ELF4 4 ((%444444TTTHHH Ptd|||Qtd/lib/ld-linux.so.2GNUaiW@d,eL)NB>(&M/8a\K[cUVZ`Pf96H<Ig bX4EY 1A Rh3$_T;^O "!'2 #*.0=C:?7%QGSJ+F5-]DK(=H1;`Y /u=H0A7gM"//vD7IW1{o@b*:; :Z:5/%7q:;]:C$P(W:3!B5.AQ7,*OW0\ \ h,#3L:8#q@c6:8XG[ ;b3,b=^S#(@ t:hy0uO:i4G;DJ:\ 8/t:  @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_putc_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii Bii Lii Vg $&(',30T4W,048<@DH L P T X \`dhlptx| !"#$%()Ī*Ȫ+̪,Ъ-Ԫ.ت/ܪ0124568:;<=> ?@ABC E$F(G,H0I4J8K<L@MDNHOLPPQTRXS\U`VdXhYlZp\t]x^|`abdefhUS[hW4[5$%(%,h%0h%4h%8h%<h %@h(%Dh0%Hh8p%Lh@`%PhHP%ThP@%XhX0%\h` %`hh%dhp%hhx%lh%ph%th%xh%|h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%Īh0%Ȫh8p%̪h@`%ЪhHP%ԪhP@%تhX0%ܪh` %hh%hp%hx%h%h%h%h%h%h%h%hp% h`%hP%h@%h0%h % h%$h%(h%,h%0h%4h%8h%<h %@h(%Dh0%Hh8p%Lh@`%PhHP%ThP@%XhX0%\h` %`hh%dhp%hhx%lh%ph%th%xh%|h%h%h%hp%h`%hP%h@1^PTRhhQVhPCUS[Pt[ÐUPP=8t ҡu8ÉUQQPtt hPfÐUhd4$(ÉU hh@hX$PQZ$YPj ÍUPP ̮PEh@P(hPj^v'UPP6>QUQQjR$ÉUPPA0U]B&UVS54  h9J^dQhjV:uRR`P\PC4PC$PCu~PPPh,h^h (h h`S9h h`jV: u^dNh RPPPPPPSNluPRhlh^h n@PPh h`8h h`jV9 e[^]ËQRPPPPPPShh^h 0jPPPPPPPSQRFlPFhPPh0&'UPP膜UWVS$Eu EE}@& ET0 / @- D- jjH- - (- $- Q|C7_b0=Z7( @ v@@PPj/@PuO8-usX@^HUtɋC d S:9DLD= P؃u RэXPčXP跍$Eu F$EFP`_^SVYV RLXFPBFt)t&à FCP!$Fuۃ V끋dUUVS1ۉ;D}PPHVCPA;D|e[^]Ít&'UVS]jjz9t&PPEPh/ /  5 8 Vy1$2$-@- ޅuT0 ue[^]esvUWVSEE PEP^_h`jrY[hj rXZh0jr_X}jj  15DP)ƃu6 Dt, WjjjjEE' KyT0 L VVhjqY[h jqЃߣt t utEEEQQPj/@C  tRQ kDt P"@EESESPjU9=1~G0t8U܅t]WPhSYURF@95E܅t EP Pv4 t-xt{ tu95tptt; 4PX=$W^(S #Z=u 6 j S)Yhw=EEPPEPj @PPE Phl#sE WW0Vh# P@ h =Drh Ps@UPPE Ph"XjEQQPPPE RPh # X P hhAPSSh PE% 4RX$PX(PM RPPho"M WW1Vh"t&M SS Qh t Du j PPE Ph|!XM PPPhd!=Du 뤋M PPPhL=M PW1VhpS@tE RQhQ SQM Rh@ Du  *=PE W0Vh`뺐USMAҍu1[%]Í'US]E Ch@Z‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPrtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPPtC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PrGe[^_]ÐUVUUUWVSu M]~)<;}|o{1% A% Š 1҈CQA% Š C1A? Cu [^_]Ê%N t>1ҊA% Š C1A CC=C1C= CېUSQ]{t]Ë9| C]RRjP/ C]Í&USP]C~ t C]PPjP/ ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P1C1]Ít&PPjP/ C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]ÉABHHIHH]ÍvU EPLHP@L]Í'UUJLBPABPBLBPBL]ÐUV1S=XtC0uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC4uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC8uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC뇍&E ;]%uve[^_]ÍE9sJ'UUEutËEPE PR/ ø?ÍvUSSS]jnjh$@lvQjkSh]fRPSh{]Ív'UU0 vv %&]Í&'USMȊt,0Cu.t:t _t-u Au1[]É[]Í'USMȊt*0Cu.t _t-uvAu1[]É[] UVS ]SÅtePPj:Sh1t@jj jPƊ<*„ Шt7f ffSe[^]PhSju SSt@PPSh뎐&UWVS }$W(,DžRRj:Pc1EtBCPPj-SƅFjj jSVjj EjVDƊ<*„ ШtI$Eff"E U Ef 0We [^_]ÍvPh$Wju Wt@$뎉HPPWhyrUWVS(EPbǃ1txEU PPj/W+ÅpPPj.VtCPEPVjtRM SQWjtB W؍e[^_]ÍvEjj PV{t UtF:tA1à Wt@U 렋UM SQWjiuà wt )ȋULE>'UWVSEuEuE}uF11ҊڍB=Eu]C]}}EtOFYЀ ƒ.%u3 v.M…%t8}t2GEu}~E UE)[F^_]Ív1[^_]ÍUS1ۋU t&ABHЃ v[]É'UWVSP1ɋE]߉f@f@E E9vm1C9//:%uف//:u>K&UF‰U9w} }}pttht1e[^_]Íe[^_]ËEPS&Y^tӸP;:t fUfBCSZ鐍&UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&FPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u( | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CP}ƃ1tPSWVe[^_]ÐU jhh)i- %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRdKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPzN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVS1M]Q=U EE)Ћ})NjS :9s}C 9v9~ME)VRURP% EPEPE PC;E vCC$;E vC$CCхu;C(r e[^_]ÉCuv'UWVS 1}U ])ЋU)‰USE 9sqC 9v9sy)PRUWPUEujC;E vUЉCC$;E v}C$sECхu;C(ru e[^_]ÉuCu{}uM PWVQO|vUWVS 1ۋu}N99r e[^_]ÉRE )QE PE P~EE…%uTF;E w>F$;E vF$FFхu;F(re[^_]F뻐PEP]SM Q|E U D 농t&UVSEu] PEPF)RPV)9Fe[^]ÍFe[^]ÉUWVSE} EE]EWhMQ* W$RG PGPGPGXPh EPE G9EvEEPSh@uV;]}3ރtvPD;XPhEPt2C;]|͋EEEE E e[^_]G냋EH9tPPEPj C봍vQShURDPD;XPhEP,wEPjjh믐USDt0tf0- EčERRPEPIt ] PEPEPEPEP(hlP譿 (S]SQIZ(P轿]ÐUSDttf0- EčEQQPEP Uȍ] PERPEPEP(hP-ESP(P[ (Q=]ÐUSQ]ttERPE PS$]ÍUVSuPP@VPttKye[^]Ít&'UVSuKxPP`VP/ue[^]Ít&'UWVSEE u]=@ Ȩ0- ;ȮG@9EPS@)PRBE^@);EQED Kx(EE‰EEEx2M D ÉD D D }G}1;}t&D1һfftĮ3 G;}|1;}Dž||G;}|[|Et*f>tEĮ|E 9D)|D)D);E }E »Ctt dd0gfffttKttU)ʉtt@w)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]ÉA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh0- =\4- t‹ 0- puȁ?BEU;- %PEh- P~E 9E%EU- -  - Mb)ʉ - ҍ)Ѝ8- - £,- e[^]É@B@UE;- 4;- )E9FRU ؅t1Ph- V0- U)‹E +4- x:tp#0- 4- tpEU@BtBpUWVSEx]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9uu#P<ERhPex[^_]ÉڹQPЉ )ʋMRhQ貯U‹EHUE%&E.P)RhhxnxEEvڹPЉ)ʋMRhQ&U‹EHUEfx?ډ)UWVS}W/ 5L0$\0 … ШuAf\AY C@Y ;|rA D3$WةD/ Hx4 Ȁxu t&Jx (ʀ8t / e[^_]ÉA됍t&'UWVS 1=9}-1PPEP- P;u ǃ- F<9|Սe[^_]ÍUWV1=19};`- tF89B8~A<9|tF8t VV$uF8te1^_]/ e^_]UV1S9}1`- F<9}"tS8t FSS(<9|ލe[^]Ð&UWVS EPjjhEEE 19`- t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99- uP- PEhP趧- MQj jh#`- $- EPjjh~E@EPPEPCj 蛩 <9cv}19} tUB4uMPVShQe1[^_]Í&UEPjjhZiRPEh P貦'URR/ uà h/ Ѓu h/ / 1ɉÐUSt'B HCЋ]á19~tLJ AJ 1҅t̓ EPx8ڋEC CEC@뒃 RI믡P JP 1i&US]CPQXKQGtP JP ]HÍv'UUu&B @H]]x&U jjh9GÐUWVS }u}t<\tFGuEe)[^_]F1ҡ0DPt50MFT~~ӋM )RSPW߃듐xtFGF,F 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡ0DPuHxtVVPh@ 1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjj˦U PUp Pe1[^]ÐUWVSP\`8`dRRj,P*`t @`PPj:dPsÅ PPj:CdPRUhPhjR3 pfDžh PdWj  PPj-S荡W@jj jPjj jSÃ@=G=v)f fFV( T0 AC T0 9cPPhj9 hƍ@ hRP#Ffh uf fFV뎍`t`8[ \Pܤe[^_]PhhjPޤdfDžh<*„ Шt+DžlPPj-S6jj jSPlPdPjyg dPϣtl@l?SSdQh"?\ZPe1[^_]PdVWhPdPShQQdRh=PPdPh뤐&UVS[M ut~,ftt1te[^]û܍v RUt,RSRPuV]SMQhe[^]ú?͍v'UPP1ɋEP89P8tEM PEPQh@ UPP1ҋEuËEPEPE PhRÉ'UPP1ҋEuËEPEPE PhÉ'UPP1ɋEP@9P@tMEU PQRhT UPP1ɋEPH9PHtEPEPE Ph UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًMSVWQ!uƋUSVWRNt뱐t&UWVS E} u]ESVWPtEEe[^_]ÉESVWPuًESVWPtĐ&UWVS E} u]SVWURktEEe[^_]ÉSVWEPuًEe[^_]ÉUWVSEDžttu$te[^_]Í&t"u.븋 t e[^_] t# ugu  u uu5UB8jj jPTu2=UB8tqjj jP{1uu1Ciu1Cdu1Cu~5UB8tjj jP蹜#RE PEPhsDžtSU REPhPNDžt1gu1Ciu1Cdu1Cu5UB8rjj jP|uGu+V E@P?t|@ SM QURh6 E@P螘td@PPE PEPh贙_3V蛙ZYPP袙;XWUrV] SMQhDžt zkXPR^_PQYZPUBPE PEPh8PE PEPhtEu5UB8jj jP胚 urUB8jj jP==@=@ h@P} WuVh@DžtEPW u2uڋUB8jj jP襙 u2 uUB8jj jPb%u2 QUB8 P , U1۾B8E FRǘU\8uޡt PcPPSj6ËE @Ph =SUÃB8PEFPh=S轚UÃ֋PE P}Wh(2V] SMQhdE1X;=0 3fGu*u% _t-€.%uF<3ut7<3u1t PFE pVdUPE P}Wh8uKu6UB8t PPE PEPh$rU Q1lu1Cou1Cgu1Cu+UB8tB8uzEPE P}Wh`@`UB8<jj jPt2PE P}Wh PÅy(UrV] S1ۋMQhDžtUB 8vU1B8UB8/ fDžxPxP|PU@ Efzu fDžz== PE P}Wh$Ltt fDžxP xjnPRՕ듃 PCDž)E@PE PEPhPtt1xRjpPht 5(=01xQjpPh4F5$=, PƅtE1P RE PEPh7ttBPE PEPhQU REPhЮЮtK tރ~t. ~ uۃ hE0V] SMQh<RREPF Ppu hUPhth^h 觔h^h jjjEPV |/h E PEPhNDžth u V]ShNU htDjhݔ̮ؽ̽<QPd```4000 8<@DHLPTÍv'UWVSldEDžDž8t& Dž8UB8. Pt/MVVYSRPE PEPhKDž 4 t&}PPG5PWu| SiZYMPAP PPPE PEPh*5 CPPhtDjã 4  C0ǃxC4C0C8ǃ|C yd}D8%U tV;uӋE;j5F5u ]WVShPE PEPhzDž MQ:t&SPPR詴BuU EQRPhDž މPP;u鋅@ L/}_@| P XܾPXؾPX=W^SنYR̆X(PXP贆XhP訆_5ؿV蛆[ Qܿ脆 Ra@~o@y1iu1Cdu1C.UB8jj jP5ll4 9tꋽl9luփ E QRPEPhq DžE SPEPhdLDžqM UVVjSQRjP? t DžUB8PE PEPh uPE PEPhM} uPWVhuPE PEPhP]}1tu1Ccu1Cpu1CBA, n1ہ,UB8$+M 5 UUUU}@:1au1Blu1Blu1B'1ou1Bdu1Bdu1By( _}PE PEPh̼Džx1au1Ccu1Clu1C} OQt* WRPE PEPhL+Dž PP0PEP3Eu ]xWVShu]>u WVShd贻Dž޿^$ }PPju} PWVjSh t DžUB8 1 DP~MXAP} DDP| uHjj j~ W| LjPNQVt] RPE PEPh胺 uPE PEPhdTDžyPWWhP这t\=G俉GEp>&ƿuB@BCM8u] MVSQh詹 EU QRPh }u1^iu1Cfu1Ct8nPQ0PEPE APn uD8DžC*}D8PPPDPƔ !ÉE;aUM ZUSQRhɣDž YYQmg$dtRjh1P6f5}džwDž>q*}D8BP PPDPx  !ÉE;aUPP} uPBPPWVhl DžAމ}D8/ PeXDP e  Pc $UPP} uPBPPWVh衡 DžAމ}D8 P!eXDP@d P,c PMWWE 4VYSRPEPh8֠ Džu } FPuPWVh|襠 DžESS QPRPE PEPh8k Džu } FPuPWVh|: Dž_ ,QcMBI%@B9tuv >N j`tRjhHPub,ǀ0ϻMAPE PEPhXDž}u ]P>u WVSh' DžLDžkuPPj} FuPWVjS t Dž ,Qb=UG% GB8}w > P`4$`MAZ8ts Pi`à S[_=,ZUYB8uYMPA PAPhbS,P-a 0"Z 떃 P_p4$^,WhmV,V` 0 j^tRjhPA`,ǀ0ESSjU HEQRPjPZ t Džt B B-A A}PPj5G}PE PWjV t Dž ,St`B% Btuh PZ^_VK^t4$?],EYP R@PheV,W/_ 0$ j\tVjhHP^,ǀ0uPPj=PE PEPjW諻 t Dž}_^HMA8 XP_uX~W ^ XXQ] \jj jVR ]=``?~;E j?PEPh7ǀ`?PE PEPha EMS] 0VSQh. NbMAqJ=tu}G 8t4W1lu1Beu1Bnu1Bu UB8uiM E YSRPEPhX耙  u}SPE PWhM mPPjj\áuXF P\ C~ W[ Cjj jvV[ C @jPhCQK n}wAV=tuUB 8t4R1lu1Beu1Bnu1Bu uF8ul} M UwVSQRhX  )E PRPE PEPhӗ PPjje[áXE@ PZU CB PY MCjj jAPY C @jPhWCQKTu] M6VSQh%RRUjPE PEPjP t DžMA8 SoZǀYRSZuXFPpY= P_XDž Ep>tX5FFu@;u=PЃ H!ƒ t1}PE PWh謕QЃ4H!ƒ4M USQRh@a=Dž މuC5F}PE PWhމ&5FPE PEPhd薔uE VRPEPhuDžM PXwN9}*u} uPWVh裔ً ‰v}PE PEPhHݓEPE PEPh讓Džމ65~~iu ]WVShUu t|UQQjE RPEPjP t DžMPPj:AP`Rt^} OQSPS PS$@ C(Eu ]8WVShd艒Džu} uPWVh_MPPjPE PEPjP t DžuF8?} OQ_Y1 W}RPE PWh藑 UM USQRhdhDž1lu1Cou1Cgu1C EX;t-@8u>;t uF8u%U EQRPhPDž PFÅ/}G 8/U1B8UB8/ fDžxP~xP|PU@ Efzu fDžz/g/ xQjpPRR fDžxP| xjnPRR{ PDžMu ]yWVShP茏$$SERRjPE PEPjP聯 t Dž erroPEh^ r neh  ar 'P bala nce' +m'E }h PWhNَMPPh=PE PEPjW迮 t DžuF8jj jPPPPEj} uPWVjS_ t DžUB8jj jP1Pt6uWWh] 6MVSQjR t Dž}G8txjj jPO6] MVSQh苍 EU QRPh_PE PEPh3SPE PEPhDž+PE PEPh<ߌDž;^uF8tvSSPdPuEU QRPhf މuD5^^#}PE PWht/މ5N N"}G8WWPdPu] MVSQhqMPjPAP} uPWVh#Cމ }D.@RRj.PNJiu \Sx u| LQMAadQQRPgssPE PEPh)I PLZËUDPLt 4$J}XDPWhVSLV~Mu TRPE PEPhm U}DPE PWh@趉`Uu ]+3}t>Y/@/HH};w GuPPjPE PEPjP象 t Dž}G8i2QQj jE ËEjPRS 2jjSPM}P5E PWV蘣 GMUM SQRhdDžN}PPjPE PEPjP t DžUB81QQj j*D MjQRP{1jjSP}5P}E PWV訢 WuM USQRhdDž-VUPPjPE PEPjPџ t DžMA8QQj j:C ujVRPujjSP}5P}E PWV踡 gEM USQRhdDž=^ UPPjPE PEPjP t DžMA85QQj jJB ujVRPjjSP}5P}E PWVȠ wEM USQRhd(~DžMg UPPjPE PEPjP t DžMA8QQj jZA ujVRP"GjjSP"}5P}E PWV؟ 釴EM USQRhd8}Dž]q *UPPjPE PEPjP t DžMA8tA8u/u} uPWVh<|ųQQj j7@ }jWRP9 E @PY?PjSPU} uPWVS褞 SEM USQRhd|Dž)FPE PEPh{} uPWVh{вFPE PEPh{飲} uPWVhW{wFPE PEPh*{J} uPWVhzz uPPjPE PEPjPš t Dž}G8t G8Eu ]8WVSh<bz邱1tsPPEjPE PEPjW* t DžUB8tB8uYM] 1MVSQh$y}E RPEPhdyDžİPPj j6= ujFPS9} WX<PjSPu ]PVShly</MWWj] 1MVSQjR t DžuF8PPj jI< }jGPSu`jjSPEE RPEPP̚ {UPE PEPhd,xDžQu ]WVShx$PE PEPhw /MWWj] 1MVSQjR蜗 t DžuF8PPj j; }jGPSu`jjSPѓEE RPEPP舙 7UPE PEPhdvDž u ]WVShvPE PEPhv鴭 /MWWj] 1MVSQjRX t DžuF8PPj j9 }jGPSu`jjSP荒EE RPEPPD UPE PEPhduDžɬu ]WVSh|u霬PE PEPhPup /MWWj] 1MVSQjR t DžuF8PPj j}8 }jGPSEu`jjSPIEE RPEPP 鯫UPE PEPhd`tDž酫u ]WVSh8tXPE PEPh t, /MWWj] 1MVSQjRГ t DžuF8PPj j97 }jGPSu`jjSPEE RPEPP輕 kUPE PEPhdsDžAu ]WVShrPE PEPhr MWWj] 1MVSQjR茒 t Dž5 }W:td CR-5M UESQRP 8UPE PEPhdqDž}PE PWhquPE PEPhq鳨tYt=MA8tA8uTu}PE PWh$ qDžEUPE PEPhdpDž}VVjM USQRjP t DžPPj j\4 ËEj@PS$-M qV~3PjSP M UPQRhlBpbGPE PEPhp5ESSjU EQRPjPُ t DžUB8WWj jB3 MjqVP  jjSP PE PEPhl9oY}u} PWVhd oDž/ESSjU EQRPjPӎ t DžUB8WWj j<2 MjqVPjjSPPE PEPhl3nS}u} PWVhdnDž)EVVjM USQRjP͍ t DžUB8tB8u/MPE PEPh$qm鑤PPj j1 uj~WP} GP%0PjSP躉6PE PEPhll }}PE PWhdlDžߣuM U^SQRhl鯣PE PEPh$cl郣FUVVjM USQRjP' t DžMA8PPj j/ uj~WPXuwjjSP\آPE PEPhlk髢E}PE PWhd\kDž遢NEU QRPh4kTPE PEPh$k( IESSjU EQRPjP̊ t DžUB8WWj j5. MjqVPuwjjSP}PE PEPhl0jP}u} PWVhdjDž&uEU NQRPhiPE PEPh$iʠtrESSjU EQRPjPr t Dž5 MQ:tK CR,7}u} PWVhdhDž 9u ]WVShhUPE PEPhh鲟 t$ t AuRRjPE PEPjPG t Dž}G8Ejj jXS*U 2\ 8Q)MZËAP)D$(uË~58WVh S, Dž9/@~ۋM UVQRh`g$+iv] MVSQhg<) ЮЮC tރ~ F uӡ 4Wv*48 <Q}(}ZËGPn(D$b'ËGP<P}PE PWh(fH}PPPF P%* QRh3h^h )h^h hPjWV |/E h PEPhNfDž鷜E h PEPhNieDž鎜 } uPEPWVh<6e Dž[PPEjPE PEPjP% t DžUB81QQjP/(ƅRPVj&D^~8 }]h^G} PWShe^ Sx% SPV')9E PR@PE PEPhP(dV$_V'2M APAPE PEPhc x V#} uPWVhc鿚 Vc#Ujj jJQ%Dž94/KA~E VPEPh0cXP&]u WVSQ 飙uPE PEPPӄ邙EE RPEPP貄aFPE PEPhb4 4R%48|uEU NQRPha鿘PE PEPh$sa铘UBPE PEPhCacMAPE PEPha3 P3bƅAG PE PEPh?FPE PEPh)u ]WVSh$`Dž̗xQjpPRC#钗SShj$Å  SDžpBdZdApC@CDC@- | EC@P"UXBP"PPj:WK ƅ@jj jP!1҃f0VDPu ss WMSLPSPPST@ CXfffCN<$!