (8=@w" L8=px  . .{.'.r.,8={c %.,8=p{ .48=`| . .D8=} $. .B.0.,8=P .88=pF  ..<8= . 0..88=p W. f.|8=6  2.\.U.E.t.l.%.+..<.;.0.,8=Ўt O.,8=P c.8=   .{. .. 1..&. `.. Q.. O...08=D <.8=; 08=0 .08=0 5.08=Т 5.08= 5.08=0 5.$8= .| LD- LD* ,LD@ .,LD .| 0E  R.$EP .HEpO  .. .4.0#.. .... ..@ ..0.X. ..pF. b.=.0./. .-. k.T....l. #..0#..@4. L.t.p...LE ..`J.5. .<Ee 5..` .,E@9 .E . '.\. '.T. Z.p. D.!. -. .;. B.?. #.. D.XEP   .). s..0+..@.$E` .| <H f. .S. LH  O.F. v.!.. 0H@T .HQ HQ 0H`\ m. tHx .\. .. b.Q. ;.X. ..0..H@+ (Hp $HP6 .| ,J{ _.8J ..$J? #.(J 0JC .0J /  .0JP }.LJ` .6.t..t.Jo J| ....$.I."..*.U.Q..2.G. .s. .H. .$Jp | (Mp | M$ M@  M`  $M5 $M0 M$ 8M  . .,M .,ML  .M  M | $OC .,O %.4Opt 5...0O  .| lP  lP 0 lP  lP   lP   lP  ,lP0 c ,.4lP  *. +.,lP` X !.,lP e &.0lP0  [.0lP \ .$lPP .$lPp .(lPm lP) 0lP0=  .$lPp  .,lPd  .(lP4 (lP0. $lP`+ .lP lP 0lP@ .0lP .,lPL .0lPa <.<lP .X..<lP0c ./. .<lP  .s. .<lP !.. .0lPh +.0lP  .8lP . .(lPp; $lP .| 0W M.,Wp  Z.8W!\ .#. .,Wp!4 .,W!Q  .<W" .R.0D. | (pX"O (pX #F $pXp#S | (Y# (Y$ | 0pY0%_ .0pY&n .(pY({ (pY( (pY ) | 8pZ) .1. .| Z`*$ Z*  Z*  $Z*5 $Z+0 Z@+$ 0Zp+R .,Z- ".,Z.@  .Z.  Z. | $x\`/' x\/" (x\/ ,x\0? (x\0U (x\P1X (x\1N (x\2K 0x\P2 x.,x\04- H.,x\`5 .$x\6( .,x\062 ..x\p6 | $^ 7' ,^P7J ,^7P ^72 (^08t (^8c ,^ 9 .$^@9 D^`9 ..T.X.,^>  K.,^@  .$^@( .,^@2 ..^@ | (xa | (a totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavailsrc/haproxy.c__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgo__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognamedowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authstats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_nameout_realmstats_add_scopestats_check_init_uri_authstats_set_realm__lenout_base64ulistnew_nameout_ubase64src/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.chex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_strst_sizeatoist_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalinit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uptick_addout_errortask_newprocess_chkfd_insertpc_endevent_srv_chk_rpendconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterevent_srv_chk_wlskerrsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrc/queue.cpendconn_get_next_sessprocess_srv_queueratioinit_pendconnsrv_dynamic_maxconnpendconn_addpendconn_freependconn_from_srvget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportladdracl_testsalensrc/client.cmax_setpatternsacl_keywordout_free_sessionmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchout_closebuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxhttp_msg_oodhttp_msg_rpbefore_crdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdrbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiepathlenquotedhttp_msg_rpline_eolacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverasession_temphttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenret_ptrhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptrhttp_is_tokenauthenticatedhttp_find_header2local_asessionhttp_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirecthttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcodenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrhttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupappsession_refreshinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_errprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queuemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serversrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serversstream_int_report_errorsrc/stream_interface.cstream_int_retnclosestream_int_returnbuffer_abortstream_int_check_timeoutssection_typesv_statesrc/dumpstats.cultoaprint_csv_headercurpxsrv_hlt_ststats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafterfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_stracl_match_subtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01"4u - / @    U  (2 5 8 @ u x { 258@#  2knvPSYx1;Oc?I9CQeFPcjEcj C| hQ S ` s Ni$,68BG^4vAFchQY^h T }O;1 4     W | ' FW\_QVsaiz\ ChMa*}- C"$L$##!! "">5?0"N">5?_""$~%%%&'DD DZD@\@2P32t2>11=- .,-)** +7+!,$,,////m0>17JbJ'IJGHCCBsB5?@+=>k:<P36t2212i45'IIGH56BsB5?@7c9kxxx?xJJJ7J9k::w;z;;;;;;=H>K>V>BCbJJEFQGGu+vKLyoLOcRRVOPPPPcRoч:qqSSq```pabcttmttdetuefggg2fggm7mkmm.nDlOlUlZlLmm.noo:qч{|:t}~| }C}M}| }C}M}w݂U=X݂d .UŃ!U%ߊ**ߊPrP׏rM\ݏLHP&F_ 3ܚښЖ(!\C3L\Q3L\v eflE  " @  =&hxb0C00Cfyj e  5 + n  n  {e B E` 3 3I&9!#  *  - @ % ' I*;qv~y~  0&%? _ Z f R T E Q o    S Y J1Nf#F / 2 , p!!!!!!!!!!!!!!!!##$H$%Z+t+++$,j,,@2-.2@211J11;00--J1]1--j..]1p1/&011)0;0//11//e00112 3*4=43344Y4t455555=55M77<<M7S7<<V7k7p8v8<<y88 9l9<<99H;;:H;=S= <u<;;<< <S<V<u<AAAASBXBcBiB\B^BB%FFFO'F*FC%F4GeGF*G'F*F.DEF*GPQQffefddncc_`^^\i]Y}ZXYQVPPPLQLQQQdd_`\i]SUSSLQQQdd_`\i](TUZRWS8Z}ZYZ)U5Vff@UDUffNU5V>[\hhhchfg[\hhfg\i]dd_`\\dd/^^f+fa__ d3da8bggb4bgg8bSboffbncd%ec d%e?ehchhh^2 _- h  RfM O S p t v []aw2HLNWF nNp , 5F P+7>P*6$%X,,+F+@*+ **()T)&',,F+V+++(()''''<,X,T) *E0S0e11E0S0e11[0e1z33Q3`3/3<3j233333%'/"[}SV=P %+ik}SVCP _ =!#/G~ :" u%Lp%u{%/G~Gv%/ p"U%t%$%|"$%%%%& '*,7'O*p'Y)+#,)O*[)g)p'v'+#,)O*'$)''''y'|'*+#,, 04<@t l    9 # 2;>@kps{ 7 = ]  q | ? D  8 j al|DQ!"63PP369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_'*xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh,7 ? WGollTo<<@c ||8l  u%p{``T00 {ttt<t  h  4-Qe@Ɯe] }l- 9 aF0G IQА W $p e p7'p  /4Hhl<|   `  {t  !"#$%&' (/ >I/  t8  !.p<H >^/ DH@ L`(5 %1`;FQnV[ `jp@|DH@@\ldpx 2 P&` /: GhDP[dmЍj ~@ Ў `  6 `L -  h X#S 3J Ap| O{ _p o }   Y  `TT   #ć0O\ ?PPD NPo ]QA k`QY {QY  Re R: Rs PSv TE pUE VE T? U? %W? 8@Wd GtU ga v @S U_ V W  XA @D%H3=0 MТ a x0 o  pA ppr pn rA  t @w" .px Hv U{c ip{ `| }   0 L ` , 8 @+ J p Ќ` x r T~ @T `T  P6    $ L @   `  5  0 # $ ,  5 T>  G L P   Y  f o u   0  \ p  L a   ( \   + 6 @ ` `*$ d *   *  *5  +0 # @+$ , p+R > - G .@ P .  Y . L W l_ ph tr 0} `/' /" x /    0? 0U  P1X # 1N 2K , P2 |> 04- G `5 P 6( 062 Y p6      } 7'  P7J # 7P 72 08t  8c # 9 @9 6 E , `9    > >  G @ P @( @2 Y @ V e @l Dr A B  |B" B" B< Ck %D /(D @V WH /G  X xY8+ Z> ZO H[ sbc G/ p I| 8J J lK> L\ M@ HM 8NF NO N] 0O\ /O2 <O0 MO \kt j,n v o o /| oo|v ! / / / / F / '4D= Y`qb i {C ^ ; c f @Rhp  Kn  &@3>* V` e`t(p p  ) d (5 2 @ H ". 8i M;_@ pC1 @   P   h 1 @ !\ /YAlC; R7 k v@ @    $   `mM  / ) T* >` U _P rp - t 5 )   @S j) =H%p0 =T Jpv  V 8f  r0@ qP7 7| @B-  M $0%_ 0 IC/ [^a/t/ N a `3 `` e @ ' Pv 7DL7^w@s2  @  0 ( p 0  #F T I" ;pw G\1p@K | WC  pB   f pt   `z  P 0 ,D3O  a q@  `O  ` X  `( @C  x %pZx 7 e E:WI e o;kJ @+   :p ,4 Z 3 1 $`b 6:Hk Vp#S g t $ 5pU q= pR /P r  +_ =P1 UX^? kzb w7t `P C  :P  0 ' 10m& ;P Q;aQ t 0 c o E :0 pZ , $ (/ 8 K0: Z p:` 3 B\ z    . P . 7B QЙ" `Ap { P  ` m / p  q7 C *& C7TO a@ j~Ўt    p @ 0) @Pz ` 6   Q / 3 p ? D I f 0= t p!4 (    ,  $  !`+ !@ !4 %!- *!H 9!{ L!p= T!0= j!P ! !} !C !9 !<!O!! ! "" 9"q@K"0U"qg"Lt"p; "PE " "p) ""@  "p "C "# "`\ #m #J -#:#@L#P1 j##X6 # #W #E #0. #,#@9 $A $ $ 7$S B$ V$P c$d q$S y$`$ $P$ t $C $3$P  %:%  !%83% 9%#J%@ S%qe% |%w% %`%c%:%%% %` X%X &(D &@t (&({ 4&0 =&;U&Y&h q&b&3&  &&=&0 &(&p &0: ''' 'H"';'!Q I'^_'P  h'S}'&n '0  'p( '@ ''(' E '(+ (0\ #(pO 4( I( [(@C h( } v(0qQ(p' ( (Pp () ((  ((<( (:)0 ))  ) 0)0c :)`I J) `)hr)D )0)A)u)gj ):)4)gW *P5 *L&*Q 9*A L*DW* ]*m* w* <***pF *`8 *5 * **ж= *++@ 1+ A+_+ g+Y r+ +7 ++" +"O + +;+p  +F ," ,P# (,  9,: N,  Y,Dn, },:,