#Mq ǃǃǃǃǃǃǃǃC<ǃDž>1iu1Fdu1F UD8jj jP =|r4 @dt9t ;|S苍u >Rt0u_fufftsf{{Ct%plFplCCfDž*HhAHhًEU QRPh]鶔Cufffwt#fx tLf@f%fIPE PEPh];f@f벋u ]WVSh\}PE PEPh\ѓ^OQW}D8jj jPK~W RPE PEPh[ uUM SQRh0[ĒU}PE PWhn[鎒\ o ax ki {uCC}@4B} DP[ CDP[C%} TR CDPC |o0   }D8tz PI}jj jDPEf} DP@pCC55u 9nPPuPE} PjWVhdV 鄍 RPE PEPh-V M M UVSQRh4U  E h+h$PEPhhU ݌+tRPE PEPhvU閌 uACt E h$h+PEPhU >C CW/CSlPSpPSt@ Cx E }h+PWhTً y\}D8tbt P6U TRM PN C|kUM USQRhS}jj jTRC<}jj jLQC,}jj jDPC0d}jj jDP=2}RjPDPJ: uDPPE h+PEPhR C CP@PP@ SEU QRPhLRl} uPWVh R@Rjph4P$ , jph Pc(0鲈P}jPDPItz*}jj jDPIƒD8M} uPWVh0PPP}P}PE jPWhP ŇV}jPLQ!Ht?= u P]WVSh`4P TPPUPPE jPEPhO  M USPQRhO ܆ U QPERPhO 饆EPE PEPhOOoUBPE PEPhO?u} PWVhNuFPE PEPhN} uPWVhN鷅 yމ}D8t P  } DP P ==M] 1MVSQhMфMVVh+hUM SQRhL vM 閄u ]WWhyh+h$VSh ]u u1Fdu ЋUBd8EҋxduMApǁ%ǁ=1= }W']f{yu~w!tt G Exd2UztBwu_ t4M Q=] RPh CuFu?uu~dW0G,9BW,uPPj/VÅPPjVCCEPPSuVoCƅ@E9EtMË@Q%@@9 P?.EÍx\0t&EpXu9X\tuF@t BBu쉊ǂǂt~umUBVjXSH,Q@Å;Emu ~,Wx1҉^,tx ‹E쉓xxaS E{uVjjK Q`@ƅ ;E) { WUs x1҅tx ‰x뛋E싘CHd8RRPh j@E@EuF [V PNp< %FQ:RPhh z@EE Rp:] VPhd ?MAM] %CW):VPhh ?]]! }W@uƉuMAP R9 RPh !?E@EF R9] VPh$n?MCMPF PU싂Phl>]C6]jt uG09E싘 Q9U RPh`>E@EbU싒U} 4 M t71ҍu싂Ft5 Ɖ5uхt11ҋu싂$Ft5, Ɖ5 uыE싀EuE~ }}Ee[^_]PF PE싀Ph P7ZYVSQu싖RPh$-=E@ ?E<]쉃|[u]uPPSuV=ƅME Q]7$RU싲VPh|M S,7ZYV]䋛SQu싖RPh;RjPh\MQjPh: ǁ0j,] ,jhPu싆t[|9@tb]쉃I EP VAEY QDU쉂|u싆tm MQ<MUƒUu^d Q5 RPhH;DnU쉂`PMA,PPhx:E@ERUB,PPhPC Pu싆Ph:E@E{ hl:EEe[^_]à P4] WPhD6:uFu P4 RPh:}}M Sv44$Q]싓RPhRC PM싁Ph0!&'UԮEPЮԮ]ÉUEPQP@ ]ÐUMAt - 9}]Ë - )Ћ]ÍUUJtH9ttu]ÍuދܐUSá- 0(@(Q#3 RPhd~8XP3YRPhjS:]ÍUWVS x@P@E9tg2 69tYZC@%@HuC$u߃ C$R[C$u SZAC0@6C0E@9EuEe[^_]Ít&UWVS1 tn1Qt&FtVtLX PG[S$u S@C0G@C0F,t VD9re[^_]ÍvUWVSƋ9t;F ƒރ FUF- V ] E XZPFEFdQu?Phlh^S4  F4PF$WPFxlt Hht?RPlRxhWhh^S4(h h =6]thh h =jNQ7FPluxhtyFt udže[^_]h h =j떃 R@Phh^S3 뀍t&'UWVS Ƌ9t%u9|He[^_]ËNAlu yhm - 9}Ӌ)߉F ƒAFAqt!8& ]VE XZPFEFdQu?Phh^S2 F4NPWylt Qht?PAlPAhPh h^Sn2h h =|4~h h =jW5 FtYuc0- 9})É؋,É,0d VЃN R@Phh^S1 Vv'UWVSËHu H@S E XZPECdQCu?Phdh^V$1 C4PWCxlt Hht?RPlR@hPh h^V0h h =2h h =jCP4C xluphtTCt&ue[^_]à R@Phh^VS0 8&륍t&UWVSËHu߉H@SE XZPECdQCu?Phh^V/ C4PWCxlt Hht?RPlRxhWh h^V/h h =1h h =jsV2 Ctue[^_]à R@Phh^V/ PvUWVS|}t|^@DtBF$u V9F0F0PPjW/ de[^_]ËSB u 0,EBta0- ȉA h@@EPQW;ESb8 ED1v tPEPQh OC@UM E~UEEEEEEǁ X-HaBproxBy-SeB rverB-StaBte: CEEREt )эQRDPEPCZYEC4PS)PC$PЋH|щTPSэD1PPPCQhEUPM0C@Mt\ E- 9}@9|<)ʍ}RPhEMPPU‰UUM B EDEU Ƃ  BƂ  BUƂ de1[^_]è@FCLECPECTECXEfffEPEjPW2u rtswt j%dCt ,- tUB4,- t )Ѕ$LJEe[^_]ËE,- H4t)ЅGS Gx F LJPjjjƃtl9L$D E… Шu"AUfTAQ B@Q ;A D$V EH4,- )…uUɉB4,- u;H  LJV=1~f QWȉ)΍6P$]P$ M}fEƴ fEm]mƋE)ƃ ,- WsEX4W@tJ -  9!⿉WWBqt=lWt:G@@t1 tn uuЋH9|~ LJV^<1 QW~ȉ)΍6P$](P$ M(*BmE9WUBq)ًET}U WЃU,- J4k)…_EɉH4,- u;t&;H E5,- H4)|WuuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jhjjVQ @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPV9E#ET L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV WMSPQV8tJu-G QW RPh "]PjSV@rsrj t&GLE؋GPE܋GTEGXEPG\PEPV7EE[}}8PPGPhTt&A jhj jV VDF;/ ~/ MLDDD \DDPPjV/ ,- uEH4G,- uڅtʅt )؅~ڋMQ4G PW SPh/Ӆv)ЅjuUB4у G|@PSjjV4 jOlEMJQRGPhZv'UWVSE4 EEEEXdtCvuEEuЋ}D j$4 EEXdEU‰E Ct- 2DB @B DXF @F$XEF0FDF8sHF<^@=,- t S;E S‹EЃ}~4tF t;~y V&uMEFuMEEe1[^_]Í& Sw=~'Et S];E} SLEE@EDU@ R藁VSEQh<!e[^_]ÿ UWVSQ]CE9r`s,C@tI - 9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjhLP0 %Ð&UMQPQQA ǂt)H4BJP0 P JP ]ÉBBJP0 P JP ]ÍvU1҉WVSu} F4tV@хt_tUFtOCRE”EAUU䋀9tl%tUى1t2YQK$K$V BV Xu ؍e[^_]à VЃCE렋EU@9B놉'UWVS uFVEZ9~ }7PPEPVt$XC$u S#C0@C09~ |ɍe[^_]ÐUSRP0 ] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 R}JUWVS}]EW(VjPjCDP @tC$ C$e[^_]QWVSDRC$ C$e[^_]UWVS\ET 9@- 9JhDžPQSEPD@1 2 J AJ 1 F$FF(0F51 1 F Ffh# -  B @B  XA XC C$C0CDC8RhhRPL9 lShjQ@ jhjjR @uG@bV^r@B ubEukƄEgUuˆƈUCShEPEPTuUu”ƔU t1=uuZUu€ƀUVhMQURREuƌEE{EPhD.t&'UWVST]EE uuE suS}:EjjPRƋEUtREt=UM9t) hshThEPEPLE 7Ee[^_]ÐPM$RPhshTh벃 hshTh ]MSQ몃 PhTh|WsVPhshTh\&UWVS E}4  t&t;!9uPPEPP uϋC;E uLEu]뻋Ee[^_]ËEP4$$PEPhe1[^_]P$] S$MQhXE ZP}$h(빍vUWVS 1u 4 t0!9uPPEPP6uхuɍve[^_]Íe1[^_]ÍU1WVS 1}t-_dt$t&PPE PPҾtue[^_]Í&uދSQU RhHe1[^_]ÍUSP]uNuthCp01]Í&QRPhtt&QRPhkQtRPh RhIQDRPhx"Cp'v% CpQRPh0t&ϋQRPh$1] UWVSDžt54 F uDžputz{uPxjdPSNjEutt ttpۉpupuF PhjVtte[^_]ËQ}x$RPht t[ppeP%x$QPh릐t&US @& 4 jj v{ tj(PPP$h(ZYPPP$hjS( ,- tu]ø䐍t&UVSuFt&PPjP舻u"PPtuP Q膻tF ue[^]ÍvRRjP8uPPjP/ ~ tF 뺍&'UVSu t&t+ S{~ S;T0 HT0 F e[^]Í'UWVS @- }54 9O~ tl9rЃ~ u SGuF 뾐 S#uF t~ u͋ @& 54 E&RRPh]PhjVVk\tB~ t ,- t)ȅ~9tӅt˅t)Ѕ~Ӎt&봍e[^_]Ë SuF PjSP^,- tڅtʅt )؅~ډ܍'UVS14 RRjj C PPP$hXPP$hjS S{ tKQRP$hXPP$hjS %ue[^]à hJ hjjye[^];t&'UVS4 PPjjJ t&{ uPPV$hYRP$hjS3 C tPPtuPPu;@- 9~9sPPjP/ C 렍e[^]f~ thfFfƋPQ$VhXZPQ$VhjSSfFf떉'Uht耻ÐUMyt]É$A$(ǁǁ @(] UWVS DžtUB@@9Љd`!t ‹;dt`R1{uҋsplh{A  RVhw hP4 =  PVh hP = P  PPPPVPjlPzPfDžx{ ƅjjjDžc9RhjPϵ@0PxjnPW蕵pƒl ШhWPPjWijPPVP P;C DG;/ ~/ DDD D\DD1te[^_]PPVh ` h `8PPVh C8uPPPV8 PPVh@!u놋hQQRP2@PPVh!G P艱<$$s-QQVh! PlPpPPQ@ 덃 h"WWVhH"PPVh"jPPVh"YXVP F88 Vǰ'PPVh #aUWVSEP@x@9`9`C~ۃ P CCjtjj膴ƅxPtjlPzPfDžx޳ xjnEPV踳x7 Vx\PPjP/ Cdt&e1[^_]8ou tQ衯뫐&UWVSU=D`%LXbDždhPdPREP螯\@0`9@- 91  z Gz 1 - CC$:C1 1 C CC(r Fr } XAG XG$G0GDG8PRhhRP裰\9 =VhjQp@:`\GD_@SG<KD{CCǃ|C4C0C<C8ChCl{@CP nCT`uCXzC\{CHCLCtCpǃǃ{xǃ nǃ`uǃzǃ{ǃC|ǃǃǃǃǃRjDjPn hjPX - - - D- fǃfǃq Fq S0BX`B4B,B0BB B$BB(^C8PBLT - spBDBHBTrPS`B4BBB 6A @A S43BXrLB B$BTBP`s0B,B0FFF8BB4B(^B BBBBB8BDBHBTSdG4t F B\4D@;/ ~/ TDL`DA(C0DA,DPC4LD PPj\P/ G$u WeG0`G0@;}>X5@- D- IFCX5@- D- Xe1[^_]PPj:W/ `A룃 RM RM QM& QMK0t- P JP t- p N8p XI XCBC1 P JP \P蟨e1[^_]à hD#붃 hD#à hXl h鍴&'U1WVS\M 50 A1DF u1MtM1DF A150A1DF uGLƒ%붐LG~u 18u`] ubU:EUǀ|B4@<QQPRre[^_]AS5=`18uE8EǀUB4ǂǂ|@<QQPROE8E8Ejj jR蜨UjEj jP聨UEjj jPfUEEǀ|@48@<8VVPR>jj jPUUWVS ]u |tt e1[^_]ËS0PBzXPj W)tPPWSt.uVuRuNV8 ,- t)ʅ~; u7 @PPh C0@LP*ǃ|1F4e[^_]ËC48@8օVS0ǃ|fǃ@0t&C0p4߉p4ǃ|1e[^_]UWVS EU@@B0EUZ0J4$E9MAHJEH4EX0CL83E uE1EEpt6CL8v̀C4%1ƉptEC4u'CuCC,C4u u CL8ЉU% = (%`=@%` = `@E1ЩptECL8EUJ4vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@%` = `@1ptEUZ0CL8E9EQP U%%B8B 1 jj@h=]1 QQSh8[&UWVSE]E} SɜPSE_؃XPMQt+W‰WUB UEE ue[^_]e[^_]ÍUWVS }U] uWMQCЃXPRt(SF SEuE }e[^_]e[^_]Í'U1ɉWVS }]u 9s;:te[^_]Í&PEWPEP襝1Ʌu׍S9s'1C)tvB9s1)u9rG})9~ы])뒍vU1ɉVS1E] 9s t 1@9r[^]Åt\t""t%,t@"u@˹@1@뾍t&UWVS M}UAtjEU9fY%q 489C9s 1'uMEA)9AVS4U)޸r e[^_]ËщUf1ҊQ%DfAf%EttUMfU %ҍ48u"9s?:E @E U 9s8:u});E ~ M <:t1MU1D|0fDf%Eue1[^_]PQEPW跛uU X9@%'C91'ut&'USE]PEPE PPSWZYPSJ]Ðt&UWVS ËJ,֋}AXA A$AA(PPA,A0AtN(̀E…%u(C$puM ȉC$uU ЉC$e[^_]ÐEtPGP7VQy뼍t&US]M C44u!C44u 0 t&[]Ít&'UWVSSSUE1ҊA<w.%@*C~);Eu{9uu ZY[^_]ÃCغ U1҉VSH@pXD9s.<*t(%50DFu 9s 9/tA9r19tʉ[^]Ít&A9s,1Ft3A9s1Fu+t-t.t9tA<:t1҉[^]À+tȀ-tÀ.u9tA:tF;ur~;}s!1F'tG;}s 1'u]uU)ЋS9uPRCPEPݎuҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWR4CUM]vE U1DUDUEfDf%Ee[^_]à hX9룃 RG.C'UWVS]u} UCM$\0B91(tЋ^0))؉F4N)ȉF [^_]Ðt&B91'tꀸ)Ћ^()B)ػ F,9s|1'u\)F0낐B91#uꀸ)Ћ^ )B)ػ F$9s,1'ur)F(g)tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F0)tB9o 딻덐&UWVSE]UM}$p0B91#uꀸ(u )K0)ȉC4{)C [^_]B91'tꀸ)u )s()BC,9ʸ1'ugu )C0jB91$uꀸ)u )s )BC$9ʸs31'u[u )C(U)tjB9zu tM t1[^_]øٸҸˀ)tLB9r붍vK(u ))ȉC,} )C4C0(tu )K )ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$0:&؋M)CXG9sɊ1Ѐ)(C9r몊1Ѐ$tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB C9_1Ѐ(H uC9 ECUX$G)ЃXGG9s WBW9r1Ѐ(uC9r}_ uC9e uKC9P1Ѐ)uWMA PQ: %PO)R  MY$ EXEEW$PEVSRPWdÅ8 EfG f% Љ_ C9q؋M)ȃXG1Ѐ( uC9[ =C9B1Ѐ)OEDX9VUDX G@GDX97UDX G@GDX9r( C9; C191Ѐ$tUXU9_G (V !C 9R; 6C9;1Ѐ$tUXU9t MjjSq$VQ ËEpU)ЋUX_G fzt tM fA fAfAG@ @؋U)ЃXG@WEЍPXW;M EY$jjSPQaEUGà rG C9,C9y1UWVS u}UE UV EG])ЃXC=^v^F XQPR߃F@xW~ )4- C 0- SUCCECESEE Ue[^_]~V G$)ЃX럍t&'UWVSLE}EE dE1UMUIDM1ɋ]9EUM@0EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿;C9]s]]UZt@MEȋUM\XDN9r&Ẻ ޿;C9]s捶UEЋMU\XDT9r Eȉ޿;JC9]sEME]E@E܅]MC$CEf1CT\XUfBfƁMfǁ~PjSh;輂!U1D\fDf%ƅuMYU;r}&U܋U܅M܋QB9uEypу9u΋U]K4fǃ@fǃ- 1- C@1@DA<`PPQSwe[^_]ËEEt&ME VY 4SQh ]EǃXEZUPB0xLW[MA0@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8,- t)Ѕ~ e1[^_]á- )Ћ - MbLJE))ʋM>ʉtWWjS\ZYPFLPCF4F8dhC$puPC$R C$e1[^_]ÍvUWVSL}GW< DBUԋU 1ۋB]ċ,E؉MEPPwVjh;0]܃ }M؋ERjh<P~] uE[]9GE01ЈU(uqv ҉UR,M̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ(tMԋ]M9sNwE=Ɖu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjh'<QJ{>E0'PEjh<P{uUωPEj h.<Pztˍ&PEj h8<PzًUQjhC<Rz3듋u)MSjhL<QzxUB<"<, Ш^Ev'UVS]u fft>fHtUǃtPPjSZYPFPPC$ptu C$%e[^]ÀPC$ٍvPCdPVSζxe[^]UWVSEEM EP$ыUf@%ETTXUM EMPfDf%E܅<] f%41GD0EEUjh0 j SBP= u?MAw4$0M]ECTXtUM܋EM%1e[^_]Ë]C9CuыEًP I0S[4AC AM|A BtBǁd6EEUB[]EK ujjVS] SsM] MMQ0‰Q0IfWf% ЉfEfH Eh0 @ PSh M $h VSQUƒ fUUz0ljz0]Kƒ ШUWVS ]}u_O1tLs$E EX EƋK8ΊEUjh0 j RGP; tUEe[^_]Ít&Gw$1UB9BuҋMW Y4QI0C AAM|A Bt ǁdE뉋MATXҋUBيEh0 G PEPh }M $h VWQOS0{$ƒ S0U DXMSjjPE QXjPCP'ƃS f‹% ЉOƒ Шu 1it&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWx|uPE SPW&UWVS EUu EB@@t_J,r1  "Z CZ EɉH,UBRLPVQrMAQ,L1 pz Gz UBRLPVSjrMAL^_SAPP赏ơ1 P JP E1ɋ,- xzNG@uF @F ^tZ_dtSQQVRPnu4CG@UB%U$? ue[^_]Ðw1 z O z | hx9蛮 hx9jEHQEe[^_]à hx9p hx9jUJӃ RM$?Cu" UMA$A$9 ܸ RG'UWVS uE EE^E싻Dtnƒ%uSPEPj;EPDnt:HL‰E]E؃)9PEYPWSXqte[^_]ËE\] e[^_] UWVSlEEUM EX$f@%TLXMȋMQfBf%Eątcuċ}ȉ}ЍUf%E1BŨjhe<RDWEu(uu}ċVfDf%Eąue[^_]ËUЋMEEEEE90}؋}EG}9Es&};€, Шu1DC uύt&U9U]sA<=t;=0,€; Ш>1DG /C;]s =u;]KủM9MM9s:C<;t3<,t/ 0%}DA WuUẺU9s <;t<,u׋U:$TMAXu}M)ϋ\}9|l9u׉u^1 } B @B EɉmUB`;E}NjuPWVQRmM8u؋Mv)ȉu;  E@EԋE܅t[ }܋u EjjPWVܦMU‰MMŰUq0}ljq0uf}ȋvEE u}DtًU)ыu9ɉt&}Ẻ}9E܅tAEԅ ] }̋ujjWVS5UfEȋU؃ EȋB0؉B0MĉMủ]9~99u׉}UEdE}B tMM9su>~t F}u9rE9EUt|U)‰U EEtfMQtA ;Eu9u׉uԋ}GE@@UB%y}$? EEu}x $?@EuH9u%E܅8,u}؉u܉}t&PPEPEP) MȋUЋE jjQRP聤u}ËNufWf% Љ}EfO f EuM @jjPVQ/U‹}̉UUNjuȋJ0}̋}J0MfƋEԋI@ uEEEԉMG h93 Ru ]Mu$?Ft1 UMuy$y$|_t& ͍UWVSEEM UZhf@%كETTXUMEMPfDf%E܅ f‹% кEHƒ 1ҨUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVSLEEU EщEphUu}苆f@%TLXWMfBf%Etjt&EŰUԋM̉Uf%41AD0Ej ha<VR…u=}MuWufDf%EuuF,<e[^_]Ít&E}@EuDMʉU9sUӊ<;u<=t<;t C9s<=u9Z;;QKM9CMs<1SЋ 0DA u(&;t}G}9us}1DA tߋUBXM英u܋M)΋\u9|w9u׉ui1 uȋ B @B Eʅɉ}G`;E}PV}WRbU苂0MIM؋Mu); uD*ًU)ыu9ɉEH,1  B @B UɉJ,BWLV]SQ8bMAQ,LMAXRRPFPP_Å}1ҋ ,- Gt ‹C S@C e[^_]Ë9u׉EMt uFu}G$E@ jjEPEP}WUű}ЉËJfVf % ЉfEufH HtـuԉHto1 2B @B 1  z Gz }GRLPG,PQ~`GL P_1  x B @B Nt~MRWWNQ`F XZVuFPP%} 1  B HB i R\& h9 h9jEHQ荞UBuTe[^_]BMA#A B @PBPEPEPEP}ԋuNjU}ԋ}fMwtƋwt@ ~ s Rgv RT h: h:j}GP藝V RJ h9貛 h9jE@à h9蓛ML R& J QBPEPEPEPủË}fE؉EԋGt؉GtvUWVSM }]Q0BPf@ %PBLf@ %PEPAVQhl<h a_]Ɖ)) 9~@RP WP'ƃƆ  FuE  Ee[^_]AZ'UWVS,EU}@0R4EUMA4D_\A]9A$sGVPSQV]ЋW]Ћs@x!E UHQSRP@x$P M]ЋA4A4ȋs XCE߉PPs,VS(ЃXPX===MlEH$pH$2MQAZ@ ة!A$_GhM1fCETfCf%LXME܅E܍]ԋ]Uf%؉E1BMj h<QDSE觾t?UR$ŨPjh<Sb\E̋]E̋ẺC$U܋_UfDf%E܅]1ۅ~9t&~)PGPEPEPxAC9ˋMA9ƋrRPEPEPXUt,0<@M]A4@@LJ]VVjSZYPExPW~UR$Upu MPỦQ$Euű]űẺC$e1[^_]=,q=-?]UB@J06 EjjPS]S9OtU]‰OtUOfS]f % ЉfO Ef Ejh<PS]SݒUԋM fWtM‹MWtI$M=UtDH\`d]SuDuXu B}SBt ]t"C$u[Ct?88][$]̃uVEP@Z@ ة!t>~BEЃx$Y@ M|_0HẼE̋EỦP$XGfxt WtMЋ]f@ f@f@UA K,‹C$)ЍPC)9r*C,EЋULJB4B4])s0։s0PPEPEPEP]SBtDH\`Q<tQPhD:ēUX<tMRAVhD:jPP ]PPEPSBu:PQh<h WUÃB! ES_h SPEP蹸 [MA@t {tG\UЋEZ ؃XEƋJ VuPVh<\O1]fATfAfӉ]Á-fM%U4VQRh<O1DD0EfDfÁ뱋E@4AP]ЋGxPGPEs XP.^UMЋY@x#] CPQRSCx$P U M@]U@t,0M]AC4LJ<@PPjQ薺^_PsPVzxE@$Epu @UẺB$E]̋M]̋]̉Y$sUЋJ@x&M uAPRVQAx$P ] U@M@]t,0UMBA4LJ<@QQjR詹_]ZPsPVwE@$Ep0EЋ@@x$U BPEPEPRBx$Pb M]U@@t,0M]AC4LJ<@VVjQ_ZPsPVvE@$Ep`PO EЋX@x!U uJQPVRBx$P M@]t,0UMBA4LJ<@QQjR;_ZP]UЋJ@x&M APERPQAx$P] UM@AB4<@Y$]pu ]̉Y$E5E E̋EỦP$My,RP hPsR ωEjh<S]PSt T Gjh<PEPEPC ][$]MA(^y]U- )ȋ - )Mb)ʍڋUщRAJ@!ȩt"]PjCL@ PCP@ PEPUOt ǂR]ǃǃ{]33v'UWVSM EU`AU9A$sESPRQ}UEP@x!U u zWPVRB|Ph M ȋY4A8Y4]S ЋS$XCz`EXlM]K4]IE`X\{8s8] t&u:?9 `MjPQSW uЅ%tƋ}`- - džQQjW>_ZPE pLVr}w$pu Pw$u Ep$1e[^_]Ë}G$G$Mq$urY;]tj@;v - 96rFr;vEp$p$` MYQCJ ȩ! `1u {$[fCDžlTfCf%tXtpphthf%<1Bj h<WSD8tt6Mq$Pjh<SLNEp$`plYfDf%pM]1~9`^t&EGP\PE SP胭U9ՋMdt`u^@@9B}uD9/ `jPEPEPCP‹C xuŅ1҈…tEE C=-=// 5<VI<GG=^ uQPRV.J{ rWK =ZEPQCPRICwƉwUK G W`u W- C]- PPWFLP}w$*EËxHH9uuD?9| `jPEPEPGP‹G xuŅ1҈…t_ UZ@;v - 9zGz;vEP0p4F BBU|B ࿉Ct @Ct Mǁd]s$s$Ex,eU@z;v - 90rFr;vUыr4R0F BB|A ࿉Gt @Gt udžd}w$w$;]guj@;v - 9lJAJ;vUB$B$sP}_6CP9F `}jPWSNQ‹F xuM1ҋY륋EX}RPE PWZ}t E@@x$U BPEPE PRB|P `] uAǁC4WWjVƬZYP{LWJkuFdhr}w$UZ\ tjjVS] S`th‹K0tK0[lfWf % ЉffN USSQRcu F4 jh<WS] S`h}tV0ƒ fV0w$tju @P,D@GEP$P$C t E@$DuDu}WXt`uVCr t}ffQf  C B}w$uEGW@z !t0Ex4UE Z J0Ȁx_0]s$u} 7U B(^z]2]`- - S0BXJ(B B$B B,B0Bt} U ,- G4G4B1ҋ|t ‹M ҉Q8u,- e] C8^$;, } 7EUxJ(QR,Rj?P@uM FQ<  )r}4uE O ȋW0Ѐx_1M 9, ] 3{ 8PvA8EG SeDt-CoDokiefD : GUGVK QS$RPAC wUGf OUO` d`p@H΋PD֋d)Ct19}d<?@9|OS=Z"CMRPQ*ACOOGUЋdQVRPAGGU|/C=Y /G@GM 1S]E K QS ЃXPEPu^}PPE PWMQY}f,$x WdWtM,!;]Kt,!;u$,PS Ph ?X1ZFP1FP1FP1P h<PfAË`Sh P`PE Pj IU`M- ǂ- SSjQZ] YPCLPMRUPB,PE z(XP)oMYC t!; tM!;z}ǬPVPh >X1ZGP1GP1GP1P h<P@Ƌ`Vh P`PE P Y]S[C8/t*]uE }UN ȋ_ pXSVRh<E1fCTfCf։ǁ`Qf%0ESVPh=n`V1DtfDfǁu^U;J,r(E hpX9M߉]pA$p A$9l `jPEPSV ~u %6&1  Z CZ `ɉPu^ ~}E W VSXPQK<`M QS E ЋuXC~,ËF Å) } j hSSWu} wƍDwjjPE _XSjPW薰Å`; YG f% ЉG U 2G@xM APWRQA|P }u ]GF4dhw$p Džd =uC`P}N4QSW E ЃXP5yE 0ϋr)ljH#BBEuj.VPj ;}WWPËQh :  Vh=P;Ë`$h P`PE P̜ eMQYSVQ%(M ,- Q8t )Å  UB@x!M APE RPQA|P$ `}ǃPPjW[^u PNLQu^U}BF4dhr$pu r$Mq$pU 2 M jh =SSQrVƒ VUBRSPYuF@x!} GPE VPWG|P# `]ǀVVjSZU YPBLPt]uM] FC4dhv$p$WS Q]YrT)ƉHBB] @҉37u1ɋ,- Ft u} O8 ϋr)ljHBBQ h9Tt Rt EEP`PWjh=!] } t4MYlϋr)ljHBBrMERj h=P7EX `E}uWS@EPEjh;xE tg}~aMERjh<PF7uDU B42B4-UZTB&M 1 r MEWSAPjh#=E uUM]UB19ڋ,|9s EU19|9M Y41Y4PE}PEPEPh]M}O8_#FF 1ɋ,- tt)NGGWWиSrvUPPUB(:u# u%tt/PPjB P/ ËBBPPjJ Q/ BBPPjB P/ ƍUWVS u^,> FF DC,ډ\K,ST % = 0%=8C tUC,u{Tt%"=F(Pt+F@u%P =,- Et UUP)^K$u S`S0S0e[^_]Í&CTtPPjF P/ FFCuC1ɋ,- tt K #aC1,- tt lj{> Vx2FF F  DF d~ W/ ^^C0u{,u [T>UPPD  - A @A t.XB @B$XB0BDB8@ tF,- B@tHB4BRjVhA=v1 H @H  (PjjhJ=&UWVS4 E#,- UuDtfEPuEPuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]át:tt2Cug=PPhp=h  Ph jCS PSUSRu,- PE4,- U_UE PEP%Ív'US] t1 P JP Kt1 H IH 1 P JP []ÍvUSP4 v PPQ3u@ C t S&9DtlC$t- CPTSDHTHH @ t- X KX X@ I X]D눐UWVSUHtUz|UBhJd@E ǁ uE9}}eUU䍴&1Ett A#;EtK uEU䋎)4@E9}UBd뮋E[^_]Ít&t01҉Å;E Шt΋ ]낉낍&UPd@l@h@x@tǀtDBt2 u.t*t.Alu Au@AlAxu]ËAh@AhAtt&U‹Hht@tB|]ÍtǂB|]ÐBxB|Bl] UVS]Ss;StMu3uSS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉCS빉UWVS}GdLJLJ  LJEÐu]䉷EEt11ҋCCtnEȉEuЋE9E}EuSSjMQLJF}e[^_] e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwlNGxwl9tBtt ut቗l kuffSSe[^_]Ë;䍇GGtGhHGh Pǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPS躳e[^_])QQPW~jUWVS u^ddždž dž dž$&CCu߉(FtFx^ddždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPWt&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFxFl@FFluP؅tt>9ut6.&;aiFtFh@FhO(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]É uè%E봋EE…%EE…%MMUMB()؉B(AtAx;B= Pv UZ(B$؋Z )1dELGGe[^_]É9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ PX VAE싗Y[X)ЉVSvUVSuue[^]Í& SѫXZV )1SPe[^]Í'UVS]SKs9tKu4t uu=fSSe[^] uu;u܃tBVx)‹FlHVxFl9u8tBtt utቖVt)‹FhHVtFh P軪ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFxЉFxFl@FFluT؅ttB9ut:2;v~FtЉFtFh@FhS )1PPPQCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xxωxxS )1QQURP让ESCCe[^_]Ë9]e[^_]a]e[^_]aE)ptΉptY Pѧsv'UVSu^ddždž  dž0dždždž$&CCu߉A^ddždždždžt\CtG uCt?tHS )1PPPPue[^]Í붍&U1WVSEUu R|PEPj?VÃ1MC؉])u)ƋEu(E3vWuVj&SÅCM؋U)ȉ])‹EU9EU<=uM9$މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1q|e[^_]Íe1[^_]Q_ v'UWVSLEEp0@ẺUЋ(@|M1ɅHSCz< tz>FU1ɃX)UEM EEPEЃPCPjh;d]܃ }M؋ERjh<PbF(EX;EEPX1Ѐ(ua S|*tl,PЃ vPɋE]CE]E ЉEF(X;E+M1Ѐ(t1Ѐ(tU1B(u 1ɍe[^_]ËMMMMċF);EsEċ],}PEPj&W ÅtCu؋M)])MċE9EvUMȀ< =uE9$uMȋE)ȍ HEčZt9B01҈€$t`UCЋUЋU)MĉEt<&űM̋E1q| Q.XEM1ɀ'ut&UWVS,1]sEԋV|<E1tL EEPPEԋPREP8P;bE܃ tEu 1e[^_]ÉËME@u=AЉ)Ku1v|e[^_]V5YhLE"U̅tЉ)IKt<.uڋE̅uEv'UWVS<E@$Ut SSjP^MYCp%EǀC UtM1A$A$}t_UM9*UMBQ4ut3At-EX,t PU9B$s MQe[^_]ËK||=Uǂ7=Q=KS 2$=Nw=uǃ MQ^WMyE1W|Uǂx;G|| LJ1EEڋC4F,j;u{u]9_|%!9uË]t MEU>‹E;@dhEǀMfff EǀSSQR\=LE EE=0t)9~%!?EЋUЋU)ЉENfG/űE@EԋE94fuS|Ƭ1tSEǀe11~#v1Ѓ9v1s|ыMbEKhEɋt@uƅC,tAK4t)F @u@1ҩt t@u‰뻃 S9C s96]빋MMKhuSlEEEF$u F(F$F بt@utEF 9w:ЅtuDžuwEiFVFF(EVF$F 말t&Ft&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC P蓛F @F G,t)G4tE}艇 WQ9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EMMUMPEU WPJQMEHxU1W|tWXx;G|| LJ1EE*;uuȉ]9_|%!9ڋC4F,tà V9F$s밉؅ExE1񋃐UpLSlA@SYW Rj&P EPUSzXK| V9F$|]ȅt M̉EW,X ]tQ9}t5U^)ȉPPPSME苀Eu9}tEU苒Uusv'USP]K$uSfBptzBLBPBTBXBtBC@uf(fff*fff1K$]ËB t1BB B$B(1K$ƍvRt0yc(,04뵁 zmfff*ffE SXK$댃 SGK$UVSuuiF$tj1tW9tOF%t KC,C4S<~ 9S4} Ve[^]à VÅtH;x%=taF$<@F$FLPt~btcpRRSVS1`?ɀxPPPڃ Sn9C r䋞48FDH\t&UWVSLE@$u PpUB0XPPjjjƃC %9 PhjV\@ jhjjV @}WB0B@EC%EE==E EC\E؋C`E܋CdEChEEĉEEEċ=L8$\8 … ШuAQ Bf\A@Q ;AAU]ȅD:$LMIMȋMA E1Ut,QfDQ%EB;AEHA EUMD: T9 D9$ffEڋEPEPEPVGBEPj]èSV@} G0@PD D O4LnO0DvDL \DF;/ ~/ WWjV/ EUH0AP=Z$@Z$P$BP$;P(X}W QЃO0WMQAZ@!ةPPVA0@L@ P趱}WB%11==9vWPSV@Åm V!KRSS}GQh>*GRh>jP+ `e[^_]ÐEPYP1ҋ ,- t j‰S1ҍe[^_]ÉP(=9}Ǩ#vPPh4?(P~*4$Zpe[^_]Í& jhj jV t& jhj jV WsTrKjB bn=L8$\8 … ШuAQ Bf\A@Q ;[A D$Vp@ @PPjjVE P=2EE̋MẺME= PEPh>=(W)=L8$\8 … ШuAf\AY C@Y ;A D$VXEZPUWBVhd?jP?)`zSlEUH&AA}ԍC\WP]SV=EЋMЅD=L8$\8 … ШuAQ Bf\A@Q ;0A D$V}PUPBWhT&M^SARh?jP,( dC| @PSjjV} - h?&4$P=L8$\8 … ШuAf\AY C@Y ;A D$V0PPh)>=(W&&it m =/ WUBVhAEF>ApA`P}PGVh%[QGRh@mPPUBWh`@$MAVh@A 5/ VMASh / Q}GRh&UWVS ]9S$%HugKAtaS$ S`uC0@Px0u@0@4C48e[^_]ËKC0@PP0J$(481҅tC0@Pp0$@0@p4tU\L - `L9JAJP;XvXt$(C48 V4u FF,t V9F$ PCs01ɋ,- ~Ptt[FPO@0p4z})ljHt"BLB랋EBݍUMA|t0- 9},]Ë0- )Ћ,]Ðt&UWVS EUtT> uUBp% Bp1e[^_]_> t*$u.UBp% Bp뿍t&UBp% Bp1Eu0UBp% BpEp>iXUD8jj jPUjj jDPU0E: 1lu1Beu1Bnu1Bti>aUD8(jj jPoUjj jtVQU@4g1Cr1Ci1Co> UB8U Bp% Bp$RXE@PU $E@PU (UB8y> UB 8+U,ǂ,0>.sPPj)VÅ9 ШU Bp8% BpWU)<ZYPVUǂ@8UB8>Eǀ@Eǀ,EDPh@EPE PkE|Wh$A܃ PU,ESh`AQhAPhAPhBPh|BPhBUWVS }u]G Vt@4 (tPPF PPatuԍe1[^_]ÉtChu te[^_]ËCl썶UWVS u}]F Gt@4 (tPPG PPtuԍe1[^_]ÉtSdt Buue[^_]ÍB,tJ8dd1gu1Biu1Bdu 1Bt&dddp LQ@pd:tjd1uu1Biu1Bdu1B jj jpDPvpd:uv h$ @e1[^_]6 jj jp@P…)=)У뎍vjj jpDPjjjp|Wp tV@PtjPpAP u\ttoVhEUREP$e[^_]QhLERhE؋pLQhEVhFPhLF볋p\ShFPhFPhG둍&'U E hXGPEPÍUWVSEEME U@4Ew $(i1ۍe[^_]ËEMfǁe[^_]ÅZ t|u WE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9l]fǃ uuhVV} …RupCRUE Sh8Hh^R-M1QMQ ]ufdž }E FLhh+ M xRtPEhh + ] pPlPEhhb* u PP1҉Ehh) RP1҉Ehh ) RPa1҉Ehha( RPBEh`hh' PA1҉Ehh ' RPÉhh`& WPUvZ1YRP}WuVMQUR}W}uVMQSPhKh^Wf0hh' E hRdPhh ' U `P\P^hh`& M XPTP9} vCW t {CJtCQVSPEhLh^P uPPV1ۋ}W &}E UxdfǂD]3u t+9|t#U]ljW }uE܅u}܋EEPF. ËH9%E] ]t EEEE?Q}t&E tU } S PsPjE QRlPP1U zdvPM - ˋ0)P(PAlPAhPI|ʋ׉ƍTP P} PSLQHRDV@S<Q8V4S`Q\VXQTSxQtWpVlSQM苀PPPPPPWhMh^Q İ]VVS]ST1ۃZu}fLJShhc, hPdPEhh+ `P\VEh`hh + _,SEhhb* G(RPwEhh) G$RPX1҉Ehh ) XRP9ELhha( QPq^Z1RPEh`hh' _h^ufdž^;SSh?u?REOQh dh^Pn PP;u?R;u?RGPEhh^VY^uVU RÉ1 TC PShDh^VcC f@% 7PCH8Qj- )P?ZYPC@0P|Phlgh^VS0J?QhB,- )P S0v@DPhDh^Vt&PPhB4 ,- )PPh,- )R Kt&Ph,- )Rm t&QQhB8,- )PHQQhB,- )P(kQhB,- )P  S4QQhB8,- )PQQhB,- )PEj4PPj讵ffDtRUCPCPQRhDh^V5 E fLJE LJ|hEj4PPj ffbPPVU BPP‹1 EfLJC US Sf9A}&UWVSU (]|te[^_]Í}EhE <U|tt2}x9lttG9luoEUt;AShgh^h]QGXZhSE P UEǀǀCvTUǂ} Eǀ|e[^_]Íx$t]뺋}t;pt&hUYPxlpl^{ 9t+RVhDh^hPt ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡ0DP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM Q}xމt;XN\L\El9Zh\hhSZXËDxsh^XDȋhr^ZDret]ߋ4nPPWE @PPB 4 ǃǃǃ}E|WWP|P\t[^JMb)RMQUREPElPEPEPhgh^hPt0fz]j.St$Pj Mt G PGPGt|REtRtBlWBVJQSMlRPhhh^hP4@PPhWu V ]ǃtGh G@GpÉxHut G PGPGt|REtRtBlWBVJQSMlRPhhЍ] j.SPjzM%fǁǁ|vUh ÐUWVS<1] utKt:EEEEtUfBfEڐt& jhjjV t5EQjPV謫x 1҅ttR1ҍe[^_]ÍERjPVwɃ jhjjVY 2 E܍UȉEfEj EREh ,fEjEVE @t Ej Ph ,jV @H@UBE jhjjV販 Yt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %PGÃ9PhjS/@f jhjjS @H jhjjSӨ @F jhjjS諨 Fr-P@ PF PS{@WWuPSȧ@F DC;/ ~/ DDD DtDDUE…%u Ee[^_]PEPEPE PEEE(j SإEEHjEExj놃 Wڧ@$WjjSK @EEjE jhjjS @p jhjjS @REEjE=& jhj jS EiEEEiEMEiM&UWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]ÉAǁ`ǁ@] UMyt]ÉDADHǁǁ@@H] UWVS } u FPXW8 ,- t )ʅE‹X\t&uMVB\9tGCt: EPjVRCPUD ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF4@@G4@@FdhF$pt@u F$1e[^_]Ë_8ۉuF@Xt,- tG81рPF$븸G8t&UWVSEEX;ili%ME9MUZE8t#iE8E1ۋP %itֿ8PQE0PEP@Å9@tPPPhSC*tH i@pujRQhjEP}W6E VVjj衤MUP XQ`PA`ʃ\Ee[^_]ÐE9E*MEP:tESjPR<E4  QU RPMAPPh kEPEPtE ;M%u#e[^_]1Bfp1BfUPh j})ω}uVEP뵍4  QLhURPMyW1VhEPEPe[^_]ËMYXuUEBX14  QU RPMAPPh`k뙡4  SZUYWPM1Vhk]SMQ.4  QnU RPM9WqVhk븋M V=UZSMQPBPPhk냃 SUSh loU WM^Y SURPAPAPPhLlEPEPh SE8Wh lM WU[^J QMRPhl&UE Ut@0u1]Ë@B |]Ðt&UWVSE tx0u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9EE~x11ҊCS1҉E1CS}B=G_(؋O )ȃX9}9|EU@ |o]C X~1CE Uh`P$D$е$L4ÐUVSu] 9t"u'tC @C Cu/e[^]ÉBJ IJ udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@HS4FUF0@Tr^4CTPN0t- H IH t- P JP N,t1 x Ox ]tEHtU싂H IH Exx5Ex4tGU싚t C tCP JP utU싂X K8X Et1 H IH Ut1 P JP Et1 x Ox V~9׋u<ًBABR1 tA BQ J9׋uŋF]BF1 0p Nۉp t Uz e[^_]ËU싚t C tCP JP uU싂H I8H {࿉F$FK$S4I҉K$C,t S_9C$ P脽 P^4 P} P޻CFSSjV`@ - Q<EZPy<X1 Pm<X1 Pa<X=1 WT<U^SD<UEe[^_])<'U 1 1 1 1 jhhE:1 %ÐUVSuF0tTPH@D+ t,FVlp9t lpuqF4tfPH@D+ t>FVtx9t txttx[^]lp끍&'UWVS ] uC,K(C@A  up t^- )Ћ - MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QS01uC4CC01^'UWVS u} t F$@F HF uQFDHG_0uG0,- Ge1[^_]ÅFt48듃࿉F$C$HC$F HF pO0 t$(F48tS4 WWG,G( tQQWVЃ &e1[^_]Ít&F@&F%S4ut0Ct*C,t SR9C$s P{F$F$vG0_4C C,t S9C$ QGNUWVS } uG,_(EF@unC(^{]Ft  tZFV@r!tEQjW RUBL@ PiY*C4C(XC4{Wv,dž$ E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$- )Ћ - Mb<))ʍe[^_]Ðt&C,@u kU CSS$SC0 C0 3] ue[^_]Cj- )Ћ - MbC<))ʍF48 SS$SC,{0uC0 B Va\- L`L]9\A@AP;XXF@CCF$=p{{] ue[^_]LC,@u u F@- )ȋ -  )ѺMbC<)ʍSS$SC0$(S{0C0@{4tX\ - L`LM9JAJP;XvXt$(F48tAW4ut0Gt*G,t W9G$s W SS$SC,- )Ћ - Mb<))ʍbuY)ƉHtHAEALJMM)Ht!BMBLY뺋EBލt&UMQ$u!ApuAdhQ$]ÃtwQ$Q$ރt Q$΁Q$ÐUWVSEp@@0' ^0N4$E FHM m VpecN4 ^0CL8 CP8 ;E uU1UEptACL8v̀C4  %1ljptE X C4u u CL8 uC0t  jЉU% = H E%=%`=@D %` = `@ SP:u"t%=%VpBwc^pJFpQQPVVpu.tϋ@tF%tPPFpPVVpt^0E1ЩptECL8CP8E N4t&EY uE1؉EEptAALڃ8v΀y4 R%1ÉptE A4u. u&AL8vA9A,sA, uA0=! u;A0t4 t+9~VFz@ E% = %`=@%` = `@SE1ЩptE^0CL8CP8U9Es AP8 : F@t F$AP8^0CP8 N4F8F ctÍ'USP]w 6 u%PShm (QXZjSt]Ív6 u5 =)1 @5 B6 PPhSt]QShPm(R}6 ŐUPPEU =w.6 tOw26 U EWtvhPhm(PÉ6 E E%t벍UWVSh1Wh> jv 5 9}51 6 6 t@u,ǃ6 F9|5 PjWjue[^_]à RЃ 5 ÐUEP P ]Ív'UEEtP P 1]Í&H H ]UEH H ]Ív'U]ÍU]ÍU1]É'USP1M ]Q$;St ]ÍA(u PRCPYStu ]PRCPAP_vt1]Í'UVSuF uCVF jjjE NQPR$; VFɈe[^]PPF@Pju1ɉÅtPFPFPStVF u^F v FPmuF V؍&'USP1M ]Q$;SA(uPRSRAPst1]PRCPAP=uu]Ð&UVS1ۋEu PN$9)F(u3X)SQRFP4st1ۉe[^]Í&XP)QRvVtˍt&'UWVS E ]H$S19ZC<U )B(tT9 MrC9wmM9uPE @$PSVKtuԸe[^_]Ív9w0U rC9w!8uPM A$PSVJrtC9vߍe1[^_]UWVSNJEZ$Eۋr~;8/?t}~L:M/?O19|HGR(E UM})߉};}wE]1C]U<DAeu1Gqu1Gt1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$pE @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@뒉U E P RPEP%Ðt&U$EP $]ÉUEPQP@ ]ÍUWVS u }PPWCPft9ue1[^_]Íe[^_]UWVSj(EP@ftu=  tSu)E_t:QUsREPCPhu CU<tCu΋? ue1[^_]Íe[^_]à EPHh}r&USRË@tS u CPi Si]à P҃C Pi؍t&UWVS ǍX@09uG __uGHIHe[^_]à PZiGHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjjhEtU؉PJEAJMA AAAWWj(SidtV@EQQj)PTdRRNjE)ǍGPjehÅPWEPS\gE܃xX 1:-u BVocu 1E1؃|u1F|u1FtPPE PVEtLPPjj`cÅtNUԋu܉x M؋zpF DžɉzQtMM1A CY CPPE PV?Eu UR9XEPc1%VVjjb‹uԉE؃M؉P PF AN uЉ1|&'UWVSlEEPUE9MEEIEM9UEBX E9tM 1}WWMCuQUM} SVQRWP u}EtEt uu9]uMI t MEE!EtUU9UiUM ʉU}tEE9E&Ee[^_]Ít&Et/t uuuR}{E0P{s9tQQUCWRP U ƒU}t?9u܋Et }WFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt @u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐USEEEjjj]W]t) EEj Sh ,jPT 1@tЋ]S]81҈ƒUUM Ѓ d ]ÍUU E d 1]UU E d 1]USUE уd  %t []Ít&'USU Ed  t []Ud Eh ]ÍUWVS,E/ EE9Ed  h =` U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;EmTu=5  1ۋ=` PESPWPY^PES1U;u%t1t&` |u FU;u%uӍe[^_]ËEH d E؃t|t؉ڃ h t | l` DZ FST Ju ,- E f1)ЅM )CM  SQ&'UVSuP juR` t\PPSj_Rd t5PPSjIRh t e[^]à d PAR ` P0R1F8Ѝe[^]Í&USh ]PQXd PQY` RQC8]U]ÍU  |)A `- ǀ`- B4B8B,EB$DB(`EB PBB@ABpAB AB BB BBABA]ÐUSQ̀Ãv MۉZ[]É'Ux MʃɋU B]!Í&'UWVSEt E9El 5x Uup U1ۋuǃuɋ9tR0=  tɃ  ̀ÃvLۉ5t u]EC]9E`t [^_]Ít&'UV5l SӋu%t p @t  ؉[^]ÐUWVSSE] ƉEC<x 1uEx  ى Z[^_]Ít&'UWVSPE] ƉEC<x 1t!E'x  hjRD< u 1"t&5@:@ÐU5@p:@UEEPh> hj5@;ÍvU塀> ÉUj uhj5@;ÉUj uhj5@;ÉUE=t =t!v5D5DU0WV}辸r9…uEPu2;j(=t&jEPR5;Eut1e^_ÐU)tu tj 6:D1ÐUm5D<ÐUEM DBJh1ÐUSUM ]DHXh1]ÐUWVSE} s#uʉȻ6utzt80t1@80t,@80t'@utttu߃@@)ȍp} tUE xtL؉ڃtzt80t1@80t,@80t'@utttu߃@@)؃1ƅt7t9rU BPSQhBuEP,<GPQUR;ED8e[^_]UEP Љ]U S]Eƒtt t@tjEPEPEPRE P+‰ECtjjReC1 Er]]ÐUWVSu }UMEE@ |tE@|t1>t: wUU- Pr7EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQt99sUډ@C9r18}t MQ@9F w$Lu p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$8~1ۊY!#E9t]υt=Ѝ1A1ҊQ 9At1t1Ѝ%뎉[^_]ÍvUWVS1]1O~PP$lE PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1Ѝ%`FW1C1ҊS ƃ>FC4M!1̓w3$1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊ ЍL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ ЍT$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$ЃS!1C!̓w$Є1BR Ѕ~1(jjj1ЍPÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸vNju =vt3%9uvVPEP/ uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$EU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0Rv}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCST`MMT~`U(RjjTQtWTVP5`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Q$ ` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q~` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPP9E`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSP u @CRQ VD;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM111ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$ćE%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uE<MEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $jE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$H@vP@t<)u担87DžRt#H@%u㋅8) PB<v?t { 5B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WЉƃ؅uDžM ERCP~NF fF(ffVffNfF}<tSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:V ЋU+M MH}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$,]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB PmC MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh U ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PЉEupEEMP EPRQUM$ ABLErLPjURMQEPURCPV u'EMA`Up9R ]Ex`UH EPRQH1C1ҊS à ;AoEUB`Up9&R M ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE  &Dž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu Dž<E8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1ɈҝɣHA-Proxy version 1.3.23 2010/01/28Copyright 2000-2009 Willy Tarreau Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Default settings : maxconn = %d, maxpollevents = %d Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Could not open configuration file %s : %s Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Some options which require full privileges might not work well. [%s.main()] Cannot set gid %d. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF|Invalid server name: '%s' Socket path '%s' too long (max %d) bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789: 'D S@g{  @:@  splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsindependant-streamsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootdescriptionpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledhealthenabledbind-processevenappsessionrequest-learncaptureretriesblockunlessredirectlocationprefixuse_backend(unknown)force-persistoptionhttplogtcplogclear-cookiecodedrop-querydefault_backendredisprealmhttp-checkmonitorfailbacklogfullconngracedisable-on-404send-stateappend-slashhttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForheaderHELO localhost HTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 EHLOHELOcaphdrrewriteindirectinsertnocachebalanceserverpostonlyscopedomain%s; domain=%senablehide-versionshow-nodeshow-descsourceusesrccliexpreqrepclientreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackclientipintefacehdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d]: '%s' expects a string argument. parsing [%s:%d]: '%s' requires valid node name - non-empty string with digits(0-9), letters(A-Z, a-z), dot(.), hyphen(-) or underscode(_). parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' . parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : error detected while parsing a 'force-persist' rule. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable', 'hide-version', 'show-node', 'show-desc'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : '%s' expects 'code', 'prefix', 'location', 'set-cookie', 'clear-cookie', 'drop-query' or 'append-slash' (was '%s'). parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. Maybe you want 'maxconn' instead ? Maybe you want 'fullconn' instead ?parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d]: domain '%s' contains no embedded dots nor does not start with a dot. RFC forbids it, this configuration may not work properly. parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: '%s %s' invalid node name - should be a stringwith digits(0-9), letters(A-Z, a-z), hyphen(-) or underscode(_). parsing [%s:%d]: out of memory. parsing [%s:%d]: '%s' requires a parameter or 'desc' to be set in the global section. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: '%s' has to be > 0. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d]: line too long, truncating at word %d, position %ld: <%s>. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracking: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracking as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled again; name=%s/%s; node=%s; weight=%d/%d; scur=%d/%d; qcur=%dCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPDOWN %d/%dUP %d/%dNOLB %d/%dNOLBno check; throttle=%d%%HTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Proxy %s stopped. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)undocumented 'timeout appsession' may not do what you think and will be removed in next versiontimeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. config : 'option httplog' not usable with %s '%s' (needs 'mode http'). Falling back to 'option tcplog'. %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. @6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket (%s). Aborting. Invalid empty name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket (%s). Aborting. error when trying to preserve previous UNIX socket (%s). Aborting. cannot change UNIX socket ownership (%s). Aborting. socket(): not enough free sockets for UNIX listener (%s). Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener (%s). Aborting. cannot listen to socket for UNIX listener (%s). Aborting. cannot switch final and temporary sockets for UNIX listener (%s). Aborting. cannot bind socket for UNIX listener (%s). Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE/HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. y  ) Y     P   ~      >>>>>: @ w c v's"! !! !!/!HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough memory process_cli():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). Not enough Memory process_srv():asession:calloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valshdr_ippathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-Cookie%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/srvrepsrvhdrCache-control: privateConnection: close: %d.%d.%d.%dclireqclihdr: %s /Expect100-continueContent-Lengthappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratefe_connbe_connavg_queuelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓no checkDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,emptyOPENFULLSTOPactiveY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,%s

 text/plaintext/html on unlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')a positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max,
%s%s
%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,DOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy%s%s version 1.3.23, released 2010/01/28

HAProxy%s

Statistics Report for pid %d%s%s%s%s

> General process information

QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle
Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%lld%lld%s
Backend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%s

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits: memmax = %s%s; ulimit-n = %d
maxsock = %d; maxconn = %d; maxpipes = %d
current conns = %d; current pipes = %d/%d
Running tasks: %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.23 Release_date: 2010/01/28 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d node: %s description: %s rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: c` '=`U#req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endmm?mm?m.m?m:^?m:m?n:n?n:nn?n:n?"n:'n?/n:4n?9n:>n?Dn:Qn?\n: =?kn:yn?{nnn`?ntin`?nn??ccccccc!=====(((((,+++,parsing acl '%s' : matching '%s' for pattern '%s' is likely a mistake and probably not what you want. Maybe you need to remove the extraneous space before '('. If you are really sure this is not an error, please insert '--' between the match and the pattern to make this warning message disappear. Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splicerrrrr      "uutttttttpt_tQt=t*tttssmatch failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6dQ^Q^X^J^X^J^X^Q^Q^Q^C^:;<=>?@[\]^_` vvvvvvzvtvnvhvbv\vWvPvxdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error ?_^^^^^^^^^}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`}`^}`^}`}`}`}`}`}`^}`}`}`}`}`}`}`}`}`}`}`}`}`S`}`}`}`}`}`}`}`}`^}`}`}`}`}`}`}`}`^}`}`k_+b+bBbBbBbBbBbBbBbBbBbBbBbBbBbaBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBbBb/bBbBbBbBbBbbbbBbBbBb/bBbBb/bbbbbb%c%c%c%c%c%c%c,c"c"c{cbbbbbcc{c{c{c{c{c{c{c{c{c c{c{c{c{c{c{c{c{c{c{c{c{c{c{c{c{c{c c{c{c{c{c{c{c{c{c3c3c{c{c{cbbbbbbbbbb~b~bb{c{cb~b{c{cucuc{c{cIcIcddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddeeeedddddddd$ipppppppppppppppppppppppppppppppppppipppx$i^pnpppipppppppppppppppp~ppppppppppppppppppppppppppppilpTipppppppppppppppppppppppppppp/p$imlmwmUm8mLyh}Lxh}h}h}h}xh}h}h}h}h}h}h}}|}|}|}|}|}|}|}|}|}|txh}[y=yyh}h}h}h}yh}h}h}h}h}h}h}h}h}h}h}h}^zh}z|000000000000000000000000000000000000000000000000000"'/a////i////////*////0////////////l/lt|N bѧNZZZ֥0&Gΰխխխխխխ~~~~~~HH&ششششششvZZZZZZZZZ@أأأ՝|՝|`+y"b׶^ŷַ ĸ,d̺C!!1*!ݓԓѓΓǓ     |uof]YRJC:0(   !"# ߒՒ$Ғ ϒ ̒ ’%& '()*+x,vspmjgda[-YVN.F/C@=00)1!234 56789:ޑ;ۑ<ّ֑ӑБZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;+4-`zR| ( (H pp`k6EPMW$  h( `  ԏ8o\ooT *:JZjzʓړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjzL 'z~ "(/6=DKRY@ЮЮ &P%@. ,@% ,%&pP%@&P%63>ITunix_streamnlnvPж  ,1$2t22:@bbb:`cc :`cd :&pdP%:%d :%d ":%d":%d":%d%:%d0%:@&d`!; , e% ;&eP%=%f ;@&f`!";%f "+;%f"4;%f"=;%f%F;%f0%O;&gP%X;&iP%a; ,`j%;% g ;@& g`!!;% g "*;% g"3;% g"<;% g%E;% g0%N;&hP%W;&PiP%`; ,j%h;%j m;@&j`!v;%j ";%j";%j";%j%;%j0%334l5(667=&еP%=&pP%=&@P%=&зP%=&`P%=&P%=&`P%=&P%j`~BCC$C4C:CFCPCTC`CfCti&P%|i(P%i@tcpv6  nvж@@tcpv4nvжm P  m   n p    (( ~~~~`~ ~}}y}@}}|||`|7|||{{{{{`{ {zzz`z+zzyyygy@yyxxx`xDx xwww`wttQedXdXP<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&@-ic9-$-c$CPYDD$ c$J\YcIDK$"c$RYcQDS$"d$pYdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$YDDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$LZDDD!D(D7$;d$ZDD $d$Zdd DD DDDD+D/d@d@d@/$/e$Zdd #eDDDDDDD*D1d@d@.e@d@1$19e d[libtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)PZ69 w:@sIOL`;p``v@CP 3@y# Z0R s.k^p}X8k`-8p J0l@P O6F9O:^T<L]@fe@Az@FNq pF0Z6+display_version+display_build_opts+usage,sig_soft_stop-,sig_pauseT,sig_listen|,sig_dump_state,dump,init.deinitK2run_poll_loop2main4global4progname4pid4relative_pid5trash5zero%5one75nolingerN5stoppingp5hostnameZ6UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)9%a2base64base64tab8w:HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_authBstats_set_uristats_set_realmstats_set_flagZstats_set_nodestats_set_desc"stats_set_refreshdstats_add_auth,stats_add_scope_O3w%ultoa_r%strlcpy2&ulltoh_rz&limit_r&str2sun+'ishexR'invalid_char{'invalid_domainchar'str2sa$)str2sa_range*str2net,url2ipQ-str2uic-url2saw.encode_string/str2uip/strl2ui0strl2uic0strl2ic 1strl2ircj1strl2llrc1parse_time_err2my_strnduph3itoa_str3hextabL$ init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace0 buffer_replace2 buffer_insert_line2 chunk_printfW buffer_dump pool2_bufferp-F'Alert'Warning/(qfprintft(get_log_level(get_log_facility )send_logR+tcp_sess_log-log_facilities2-log_levelsT-monthnamev-sess_term_cond-sess_fin_state+$__task_queue@%__task_wakeupz%wake_expired_tasks'process_runnable_tasks)init_task*nb_tasks+run_queue+run_queue_cur(+nb_tasks_cur:+niced_tasksL+pool2_task^+last_timerN_tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnrCo Z get_pipe kill_pipe put_pipe pool2_pipe8 pipes_liveJ pipes_used\ pipes_freeR ?'$exp_replace%check_replace_string &chain_regex&pmatch3mO/warnifnotcap0warnif_rule_after_blockZ0warnif_rule_after_reqxxx0warnif_rule_after_reqadd 1warnif_rule_after_redirectb1warnif_rule_after_use_backend1warnif_misplaced_block2warnif_misplaced_reqxxxf2warnif_misplaced_reqadd2cfg_parse_globalN:init_default_instance:cfg_parse_listenOereadcfgfilehcheck_config_validityjcfg_register_keywordskcfg_unregister_keywordskcfg_maxpconn lcfg_maxconnlsslv3_client_hello_pkt0j%$srv_downtime$srv_getinter/4-process_chke2start_checks($srv_dynamic_maxconn%init_pendconn%pendconn_freeR%pendconn_get_next_sessk&process_srv_queue&pendconn_add'pool2_pendconn0#6+get_frt_addrO,event_acceptZ3a(proxy_cap_str(proxy_mode_str,findproxy_mode-findproxy-findserver}.proxy_cfg_ensure_no_http./start_proxies/soft_stopW0pause_proxy0stop_proxy0maintain_proxies$2pause_proxiesW2listen_proxies[3proxym3next_pxid3listeners}8'uxst_add_listener*uxst_event_accept_-unix_sock_parse_request;0uxst_req_analyser_statsc1uxst_process_sessionN8unix_sock_usage_msge8unix_sock_usage g /init_proto_http/http_header_add_tail0http_header_add_tail2u0http_header_match20find_hdr_value_end+1http_find_header2>2http_find_header3error_message4perform_http_redirect5http_return_srv_error5http_sess_log8capture_headers9http_parse_stsline9http_parse_reqline:http_msg_analyzer=http_capture_bad_messagez=stats_check_uri_auth=?http_process_tarpit?http_process_request_bodyAcheck_response_for_cacheabilityRBproduce_contentBapply_filter_to_req_headersCapply_filter_to_req_lineDapply_filters_to_requestDmanage_client_side_appsessionEget_srv_from_appsessionLFmanage_client_side_cookiesFHapply_filter_to_resp_headers=Iapply_filter_to_sts_line Japply_filters_to_responserJmanage_server_side_cookiesnLdebug_hdrLprocess_responsePhttp_process_requestdpool2_capturedpool2_requridhttp_is_ctlehttp_is_sep'ehttp_is_lws?ehttp_is_sphtWehttp_is_crlfoehttp_is_tokenehttp_is_ver_tokeneHTTP_200 fhttp_200_chunkfHTTP_3011fHTTP_302CfHTTP_303UfHTTP_401_fmtwfhttp_err_codesfhttp_err_chunksfhdr_encode_mapfurl_encode_map ghttp_methodswgsess_cookiegsess_set_cookie.0(splice(stream_sock_shutr#)stream_sock_readd+stream_sock_shutw+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv .stream_sock_chk_snd^,&appsession_task_init'appsession_init:(appsession_refresh6)match_str)destroy)appsession_cleanupx+pool2_appsess+apools+have_appsessionIX=P ,recalc_server_map-init_server_mapr0fwrr_init_server_groups6fwlc_init_server_tree[7get_server_ph7get_server_ph_post9get_server_hh9assign_servermAassign_server_address&Bassign_server_and_queueiBconnect_serverGEsrv_redispatch_connectFbe_downtimeFbackend_parse_balancew'$stream_int_check_timeouts%stream_int_report_error@%stream_int_return%stream_int_retnclosek5:-print_csv_headerx-stats_dump_proxy.stats_dump_http/stats_dump_rawc0stats_dump_raw_to_buffer0stats_dump_sess_to_buffer1stats_dump_errors_to_buffer8 7,tcpv4_bind_socket#.tcp_bind_listener/tcpv4_add_listener@/tcpv6_add_listenerg/tcp_inspect_request%pF52'sess_change_serverg'session_free{(init_session(session_process_counters(sess_update_st_con_tcpz)sess_update_st_cer'*sess_establish*sess_update_stream_int,sess_set_term_flags,process_session3default_srv_error4pool2_session4sessionsJAhdr_idx_add&(%signal_initm%signal_handler%signal_register%__signal_process_queue&signal_queue_len&signal_state&signal_queue&blocked_sig`<3+acl_parse_nothingy+acl_fetch_nothing+acl_match_nothing,acl_match_str_,acl_match_reg,acl_match_beg-acl_match_endF-acl_match_sub.acl_match_dir.acl_match_dom.acl_match_int3/acl_match_ip~/acl_parse_str/acl_parse_reg]0acl_parse_intM2acl_parse_dotted_ver94acl_parse_ip4acl_register_keywords4acl_unregister_keywords4find_acl_by_nameP5find_acl_kwQ6parse_acl_expr27prune_acl7parse_acl8find_acl_default8prune_acl_cond@9parse_acl_condY:acl_exec_condi;cond_find_require<filt_cap<default_acl_listr'$create_pool'%pool_gc2%pool_refill_alloc%pool_flush2%pool_destroy26&dump_poolsIFread_freq_ctrifreq_ctr_remainnext_event_delay.Ofeb_deleteeb_insert_dupcT[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)L]-check_cttproxy_versionOO__udivdi3F`O__umoddi3V6P0y& 07i  "0{ #[2-y &tk 5int 60 >Em ?ER AE3 C Di; GP7ro S UH  09 &-<5 &-?'#!' #' #b ' #  '#'#A'# '#z'# '#$'#(+ '#,M'#00'$#4.'#8e'#<'#@'">#D '#{#FH'$*#Gb'(:#H'1#L'7/#Td'8/#X':#\"'<@#` / ' ' '#  '$# B '#< :  P 3oBTGQqFz #D #E# #F# $[ >   # #  + R # J # t +# ; wgy 6 7#w 8#2>40YgG ro  b# ڰ# }# n ܓ# " # 7 =%kC%t %v# %x#hnh#ph#C"  - C#ref!h#0]4!w !x# !yC# !z0# !{0# '!|0# r!}0# y9!~0# ?!0# -!0#$ 4!0#( @ c bc# ss @ H#s#s# bit#u32"0* +y#key,#r H0wq1#rq2# 3#0 4#4 50#8 6#< 7/#@ 8#Dr)  D# # # [# C#: D# #)8)J )K0# * )L0# {)M/#fd)N# ?)O0#exp)P0# 5)Q# 6)R# p5)S# 6)T#$ib)UJ #(ob)UJ #, x )V0#0 )W/#4J # )U ?"}0#rex"~#wex"#rto"# wto"#cto"#l"0#r"#w"# lr"#$ >"0#( "0#, "0#0 "0#4 H"#8 )"A #< "7#@ "7#A "b#D <"#L "#P !"M #T "S #X y 0"tstr"u#len"v#  J  A p "z *C# L*C# *# !*#fe* #be* # *# ?*#$ Z *0#( D*#,req*J #0rep*J #4si*"#8 *# %*# *#srv*V# p*V# Q *V# > *"#txn*# *# * # *"# 2*"# # *Â# *Ă# ,*؎"# *0#y !G d ] Tn  # ! # k auid ^f#gid _P#  `[# bux a  ! Lfd M# N# h O# k? P# Q#  R# $ S#  T0#  U#  VC# * W# A X# ' Y# ` Z/# [0#  b # ) c# T Q 4 m#  n# S o#  p# q# r#  s#$ J5 t#( a6 u#,  v#0  w#4 { x#8 @ y#< h zC#@ e {#H  |C#L    FCfA#bBJ #.(?cbC# {D/# E7#evF7# G # H# I# J$#$ % $ J y9#get#put# u# # Y<_ ``/# @a##setb##clrc## Ad## @e##remf5#clog5# _5hR# 9ih#$ Bjz#( [%kh#, Hlh#0 4m#4 n#8  5)LL*;hLXzLn a ^/# _%# k`%#ae+ ,# - # .# /#  =P h# O#II=5-8len-90#cr-:0#-;0#b -Cv-D# y9-E# -F# .*-G# 3-H# U0,    D ,,l,ޔ#m_l,ߔ#u,#u_l,# v,#v_l,#,l,#v_l,#c,#c_l,# r,#r_l,#,rq,;st,D, P ,0#sol,#eol,#som,0# col,0#sov,0#eoh,0#cap,#sl,# ,b#8  ,#@J, 3,0# b,# ,P #req,#rsp,#\uri,# ,# ,# I,# ?,0#F  &0# f 0# 0# g VT@I JV# K# * L# M# N# O# B P# (R # S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< XC#@ !Y#H k?[#L p\#\ ?^#l `#| oa# b$# @dV# dV# e# o f# wg# h# i# ;i# %$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hwV# yt# yt# jz0# {q# }t# }t# ~t# ~t# t# .J# 0# t# t# t# Qt# U# (tDR # # O# # h# r# # # B$#,aclC#0 C#8 C#@ C#H >C#P >%#XsrvV#d e #h ? #l h ȶ%#p K# Z # ̔# # Δ# 0# Д# gє# [# Ӕ# R Ԕ# # ֔# ה# # G # Rڔ# 7۔# .'# # /ޔ# C# '&#id# +# C# t# 4 # # 0# i0# 0# 0# J# 0# +J# 0# t# t# t# $0# 0# `0# # z# # # # # 8# #0#j0# q#t#t#t#t# t#t#) t# t#Q t# #cap #p #?##o# #m ##u ##J{#{#### # #g##B#p ###Z#1(#]1(# # !#O"#q#7(# #7(#$#w %#&#'G(#= (#)# *0# +0#F,r$#:,r$#H\H ; + + C# +! #srv+"V# !D* *# *|# *|# /*|# *# *#  *#$ q&*[#( } *[#, *[#0 *t#4 Q*t#<"*px*ǰ #sv*V# *ɂ# D*ɂ# ?*0# iid*˔# J*˔#sid*˔#2" * "*n#"*iid*є#px*Ұ #buf*0#sid*0# ptr*Ք#bol*֔#"*!(*̤!!*"!*2" "  " "" "I"W#acl$*$+C#4$,#C$-C#  $.#$/0#"#C$>$?C#g$@C#pol$A#$B0#{.$C##p7!k?4un5d in6#p2u7##r$x , H#t0H#t1H# 9 #  # # D#$ #($ |#len0#pos0# sid0#srvV#oe #src#bufS #%be !43%  !0# .C#f% srvf%# # #V%Xact##bck##,%actH#bckH#& # Q # # # # # 8 # V#map3%# l%#, V‘%# T ñ&# 7ı&# 9ű&# /Ʊ&# DZ&#&V&0'  # 3# _9# R;# T@# *# \# !#' .( 7(# &)# *# +# ++# 6,# ?-# -.)# /)# 0'#$0'1(!   1(# 4 # Z #len # \ !# E "#' G( W(P #y(5$3 $44(@/0C#E1(#be5W(# ]#N)x(=>C#E?(#J@# A#%B#.C#?D0#E# F#$)   )# # #N))  )# # G#) *.S C.O# .P# h.Q# .R# + .;uid.<#gid.=# .># $.?# ,.@#  .A# !.B# a.C# .D# |.E#$ .F#( <.G#, .H#0 .I#4 +.I#8 J.J#< .J#@ .K#D .K#H .L#L  .L#P m .M##T u .M## .S)# .T # Y.U#% PnU&+{pU'+(+)+C*__cB+,(U,4+-, U-sig.T, U-sig.|,  )U/sig., 0RU/sig0p V10sVS.,m?`pU/sig>..9pU2W2+V0iV3p3'l4tmp3h3d5-3S5-`0ret"S5-0curQ P3 RV3RS6 ..Sa(.'.Sa(.(.(.6>..ףݣ(.'.ףݣ(.(.(.6r..%(.'.%(.(.(.'.>D(.'.>D(.(.(.7.n8m7. -8+8x+8,.P11U0p W0p0 P0h1(S3E1(V0sVV3cVp0lP3S3E(S3/ (V0expS3P0aclW#S3W#V3JP1S3B P1V0rdrV1S3CV1V0uap'V0ua'l3N")S0iS5S09\h5i09\h509\ h509\h509\h60\1ѩ(m1'w1ѩ(1'1ة(1'1ة:1P611+:1Q'1b(1'1m(2'1my(1y((;w1"*t;1*t;1*t<1]=\1<1*tǂ;1 ~*t};2 v*tu>K2 ūU/sigV0pS?2 ЫMU3t@2AABr3X'PU22+ 0errV3}S3'`3r3\53 0w|h5E380px S0retP3 V5]3X0ret:P1x3jP1C[&r3CJ &r3CL&r3C(L33 C(M3C4CC  C q*C.v4FCwC xC .\ C4D C/Q24E(I C0;C0<C1;0Fnow1<|C1>|CZ %G s *G5n@Hpido GXpCh.]GS  G& HoneGI5 ;G@&  p5 G`5C5 2#C 3$C4#Cj 5CC Q0CR0C U0C VCW1IlLI[m7(`IDIHInQO 0y& 07i 2-kint7rn#p#) D}#}#h#E# #:<P #N# H H< 03U ptr}Q h0S 'h@U[%S&NP i(hQ 4ɳU[3Vp 3HS idx50P ~<~г'U[;RD;}W idx=0P!>HS&C%C% J0U[Ipp IHW idxK0P!LHS`p&R%R%\S[U[ZW i\0V!]HS\g = 0OyF =UinQ_>VoutS/4intr @7 <  D @0y7i "%2-y&^kint6%>:m?:RA:3CDS7rH %9 -5 -? s#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. s#8e s#< #@ "3#D #e#FH $#Gb (#H 1#L 7#Td 8#X :s#\" <#`    #  # B s#    3-n-#p-#o BT G Q$[3  _# #   R_# Jz# t#  w    b  #  m   # # # bit s#u32"%* +##key,m# H0wq1x#rq2x# 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,)8J K%# * L%# {M#fdNs# ?O%#expP%# 5Q# 6R# p5S# 6T#$ibUg#(obUg#, x V%#0 W#48g# U ?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )#< ,#@ ,#A L#D <#L #P !#T #X~~gp m! ] auid^I#gid_3# `># buxa !LfdMs# Ns# hOs# k?P# Q # Rs# $Ss# T%# U # V# *W # AX2# 'Y # `Z# [%# b# )c# TQ 4m # ns# Sos# ps# q_# rT# ss#$ J5t #( a6u #, v/ #0 w/ #4 {x/ #8 @y/ #< hz#@ e{s#H |#L ss s  / s  V  Cf A #b Bg# .( ?cb C # { D# E,#ev F,# G #  HT#  Is# J #$ 5 j   Y< _ ` `# @ a #set b #clr c # A d # @ e #rem f #clo g # _5 h # 9 i1 #$ B jC #( [% k1 #, H l1 #0 4 m#4  ns#8 s s s      s  1 s ! C  7 n '@U ! S /öU !. S >sж U = P !? S \LsMU K P !M S( *ZsPU !Y S^ jsU i P !k S Lx-U !w Q !\|- 0SU  P `U  R"ft!\-) søU  S#errsV_sиU  S#errsVrs cU  S#errsV7spU  S#errsV$[ $J $ q $. vV $ ws )% $Q0ly& 07inti 2-k7r  #>#}# #>#G}# .('7(>#&)}#*}#+}# ++}#6,>#?->#-.#/# 0#$< U  <V uS 7  4? 2  '%%%}P` '*%*}P@ U  ?<uri?}S uASB}V 7C> S Q\lU  [< [} u]S^}V lc jWZupU  < >P uɝRv,U  u<W 4u}P uwSkx}V  "]0U  <W +}P uS-}V  dU  < >P uR&\U  < f} uםW}V a%> >-SB&p QQ 7E н &% %U <}VuWH }V{ S pout'%# /&%%3Y0,y& #07 Bi "02-y&tk2B5int60>Pm?PRAP3CDi7roS UH 02I40Y1G <xo bR# "7 $Po BT G QqFz %D%E#%F#[ 7  J G#  .A J$$[I_ +#_# o R+#J#t#  w+#G#n ]#" # B d r\ s#] t # u# v#  w #6Tn  +#!#  k 9 -L5 - ?# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .#8 e#< #@ "I#D #{#F H$#G b(#H 1#L 7/#T d8/#X :#\ "<#`/ # #B #Y  R  3 b#  E  # # # bit#u32"0y*+#key,E#n#p#y" - y#ref!#H H0wq1P#rq2P# 3#04#450#86^#< 7/#@8#DXXXH]4$w $xL#$yy#$z0#  ${0#'$|0#r$}0#y9$~0#?$0# -$0#$4$#(  )8J K0#* L0#{M/#fdN# ?O0#expP0#5Q# 6R#p5S# 6T#$ibU< #(obU< #,x V0#0W/#4 < # U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)3 #< B#@B#Ab#D<#L #P!? #TE #Xk 0tstru#lenv#| | <  3 p zy#Ly# X# !#fe#be## ?#$Z 0#(D#,req< #0rep< #4si!#8 o#%o##srv^#p^#Q ^#> !#txn# ##!#2!## Í#č#,ؖ!#0#k !9 V ] auid^#gid_#`# buxaV  !LfdM# N#hO#k?Po#  Q#R#$S# T0#U#Vy#*W#AX^#'Y#`Z/# [0#b #)c# TQ4m#n#So#p# q+# r # s#$J5t#(a6u#,v#0w#4{x#8@y#<hzy#@e{#H|y#L     CfA#bB< #z.(?cbCz#{D/# EB#evFB# Gd#H #I#  J#$   Jy9#get#put#u# # p 7k? 46un 5jin 6$p 2u 7#w) D###[# y#:$d  "a"^/#"_%#k"`%#"a e!+!, #!-#!.#!/#  EP #W#QQwE5(8len(90#cr(:0#(;0#b (Cv(D#y9(E#(F#.*(G#3(H# ]8'           D ' 'l'ޟ#m_l'ߟ#u'#u_l'# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'Cst'D'P '0#sol'#eol'#som'0# col'0#sov'0#eoh'0#cap' #sl'#  'b#8 '#@R'3'8#b'# 'B #req'#rsp'#\uri'# '#'#I'#?'0#F &0#f 0#0# 1!^T@IJ^# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<Xy#@!YX#Hk?[#Lp\#\?^#l`#|oa# b#@d^#d^#e#o f#wg#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guP# v#hw^#yt#yt#jz0# {#}t#}t#~t#~t#t#.R# 0#t# t#t#Qt#U#(tDR# ]#O]# # h#r###B"#,acly#0y#8y#@y#H>y#P>##Xsrv^#de #h? #lh ##pK#Z #̟##Ο#0#П#gџ#[# ӟ#R ԟ##֟#ן##G #Rڟ#7۟# .E%##/ޟ#y#'$#id#+#y#t#4 ##0#i0#0#0# R#0#+R# 0#t#t# t#$0#0#`0#]#z]#]#]## #8## 0# j0# # t# t# t# t# t# t# ) t#  t# Q t#  #cap # p # ?# # o# # m  # u  # J{# {# # # #  # # g# # B# p  #  # # Z# Q%# ]Q%#  # !# O"# q#W%# #W%# $# w %# &# 'g%# = (# )# *0# +0# F,"# :,"#Hd; && y#&!| #srv&"^# D ## # /###  #$q&[#(} [#,[#0t#4Qt#< #!pxǸ#sv^#ɍ#Dɍ# ?0# iid˟#J˟#sid˟# :! "Τ# !iidџ#pxҸ#buf0#sid0# ptr՟#bol֟#!(̬ #!:! !  !| !!| !I"x ,#t0#t1#9### D#$ #("#len0#pos0# sid0#srv^#oe#srco#bufE ##be4 B# !0#.y# u# srvu## # #^ #Xact"#bck"#, #act#bck# $#Q # ## ##8 # ^#mapB## {##,V ##T $#7$#9$#/$#$#$^$ ?% #3#_9#R;# T@#*#\#!# .?%! K% g% w%B "%<U#n;[Q$# ; $y9;%pos=S"&,?U#dst+R#src+S$y9+Q&-V"z&P@WU#nObVW$# O$y9O&R+QS&Rp"&r`U#nq[R$# q $y9q#altqP"%'{%'U#strzS%su|j&&}P'(__s/j"R'2U#sR"{'@U$4Q"'U$4Q"((U#strS%sa϶%cP&#џV)*T((__s/=(!0$IB(__u((__cӂ+((9J,(-(9J,(,),).(fl%__vIP'%he)P(/(n0m/) -0+0x+ 0,"*j(/U#strW#lowP$P%sa %cS1p1V2***3__s/4)5!05$I5B3__u*3__c** 6sepV+Q*(bq,(-(bq,(,),)-(qu,(-(qu,(,),).*6__v#IP786he)P)8o,L50cU9str4:k?4o, :`4o,2g2e6c7V6s7W18S6len9[P*+P3__s?/4+?5!?05$?I5?B3__u?u,3__c?*,h3__s@/4+@5!@05$@I5@B3__u@{,3__c@*=,6errJd-(,(;)P,).X,6heX)P'=K3__vO0]b++8;-opZU:k?nV9dstno,P1pl1ph6chpQ6tmpq;-p6tpqK-W6cprd71yBS'6new}P K-x x8-S0`U9s--d;-R7<-S<-Q=-Q0>s(i0(j08w.@xU9url:e :k?(1S6cpV6retR1*Q10p'ae3__vI8.gU:R+Q:  :s9map.:V'1R. 8L/V0 GU9s-L/!#;]/Q7sڣ(i08/I0PyU9s9lenP-/QS;/S;/Q7s>len(i08m00U9s9lenP-m0;0S;0Q7<0V<0R?0@00AsAlen3i03j03k08 1&U9sS9lenQ6iV6jR3k8j1,0U9s+V9len+S9ret+P6i-Q6j.R81w\HU9s[9len[ 9ret[1P6i]tVW6j^lt8|23PU: S9ret|2P:010V10W10p1;0l10d'6j0R082uYU9srcW9nP6lenS6retVBB K22 IB L23 B M2B[ 3BJ 3B.v?3Bw h3 C"R3`&  3 D3 z3 X r`0y+06ri%7i 2-y&vkint3CDk76H H9 -r5 -?#! # #b  #  ##A# #z# #$#(+ #,M#00#4.#8e#<#@"V#D #}#FH$#Gb(#H1#L7#Td8#X:#\"<#`x 6   #  # B # 6  6 3n#p#]4w x}# y# zH# {H# '|H# r}H# y9~H# ?H# -H#$ 4#( 6  $[ V   # # 6 )8J KH# * LH# {M#fdN# ?OH#expPH# 5Q# 6R# p5S# 6T#$ibUE#(obUE#, x VH#0 W#4E# U ?}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 H#4 H#8 )#< O#@ O#A d#D <#L #P !#T #Xt0tstru#lenv#Ep t! 6] Cf A#b BE#f.( ?cb Cf# { D# EO#ev FO# Gv#  H#  I# J#$ v  |`U&fUbuf%ESmsg%r len%Vmax'%2C2 buf EObufOU "EpZUbufDES 0DVmaxF%2CK0 k`3UbjESposj endjstrjr!lWlenm 5@UbESpos endWstrrlen!p R UbEVpos strrlen!WW ENUchkV y9Sfmtr"#=$retP% fPUo pbEW rStol&[ &J  &. v & w 6' & Q & ;H(  - -a)^0y& 07i "02-y&ikint60>Em?ERAE3CD^~7roS UH 0oBTGQqF uz !D !E# !F#+iu9 - /5 - ?~# ! #  # b  # # # A# # z# #$ #( + #, M~#0 0#4 .~#8 e~#< #@ ">#D #p#F H$#G b(#H 1#L 7#T d8#X :~#\ "<#`5   ~  ~#  # B ~#G@3Vtm,w Ex~# 6y~# z~# {~# T|~# h}~# L~~# ~# ~# #$ /#([ >    a# #  R a# J # t #w2>40YG  3o  b # x a# # n # " x#7 b#   # # # bit~#u32"0 ?* +#key, # dnd#pd#? "  - ?#ref!d#  H0wq1#rq2# 3~#0 4~#4 50#8 6$#< 7#@ 8~#D ]4w x:# y?# z0# {0# '|0# r}0# y9~0# ?0# -0#$ 4#( )8#J #K0# * #L0# {#M#fd#N~# ?#O0#exp#P0# 5#Q# 6#R# p5#S# 6#T#$ib#U #(ob#U #, x #V0#0 #W#4 # #U ? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H ~#8 ) #< 7#@  7#A W#D < #L #P !  #T #X 1 0 tstr u#len v~#B B  H  p  z "?# L"?# "# !"#fe"!#be"!# "~# ?"~#$ Z "0#( D"#,req" #0rep" #4si"##8 "# %"# "3#srv"-# p"-# Q "-# > "##txn"# "~# "!# "## 2"## # "w# "w# ,"e## "0#1 !  ] E Tn  a# !E #U k auid ^6#gid _ #  `+# bux aU ! Lfd M~# N~# h O~# k? P# Q#  R~# $ S~#  T0#  U#  V?# * W# A X$# ' Y# ` Z# [0#  b # ) c#  T Q 4 m#  n~# S o~#  p~# qa# rV#  s~#$ J5 t#( a6 u#,  v#0  w#4 { x#8 @ y#< h z?#@ e {~#H  |?#L  ~~~~CfA#bB # y.(?cbCy# {D# E7#evF7# G# HV# I~# J#$l  J y9~#get~#put~# u~# X# ~p7k?4lun5 in63 .p2u7#o'S C'O~# 'P~# h'Q~# 'R~#  ';uid'<~#gid'=~# '>~# $'?~# ,'@~#  'A~# !'B~# a'C~# 'D~# |'E~#$ 'F~#( <'G#, 'H#0 'I#4 +'I#8 J'J~#< 'J~#@ 'K~#D 'K~#H 'L~#L  'L~#P m 'M#T u 'M# 'S.# 'T # Y'U~# @)  D# # ~# P# ?#:* a ^# _%# k`%#aQ e+ ,# -# .~# //#   P d#  #@ e5&8len&90#cr&:0#&;0# b &Cv&D# y9&Ew# &Fw# .*&Gw# 3&Hw# & %!!!! ! !!!! ! D %¼c%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq% st%c }D% P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%}#sl%# %W#8  %~#@ !% 3%# b%e# % #req%#rsp%#\uri%# %# %# I%~# ?%0# XF  &0# f 0# 0#g"-T@ I  J-# K~# * L~#  M~#  N~# O# B P# ( R!#  S~#  T~#$ 5 T~#( $ U0#, 6 U0#0 t V~#4 4 V~#8 ' W~#<  X?#@ ! Y#H k? [3#L p \3#\ ? ^3#l  `~#| o a# b# @ d-#  d-#  e# o f3# w gw#  h~#  i~# ; i~# %$ j~# j~# R j~#  k~#  l~# F m~#id o#  p0# b p0# q0#  r0# u s0# ? t0# V t0# g u# v!# h w-#  yi# yi# j z0# {A#  }i#  }i#  ~i#  ~i#  i# . !# 0#  i# i#  i# Q i# U ~#g!(tD R  # # O # ~# h ~# r ~#  ~#  3# B $#,acl ?#0  ?#8  ?#@  ?#H > ?#P > $#Xsrv -#d e ~#h ? ~#l h Ȕ%#p K # Z #  ~#  #  ~#  0#  ~# g ~# [ # ~# R ~#  #  ~#  ~#  # G # R ~# 7 ~# . '#  # / ~#  ?# ' &#id # + #  ?# t ~# 4 ~#  ~#  0# i 0#  0#  0# !#  0# + !# 0#  i#  i# i# $ 0#  0# ` 0#  # z #  #  #  # ~# 8 #  ~# 0# j 0# A#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p 3# ? 3#  ~# o #  !# m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p #  #  ~# Z ~#   '# ]  '#  K#  !K# O "K# q #&'# #&'#  $~# w %#  &~#  '6'# = (~#  )~#  *0# +0# F ,P$# : ,P$#H3 !; $ $ ?# $!B #srv$"-# {"D" "~# "L# "L# /"L# "# "#  "#$ q&"P#( } "P#, "P#0 "i#4 Q"i#<""px"LJ!#sv"-# "w# D"w# ?"0# iid"~# J"~#sid"~# # " ""j#e#"iid"~#px"҇!#buf"0#sid"0# ptr"~#bol"~##"("{"""" ##!#B ##B #I P$x ,  #t0 #t1 # 9 !#  !#  ~# D ~#$  ~#($  L#len 0#pos 0# sid 0#srv -#oe !#src #buf #$ be !4 % ! 0# . ?#D% srv D%# ~# ~#-o%X act ##bck ##,% act #bck #&  ~# Q ~# ~#  ~#  ~#  ~# 8 ~# -#map %#  J%#, V o%# T Ï&# 7 ď&# 9 ŏ&# / Ə&#  Ǐ&#&-&'  ~# 3 ~# _9 ~# R; ~# T@ ~# * ~# \ ~# ! ~# .'! '6' F' #'>U$fmt=/%&?'tm@H(')'D)'P*'"+now!'+tm!' A#/(xS U$fmtR/%&T'tmUH('4K)'D)'P#n('gU$outfn(S$fmtf/ %&h,(v~U$levu/V-w~S.&&z%&z%, )~ UU$fac/V- ~S.5H&&%&%#+`kU$p!V/~ /-/S%-~-~Į-Ȯ&-+@-@-~~-~P-w~-=+----~W-~-pS0*-*+P- ~R-S1* 2*+V22~P(5+3F+.k'tm(')')'P+$+$+0+ 4R+~5*+6M,[@p^U7s?B S8pnA8feB!V8beC!~9D!20E~W2E~~8errE~~2F~8tmG~:,')'~)'P16,^i;__vj>.$4;__vi><[n(pid'Z~<& '_-/?"-`2-/?,"-@T-/ ?1D-v-5?6-r f-?7-j f-+"`0y& 07i "02-y&ik27int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz "D"E#"F#    b#  p  x### bit#u32"0'*+#key,#LnL#pL#'{" - '#ref!L#]4!w !x#!y'#!z0#  !{0#'!|0#r!}0#y9!~0#?!0# -!0#$4!#( * 02>40Y5G @|o bV#$[> ##  R#J#t#  wWڇ#K#n a#" W# g7 9 -r5 -? #! # #b #  # #A # #z #  #$ #(+ #,M C#00 I#4. #8e #< #@ ">#D #p#FH $O#Gb (_#H 1#L 7#Td 8#X :#\" <e#` C  C# I#B # r _  u 3 H0wq1#rq2# 3#04#450#86#< 7#@8#Du)8 J K0#* L0#{ M#fd N# ? O0#exp P0#5 Q# 6 R#p5 S# 6 T#$ib U; #(ob U; #,x V0#0 W#4 ; #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) 2 #< 7#@ 7#A W#D< #L #P! > #T D #Xj 0 tstr u#len v#{ { ;  2 p  z '#L '# # ! #fe #be # # ? #$Z 0#(D #,req ; #0rep ; #4si #8 #% # #srv a#p a#Q a#> #txn # # # #2 ## Â# Ă#, ؙ # 0#j !8 U ]~ Tn  #!~ # k auid^1#gid_#`&# buxa  !LfdM# N#hO#k?P#  Q #R#$S# T0#U #V'#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n#So#p# q# r|# s#$J5t #(a6u #,v#0w#4{x#8@y#<hz'#@e{#H|'#L       7 Cf A #b B; #.( ?cb C#{ D# E7#ev F7# G# H|# I#  J#$    Jy9#get#put#u# #t) D###P# '#:!{ a^#_%#k`%#ae+,#-#.#/*# BP L#T#NNtB5%8len%90#cr%:0#%;0#b %Cv%D#y9%E#%F#.*%G#3%H# Z5$    D $$l$މ#m_l$߉#u$#u_l$# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$# $rq$@st$D$P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$۱#sl$#  $W#8 $#@U$3$5#b$# $A #req$ #rsp$ #\uri$# $#$#I$#?$0#F &0#f 0#0# 5 aT@IJa# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X'#@!Y#Hk?[#Lp\#\?^#l`#|oa# b#@da#da#e#o f#wg#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v#hwa#yi#yi#jz0# {<#}i#}i#~i#~i#i#.U# 0#i# i#i#Qi#U#(tDR # a#Oa# # h#r###BC"#,acl'#0'#8'#@'#H>'#P>a"#Xsrva#de #h? #lh  ##pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉##G #Rډ#7ۉ# .܉$##/މ#'#' $#id#+#'#t#4 ##0#i0#0#0# U#0#+U# 0#i#i# i#$0#0#`0#a#za#a#a## #8##0#j0# <#i#i#i#i# i#i#) i# i#Q i# # cap #p #?##o##m 1!#u 1!#Jp#p#### # #g##B#p ###Z#$#]$# # !#O"#q#$# #$#$#w %#&#'$#= (#)# *0# +0#F,!#:,!#Hgx; ## '##!{ #srv#"a# D  # G# G# / G# # #  #$q& P#(} P#, P#0 i#4Q i#<&  px ǻ#sv a# ɂ#D ɂ# ? 0# iid ˉ#J ˉ#sid ˉ#= " R#  iid щ#px һ#buf 0#sid 0# ptr Չ#bol ։#  !( ̯! & ! =   {   {  I1!p7!k?4un5U in6J!p2u7 !#!x ,x#t0x#t1x#9### D#$ #(C"G#len0#pos0# sid0#srva#oe#src#bufD #a"be!4" !0#.'#" srv"# # #a"XactJ!#bckJ!#, #actx#bckx###Q # ## ##8 # a#map"# "#,V"#T $#7$#9$#/$#$#$a#$ #3#_9#R;# T@#*#\#!# .$! $ $ $A "%RT` U# SS$%s%%$!%s|%.%&!% v'tu(:%])\:%*z%0U+t/S,8-5P"&{U#z V- |W.eb}:%S/%&%&0&P/&&%'$'%$'$7'0I'P%U'/n&b'%s'$'%'12'P$7' 0I'P%U'/&%%%$!%%.%/&'1E%'0'P$'%'%'&&@_'t1^'t2^&'7:%) 631'61'4 53b'1'4R+4F0&'C:%)B:%3'T1'4S1'5tU&'k)j'nowj&'h'tg'fg0"@))bU# .tS.eb:%V-0W-‰p/(b'&Z%s'$'&Z%'1&Z2'P$7'HW0I'P%U'/(@)Z`%Q)$!%Z`0.%P/([)%h)/(t)%)%)$&-=%'$'-=%$'$7'-=0I'P%U'&[)'t(t)T) &) 't1't26n*_pU7*v5__s8)9!09$>975__un*5__cw,P5__s8T*9!09$>975__ut*5__cw)&*:[*g:J *:. v*7: w *; :&Q*:';0#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# ?O%# expP%#5Q4# 6R4#p5S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P! #T #X:p ! ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    &-h[Utv1,Qtv2,S%htv1tv2```Utv`Sr mshQ:6hUtv15Qtv25R9htv1tv2- Ah Utv1@Vtv2@W-,9?KX*htv1)tv2)>K:Utv1JVtv2JS  h!" =[:tv1Ztv2Z/ )J:tv1Itv2I"retK: U:<Utv1TWtv2TS 7  #7!"  *a:@zUtv1`Stv2`RKg  $" Pb i`Utvh`VrhRinchPb t    w`tvv`%rvincv orh Utvq`SrqVincqQ    - nhtv`%rinc {`tUtv1zRtv2zPtvz`V 9    `tv1tv2tv`U b`Utv1Stv2Rtv`QA U g s         a`tv1tv2tv` o`tvn` h0Utv1Qtv2R    htv1tv2k h0`Utv1Qtv2Rk 9G|   htv1tv2&u`U}hSh 'Wp'p'h(()b t   Euauhtv1tv2x`tvx`L 6UthSaQ)rvx)p͓p)cnthl ' *[4F*J 4*.vT*wh x+ * Qg,1% - ,%8- ,%,- -now- ,0- ,$-  ,A@0y& 07i 2-y &^kint3 C DS7rH  09 -a5 -?s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8es#<z#@">#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`g   #  # B s#s  l  3[ >   # # + 2>)8 J K0# * L0# { M#fd Ns# ? O0#exp P0# 5 Q# 6 R# p5 S# 6 T#$ib Ue#(ob Ue#, x V0#0  W#46e#  U ? }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H s#8 ) #< 7#@  7#A L#D < #L #P ! #T #X||ep k! ]ssCfA#bBe#].(?cbC]# {D# E7#evF7# Gm# H# Is# J#$ m  J y9s#gets#puts# us# "#sY<_ ``# @a#setb#clrc# Ad# @e#remf#clog# _5h# 9i #$ Bj#( [%k #, Hl #0 4ma#4 ns#8ss ss s 1+q&@Ufd%sWqS_~QS`/q.#.sQ4ZU3ap5sV'< &8% 8%! As`UpBsQbpCV"D ZU#bp\p]sV$ ls Uoutk pmsS%.*nsh%nsW%7ospbppl&sAU'[ 'J  ( / (xs   ( `- (.= (s/ ( sD- ( s@-  ) 'Qy k 0P0y7i  "%2-kint 6% >:m ?:R A:h7r % oBTGQz $  n $# p $# ]4w x# y# z%# {%# '|%# r}%# y9~%# ?%# -%#$ 4#(  23 4%YG  o  b#[3 T   # T#d  R # Jo# t#w   # # n # " #, )Tn  # !)#9k ap7 k?4+un5in6 zp2 u79# b#z ### bith#u32"% 1* +# key,#  H0 wq1# rq2# 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _#  `#  bux a  ! L fd Mh# Nh# h Oh# k? Pd# Q#  Rh# $ Sh#  T%#  U#  V# * W# A X# ' Y$# ` Z# [%#  b# ) c#  T Q 4 m*#  nh# S oh#  ph# q # r#  sh#$ J5 t#( a6 u#,  vJ#0  wJ#4 { xJ#8 @ yJ#< h z#@ e {h#H  |#Lhhh:Jh:S COh# Ph# hQh# Rh#  ; uidh# $?h# ,@h#  Ah# !Bh# aCh# Dh# |Eh#$ Fh#( <G#, H#0 I#4 +I#8 JJh#< Jh#@ Kh#D Kh#H Lh#L  Lh#P m Ma#T u Ma# SP# T# YUh# T !  h# <!h# "h# #T #   &T PUret'T &(p__p5S I fUpHT S VpUpUT R -dU !" X#2 *#T #h#h;'30by& 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz !D!E#!F#|  a^#_%#k`%#ae jh#si#Wj?e+,?#-E#.#/v# K 2>40YPG [o bq#$[> ##  R#J#t# - wrڢ#f#n |#" r# 7 9 - 5 - ?# ! #  # b  # # # A# # z# #$ #( + #, Md#0 0j#4 .#8 e#< #@ ">#D #p#F H$p#G b(#H 1#L 7#T d8#X :#\ "<#`d d# j#B #-  &  3 b#    # # # bit#u32"0M*+#key,#r n r#p r#M" - M#ref !r# H0wq1$#rq2$# 3#04#450#862#< 7#@8#D,,,]4 w x # yM# z0#  {0#' |0#r }0#y9 ~0#? 0# - 0#$4 #(  )8 J K0#* L0#{ M#fd N# ? O0#exp P0#5 Q# 6 R#p5 S# 6 T#$ib U #(ob U #,x V0#0 W#4 #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8)  #< 7#@ 7#A W#D< #L #P!  #T  #X? 0 tstr u#len v#P P  V  p  z M#L M# ,# ! #fe 7#be 7# # ? #$Z 0#(D #,req  #0rep  #4si ?!#8 #% # -#srv #p #Q #> O!#txn 3# # z# a!#2 x!## w# w#, !# 0#? ! * ]S Tn  #!S # c k auid^1#gid_#`&# buxac  !LfdM# N#hO#k?P#  Q#R#$S# T0#U#VM#*W#AX2#'Yp#`Z# [0#b #)c# TQ4m#n#So#p# q# r# s#$J5t#(a6u#,v#0w#4{x#8@y#<hzM#@e{#H|M#L      Cf A#b B #.( ?cb C#{ D# E7#ev F7# G# H# I#  J#$    Jy9#get#put#u# #p7k?4un5* in6-1p2u7#) D###P# M#:18P r##5$8len$90#cr$:0#$;0#fb $Cv$Df#y9$Ew#$Fw#.*$Gw#3$Hw# #           D #l #l#މ#m_l#߉#u##u_l## v##v_l## j#l##v_l##c##c_l## r##r_l###rq#st#-D#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#-#sl#j#  #W#8 ##@#3##b## # #req##rsp##\uri## ####I##?#0#F &0#f 0#0# P!T@IJ# K#* L#M# N# O#B P#(R7#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<XM#@!Y,#Hk?[-#Lp\-#\?^-#l`#|oa# b#@d#d#e#o f-#wgw#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu$# v=#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#7(tDR# |#O|# # h#r##-#B~"#,aclM#0M#8M#@M#H>M#P>"#Xsrv#de #h? #lh D##pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉#ؕ#G #Rډ#7ۉ# .$##/މ#M#'E$#id#+#M#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#|#z|#|#|## #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p -# ?-# # o# 7# m # u # Jp# p# # # #  # # g# # B# p ?# ?# # Z# $# ]$#  # !# O"# q#$# #$# $# w %# &# '$# = (# )# *0# +0# F,"# :,"#Hz; "" M#"!P #srv""# + D  # G# G# / G# # #  #$q& P#(} P#, P#0 i#4Q i#<  px 7#sv # w#D w# ? 0# iid ˉ#J ˉ#sid ˉ# " x# ! iid щ#px 7#buf 0#sid 0# ptr Չ#bol ։#?! ( +  Ϣ  ׹ O! Ca!P U!x!P g!I"x ,#t0#t1#9=#=## D#$ #(~"G#len0#pos0# sid0#srv#oe7#src#buf #"be74 " !0#.M# " srv"# # # #Xact!#bck!#, D#act#bck# 3$#Q # ## ##8 # #map"# "#,V##T ?$#7?$#9?$#/?$#?$#?$3$ $ #3#_9#R;# T@#*#\#!# .$! $ $ $ "%U#dstW#src #strvV$%%p&}%;p'len#S'num#P(%n/7Q%R/7P&%|)@2()@3% " &yEvMU#strDvS'errFvV"{&FfvPU$bd{&S$dER$eR$evV*expg?+_o'errjvP?,BK&& >,L&& ~,M& & -&0 ,[&,J &,. v ', w 1'. ,%Q 'm88:0y& 07i  "0{ #[2! %m-y &k 5int 60 =b >Em ?E! @PR AE BE3 C Dt7ro S U! lK qH  09 *-s5 *-?+#!+ #+ #b + #  +#+#A+# +#z+# +#$+#(+ +#,M+`#00+f#4.+#8e+#<+#@+">#D +##FH+$l#Gb+(|#H+1P#L+7f#Td+8f#X+:#\"+<#`  7 f +` + +`#  +f# B +#)s | "  3oBTGQqF$z $D $E$# $F/#2>40YG .o  b#$[[ >m  9# m# }   R9# J# t#  w  9# # n # "  # 7 rr \s# ]t# u# v# w#D0 %3 %4# n%5# %6# %7# Z %8# %9# !%:#,', !'-# - '.# !'/# '0# QE!X)% ,!)&# )'># !))# )-# ]).# )/# )0# $!)1# d)2>#( C)4#, c)8:#0 S!);E#4 !)?$#8 ")@[#< )A$#@ ")B[#D  )C$#H f)D[#L ")F[#P p)G[#Tt bt#  Q Y### bit#u32 "0 *  +#key ,#- n -#p -#\"  - #ref !-# H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7f#@  8#D\ ]4"w "x# "y# "z0# "{0# '"|0# r"}0# y9"~0# ?"0# -"0#$ 4" #(   j )8-J -K0# * -L0# {-Mf#fd-N# ?-O0#exp-P0# 5-Q| # 6-R| # p5-S| # 6-T| #$ib-U #(ob-U #, x -V0#0 -Wf#4v v  j  # -U ?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 #0#4 H##8 )# #< #7#@ #7#A #m#D <#v #L #v #P !# #T # #X  0#tstr#u#len#v#     p #z .# L.# .# !.^#fe.D!#be.D!# .# ?.#$ Z .0#( D.#,req. #0rep. #4si.L##8 .}# %.}# .#srv.# p.# Q .# > .\##txn.@# .# .!# .n## 2.…## # .Í# .č# ,."## .0# ! ]Tn  9# !#  kQ auid^#gid_# `#d buxak !LfdM# N# hO# k?P}# QX# R# $S# T0# U^# V# *Wt# AX# 'Yz# `Zf# [0# bQ# )c#X TQ 4m# n# So# p# q9# r.# s#$ J5tt#( a6ut#, v#0 w#4 {x#8 @y#< hz#@ e{#H |#Lkdtd  XCfAt#bB #B.(?cbCB# {Df# E7#evF7# Gr# H.# I# J#$ R  J y9#get#put# u# #R )  D# # # [# #:G a ^f# _%# k`%#ae+ ,# -# .# /# R GP -# #(518len190#cr1:0#1;0#yb 1Cv1Dy# y91E# 1F# .*1G# 31H# 0    D 0&0l0ޟ#m_l0ߟ#u0#u_l0# v0#v_l0#}0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st0&@D0 P 00#sol0#eol0#som00# col00#sov00#eoh00#cap0#sl0}# 0m#8  0#@0 30# b0(# 0 #req0#rsp0#\uri0# 0# 0# I0# ?00#F  &0# f 0# 0# $ T@I J# K# * L# M# N# O# B P# (RD!# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X#@ !Y#H k?[#L p\#\ ?^#l `#| oa# b# @d# d# e# o f# wg# h# i# ;i# %$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# vJ!# hw# y# y# jz0# {# }# }# ~# ~# # .# 0# # # # Q# U#$D!(tDR ^# # O# # h# r# # # B%#,acl#0 #8 #@ #H >#P >%#Xsrv#d e #h ? #l h P&#p K# Z # ̟# # Ο# 0# П# gџ# [# ӟ# R ԟ# # ֟# ן# ب# G # Rڟ# 7۟# .c(# # /ޟ# # 'Q'#id# +# # t# 4 # # 0# i0# 0# 0# # 0# +# 0# # # # $0# 0# `0# # z# # # # # 8# #0#j0# ##### ##) # #Q # #cap #p #?##o#D!#m x$#u x$#J##### # #g##B#p ###Z#(#](# # !#O"#q#(# #(#$#w %#&#'(#= (#)# *0# +0#F, %#:, %#HY!; / / # /! #srv/"# 8"D. .# .# .# /.# .# .#  .#$ q&.[#( } .[#, .[#0 .#4 Q.#<".px.D!#sv.# .ɍ# D.ɍ# ?.0# iid.˟# J.˟#sid.˟#" . ".3#"#.iid.џ#px.D!#buf.0#sid.0# ptr.՟#bol.֟#L#.!(.8"!.ϯ"!." \# P!n# b## v t#GI"#acl(*(+#4(,#C(-#  (.#(/0##P$C(>(?#g(@#pol(A#(B0#{.(C#x$p7!k?4Dun5 in6$p2u7P$# %x , Y#t0Y#t1Y# 9J!# J!# # D#$ #(% #len0#pos0# sid0#srv#oeD!#src}#buf #%beD!!4%  !0# .#& srv&# # #+&Xact$#bck$#,P&actY#bckY#?' # Q # # # # # 8 # #map%# &#, V+&# T K'# 7K'# 9K'# /K'# K'#K'?''  # 3# _9# R;# T@# *# \# !#c( .( 7(# &)# *# +# ++# 6,# ?-# -.*# /$+# 0c(#$'(!  !(# 4!# Z!#len! # \!!# E!"#i( (  ( #)5$3D!$44M)@/0#E1M)#be5(# #)P 89#E:M)#*x(=>#E?M)#J@# A#%B#.C#?D0#E# F#$J* &$ &%#kw&&# &-s*#s*D!D!J**&5 &6#kw&7*# ** *   *# # #*$+  $+# # G#*k+4S C4O# 4P# h4Q# 4R# , 4;uid4<#gid4=# 4># $4?# ,4@#  4A# !4B# a4C# 4D# |4E#$ 4F#( <4G#, 4H#0 4I#4 +4I#8 J4J#< 4J#@ 4K#D 4K#H 4L#L  4L#P m 4Mx$#T u 4Mx$# 4S*+# 4Td# Y4U#.-!U 4V#valW0#capX0# 'Y0# %.!^U&str~'3^V(l^P(cP)~)qS);~)#S(endW*I \+.(ss}~,-Md-__sf....//0//$//0//P1U[(__v>P+.-__sf2((heI/P3/n4m3I/ -4+4x+4,5/ VU6(D!V7capQ66{.7arg68msg S0///9043:(2D!5Z0c  `U6(D!P6 6{.7arg50"-U6(,D!P6, 6{.,7arg,5 1 :U6(9D!P69 6{.97arg95b1&"G QU6(FD!P6F 6{.F7argF51T`U6(SD!P6S 6{.S7argS52_U6(^D!6^W6{.^V7arg^S5f2S"h U6(gD!6gW6{.gV7arggS52 pU6(oD!6oW6{.oV7argoS5<: U66: U+{:X?__sf0:T/:@:9:(8D!5d U6 6^v=&q%=q%1^v=q;qP+>;VrD!R0.//0//$//0//Z|=&i%=i%1Z|=i;iP,>=&%=%+)?8iV8lenS8dS,O?&=&%=%,u?<I=&j%=j%,?=&%=%,?=&%=%+@8;}8set0}+@`8uP,J@Ce=&%=%1Ce=;P,@m=&%=%1m=;P1=&%=%,A*=&%=%1*=;P,'A =&%=%,MA =&Q%=Q%,A(:;RS.Ad/d0//$//0//>=&%=%,P>>=&%=%,P@@=& %= %,Qb@o@=& %= %,;QXAeA=& %= %,aQmAzA=& %= %+Q; };  P; ! W;]!" };!# },RJBlB=& %= %1JBlB= ; P+qR; x$~;  S,NRBB=& %= %2; V; W.R.!E#E//0/!E#E/$//0//P,]tt=&r %=r %1tt=r ;r P+D^ ;Vs P0.u#u//0/u#u/$//0//,^vv?__v >,^ww=& %= %,^!w4w=& %= %,_En=-ret?5gN ŒU6;J!go8fgm; S+ri ;VD!S+i 8expS2;VD!V.i/ux//.i///.i///.i/am//.j///0/(//,?j= .Vj/8G//.mj/Ӗ//.j///.j/z//.j/IR//.j/y//0///HkU7kwlB:PH=kz :U7kwlB:P20=\-I[*gIJ *gIB,Kdkjk >I,L|kk I,M|kI.vkIw kJ I2QkI  K(ID!KJL̮LI3;0Mnow3<I 4Xk+Ih4]I4^  pl I 5}l `lIB5I5I 6Q0I6R0I 6U0I 6VI6Wl l ~L{!;m l mm  ,)]0m m Emm ) yVm  5m))3!)n!y*Юf%J!WҚ@0"y& 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0o BT G QqFez DE#F#k 2L40 YpG {o  b #$[L ##  =R#J#t=# M w  # ۆ#n ܜ#" # E 9 -@5 - ?># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 e>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#`  # #B >#M  F  3   b #  9    #  #  # bit >#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H 0wq 1D#rq 2D# 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#y9~0#?0# -0#$4#(  )8J K0#* L0#{M#fdN># ?O0#expP0#5Q# 6R#p5S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U?}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P!3 #T9 #X_ 0tstru#lenv>#p p 0 v ' p z m#L m# L# ! #fe #be # ># ? >#$Z 0#(D #,req 0 #0rep 0 #4si #8 #% # M#srv V#p V#Q V#> #txn # ># # #2 ## Å# ą#, ؎ # 0#_ !- J ]s Tn  #!s # k auid^&#gid_#`# buxa  !LfdM># N>#hO>#k?P#  Q #R>#$S># T0#U #Vm#*W #AXR#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$J5t #(a6u #,v#0w#4{x#8@y#<hzm#@e{>#H|m#L   >> > >  ,CfA #bB0 #.(?cbC#{D# EE#evFE# G#H#I>#  J#$    Jy9>#get>#put>#u># #i) D##>#^# m#:X a^#_%#k`%#aze+,#-#.>#/e#   7P #I#CCi75#8len#90#cr#:0##;0#b #Cv#D#y9#E##F#.*#G#3#H# O*"    D ""l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"5st"D"P "0#sol"#eol"#som"0# col"0#sov"0#eoh"0#cap"ۦ#sl"#  "e#8 ">#@J"3"*#b"# "6 #req"#rsp"#\uri"# "#"#I">#?"0#F &0#f 0#0# p VT@IJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xm#@!YL#Hk?[M#Lp\M#\?^M#l`>#|oa# b#@dV#dV#e#o fM#wg#h>#i>#;i>#%$j># j>#Rj>#k>#l>#Fm>#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#M#B8"#,aclm#0m#8m#@m#H>m#P>V"#XsrvV#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7># .~$##/>#m#'##id#+#m#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p M# ?M# ># o# # m &!# u &!# J~# ~# ># ># >#  ># ># g># ># B># p # # ># Z># $# ]$#  t# !t# O"t# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H\; !! m#!!p #srv!"V# D  ># <# <# / <# 7# 7#  7#$q& ^#(} ^#, ^#0 w#4Q w#<  px ǰ#sv V# Ʌ#D Ʌ# ? 0# iid >#J >#sid >#2 " Θ#  iid >#px Ұ#buf 0#sid 0# ptr >#bol >#  !( ̤!  ! 2   p   p  I&!p7!k?4un5J in6M?!p2u7 #!x ,#t0#t1#9##># D>#$ >#(8"<#len0#pos0# sid0#srvV#oe#src#buf9 #V"be!4{" !0#.m#" srv"# ># >#V"Xact?!#bck?!#,"act#bck##>#Q ># >#># >#>#8 ># V#map{"# "#,V"#T ##7##9##/#####V#x$ >#3>#_9>#R;># T@>#*>#\>#!># .x$! $ $ $6 "$r">@zU#sVQ"$">ҚU#sVR$[ %$J  %$.v+%,$w> O%% $$Q>%&now%<<4-#/\0A$y& "07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez %D%E#%F#9 *-p5 *- ?+~# !+ # + # b + # +# +# A+# +# z+# +#$ +#( + +#, M+R#0 0+X#4 .+~#8 e+~#< +#@ +">#D +#p#F H+$^#G b+(n#H +1#L +7#T d+8#X +:~#\ "+<t#`   +R ++R# +X#B +~#p n   3[ >   # #    R #J #t #  wFy 6  7~# w 8~#2>40YFG Qo bg#ڏ#\#n r#" # 7  b#  e  # # # bit~#u32"0*+#key,e#n#p#" - #ref!#h H0wq1p#rq2p# 3~#04~#450#86~#< 7#@8~#Dxxxh]4#w #x##y##z0#  #{0#'#|0#r#}0#y9#~0#?#0# -#0#$4##( - )8'J 'K0#* 'L0#{'M#fd'N~# ?'O0#exp'P0#5'Q # 6'R #p5'S # 6'T #$ib'U\ #(ob'U\ #,x 'V0#0'W#4-\ # 'U?$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#,$0#0 $0#4H$~#8)$S #< $7#@$7#A$W#D<$#L $#P!$_ #T$e #X 0$tstr$u#len$v~#  \  S p $z&#L&# &x# !& #fe&#be&#&~# ?&~#$Z &0#(D&#,req&\ #0rep&\ #4si&'#8 &#%&#&#srv&p"#p&p"#Q &p"#> &'#txn&# &~#&%#&'#2&'## &w#&w#,&؈'#&0# !Y v ] Tn  #! # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#k? P#  Q # R~#$ S~#  T0# U # V#* W#A X~#' Y #` Z# [0# b #) c# T Q4 m# n~#S o~# p~# q# r#  s~#$J5 t#(a6 u#, v1#0 w1#4{ x1#8@ y1#<h z#@e {~#H |#L  ~~ ~ ! 1~ !XCfA#bB\ #.(?cbC#{D# E7#evF7# G#H#I~#  J<#$ 7 < Jy9~#get~#put~#u~# d#!Y<_``#@a;#setb;#clrc;# Ad;#@e;#remfM#clogM#_5hj# 9i#$Bj#([%k#,Hl#04m#4n~#86~6~ ~!M6Add~BS~dpdp7k?4un5v in6p2u7#.SC.O~#.P~#h.Q~# .R~#  .;uid.<~#gid.=~#.>~#$.?~# ,.@~# .A~#!.B~#a.C~#.D~# |.E~#$ .F~#(<.G#,.H#0.I#4+.I#8J.J~#<.J~#@.K~#D.K~#H.L~#L .L~#Pm .M#Tu .M#.S# .T #Y.U~#5)8len)90#cr):0#);0#(b )Cv)D(#y9)Ew#)Fw#.*)Gw#3)Hw# s(           D (.(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#,(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#I(rq(~st(D(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(#sl(,#  (W#8 (~#@(3(s#b(# (b #req(I#rsp(I#\uri(# (#(#I(~#?(0#) D##~#P# #:* !a!^#!_%#k!`%#!aze + ,z# -# .~# /# 5 *P ##I-(tD # r#O r# ~# h ~#r ~# ~# #B u##,acl #0 #8 #@ #H> #P> ##Xsrv p"#de ~#h? ~#lh ;$#pK #Z # ~# # ~# 0# ~#g ~#[ # ~#R ~# # ~# ~# ؋#G #R ~#7 ~# . ܻ%# #/ ~# ߙ#' <%#id #+ # #t ~#4 ~# ~# 0#i 0# 0# 0# -# 0#+ -# 0# i# i# i#$ 0# 0#` 0# r#z r# r# r# # ~#8 # ~# 0# j 0# 1#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p # ? #  ~# o #  # m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p z#  z#  ~# Z ~#  %# ] %#  #  !# O "# q #%# #%#  $~# w %#  &~#  '%# = (~#  )~#  *0# +0# F ,"# : ,"#HdF &0#f 0#0# sF!;  #! #srv"p"# p"T@"Jp"# K~#* L~#M~# N~# O#B P#(R#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Yx#Hk?[#Lp\#\?^#l`~#|oa# b<#@dp"#dp"#e#o f#wgw#h~#i~#;i~#%$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gup# vv"#hwp"#yi#yi#jz0# {1#}i#}i#~i#~i#i#.-# 0#i# i#i#Qi#U~#"x ,  #t0 #t1 #9 v"# v"# ~# D ~#$  ~#(u#  <#len 0#pos 0# sid 0#srv p"#oe #src #buf e ## be 4 # ! 0#. ## srv ## ~# ~#p"$X act |"#bck |"#,;$ act #bck #*%  ~#Q ~# ~# ~#  ~# ~#8 ~# p"#map ##  ##,V $#T 6%#7 6%#9 6%#/ 6%# 6%#6%p"*%%  ~#3 ~#_9 ~#R; ~# T@ ~#* ~#\ ~#! ~# .%! % % %b &D& &~#&<# &<# /&<#&#&#  &#$q&&P#(} &P#,&P#0&i#4Q&i#<'&px&#sv&p"#&w#D&w# ?&0# iid&~#J&~#sid&~#,' &"&#'&iid&~#px&#buf&0#sid&0# ptr&~#bol&~#'&(&̞&&'&,' '- s' '' '">(8#2JU#be1S$*(>(%O(&>(#0%O('[(43((2)(#>~PܛU#s=p"P*pc?'R+"?'V+"?'W+]#@~p,H+C S&(-(S%(')hx.tgx.fg0))#[~mU#sZp"V+]#\~W,p/b 0pc'$j))-)P&()/-(S%(')#;'.px;)) " *$vp%U#sup"V*srvwp"S*msgxb h+]#y~W,+#|~d"U*"0fU#sp"V*srvp"S*msgb h+]#~W"*e#pU#sp"S*srvp"S*msgb h+]#~W1*#U2sp"S3srv!p"S3msg"b h4]##~W5,1$~U2fd~W6#.6#J6/# 6"3txV3sp"S$z+(.J%(%(7+3ret~P4w Q4~89T#~8:__v0$",,%%,-,,;,P;,P;,;,7Q,3sa8fq:__v>&,צߦ%,% -&-צߦ-&-P%1-<,"H~=sGp"># G9#I~9+$J~9Y>K~9"L, , '-Z$W~.nowV~('V~'=-y#L~.nowK~('K~5-#~U2fd~6#@I3len~R3txh3sp"d&(kq%(%(?1"Ox6U2tNx4#P~3sQp"W3saRX3fdS~V3rvT~V6w$٩$L.1,-1P-1R$h.1AY%1%1$.1-1Q-1$.1)%1-1P$.-)8-&-P%1-$.--&-S-1-P$/1׭%1-1P$"/-׭-&-P%1-$@/1I]%1-1V7/9N$'~$s/-]o-&-S%1-$/-o~-&-P%1-&1% 2%2@/,7:__v>70 4i$23ret~4?~8̰4#~3srcH$O0%2-%628-;A2@k0MQ3__v>P&1ṵ-1Q-170@4i$2S3ret~P4?~&>(k}-O(P$0M2%Z2$ 1--&-P-1-P@]1R9N$~$D1-Ra-&-S%1-&1aw% 2%2$v1>(-O(P$11̳%1%1&-̳۳-&-P%1-'1k~(j~.nowj~A1`/(q.<(#.~'2I#u~.t1t~.t2t~'M2#~(q<0ret~Ae2"T.fdS~BK3#~@U3pxp3sp"S:tx4T$~l4"$~h4p$~d$3K38C\3,XC\373x;f3V&s3$+%3$73-8;-&-W-1-P&3%3's3"x0txD0__p'37x.txA3T( xE[*3eEJ *3E qBE.v3XEw~ 4F E,Q3E-;0Gnow-<<E-=<E .XE.^e Gone.`6E.am4 H( IE Q0ER0E U0E VEW4p(&f0$y& 07inti  "02-y &wk 60 >Sm ?SR AS3 C7 Dl7ro S7 U7H  0oBTGQqFez DE#F#  n # p #e" - e# ref !#R]4w xR#ye#z0#  {0#'|0#r}0#y9~0#?0# -0#$4X#( h n 2L40YsG ~o b#$[ L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 %-C5 %- ?&># !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&#0 0&#4 .&>#8 e&>#< &#@ &"L#D &#~#F H&$#G b&(#H &1#L &7#T d&8#X &:>#\ "&<#`& &&# &#B &>#J  C  3 b#  6  # # # bit>#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8"J "K0#* "L0#{"M# fd"N># ?"O0# exp"P0#5"Q# 6"R#p5"S# 6"T#$ ib"U0 #( ob"U0 #,x "V0#0"W#40 # "U?}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P!3 #T9 #X_ 0t stru# lenv>#p p 0 v ' p z!e#L!e# !# !! # fe!# be!#!># ?!>#$Z !0#(D!#, req!0 #0 rep!0 #4 si! #8 ! #%! #!P# srv!V#p!V#Q !V#> ! # txn!# !>#!#! #2! ## !Å#!ą#,!؎ #!0#_ !- J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#k?P #  Q #R>#$S># T0#U #Ve#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$J5t #(a6u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    Jy9># get># put>#u># #i) D##>#^# e#: a^#_%#k`%#aze+,#-#.>#/h#   7P #I#CCi75$8len$90#cr$:0#$;0#b $C v$D#y9$E#$F#.*$G#3$H# O*#    D ## l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#5st#D#P #0# sol## eol## som#0# col#0# sov#0# eoh#0# cap#ۦ# sl##  #e#8 #>#@J#3#*#b## #6 # req## rsp##\ uri## ####I#>#?#0#F &0#f 0#0# s VT@IJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#Hk?[P#Lp\P#\?^P#l`>#|oa# b#@dV#dV#e#o fP#wg#h>#i>#;i>#%$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B8"#, acle#0e#8e#@e#H>e#P>V"#X srvV#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7># .~$##/>#e#'## id#+#e#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p P# ?P# ># o# # m &!# u &!# J~# ~# ># ># >#  ># ># g># ># B># p # # ># Z># $# ]$#  t# !t# O"t# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H\;   e# !p # srv "V# D! !>#!<# !<# /!<#!7#!7#  !7#$q&!^#(} !^#,!^#0!w#4Q!w#< ! px!ǰ# sv!V#!Ʌ#D!Ʌ# ?!0# iid!>#J!># sid!>#2 !"!ΐ# ! iid!># px!Ұ# buf!0# sid!0# ptr!># bol!># !!(!̤!! !!2   p   p  I&!p7!k?4un5J in6P?!p2 u7 #!x ,# t0# t1#9##># D>#$ >#(8"<# len0# pos0# sid0# srvV# oe# src # buf9 #V"be!4{" !0#.e#"  srv"# ># >#V"X act?!# bck?!#," act# bck##>#Q ># >#># >#>#8 ># V# map{"# "#,V"#T ##7##9##/#####V#x$ >#3>#_9>#R;># T@>#*>#\>#!># .x$! $ $ $6 "$$'0@U#s&$S$max(0V%&+$60$ '$>@hU(R%$pU#p Q%v&\"%$ap ׸U#srv`VV#px`W$psb Q)ppb *cp S+%%,&+%& ,"&-8&/e.I&p.T&l/&$1 0s1$/-&#; 0px;-&3& \/`&>0tv1`&0tv2`&f& <(&$C?U#sBVV$pDp*$E>W%2*Mp P-&2.&S,&/&h0tg0fg0"A'$ @U1p S)p 2$__pQ3[%N'3J %N'3.vn',3w> '4 3'Q'5now<<65 tP0 3 Q03R03 U03 Vt3W'A6)l" 0f%y& #07i "02-y&ikint60>Em?ERAE3CD^7roS UH 0oBTGQqFez %D%E#%F#9 +-p5 +- ?,~# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,j#0 0,p#4 .,~#8 e,~#< ,#@ ,">#D ,#p#F H,$v#G b,(#H ,1#L ,7#T d,8#X ,:~#\ ",<#`    ,  ,j ,,j# ,p#B ,~#3p,3$[> ## "R#J#t"#2w^y6 7~# w8~#2>40Y^G io b#ڧ#t#n ܊#" #7 b#--}  # -# -# bit~#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5]4$w $x#$y#$z0#  ${0#'$|0#r$}0#y9$~0#?$0# -$0#$4$5#(E )8&J &K0#* &L0#{&M#fd&N~# ?&O0#exp&P0#5&Q%# 6&R%#p5&S%# 6&T%#$ib&Ut #(ob&Ut #,x &V0#0&W#4  Et # &U? }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H ~#8) k #< 7#@ 7#A W#D< #L #P! w #T } #X+ 0 tstr u#len v~#  t  k p  z #L # # ! #fe J"#be J"# ~# ? ~#$Z 0#(D #,req t #0rep t #4si R$#8 #% # #srv #p #Q #> b$#txn }# ~# "# t$#2 ‹$## w# w#, ($# 0# !q  ] Tn  # ! # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#k?P#  Q#R~#$S~# T0#U#V#*W#AX#'Y##`Z# [0#b #)c# TQ4m)#n~#So~#p~# q# r# s~#$J5t#(a6u#,vI#0wI#4{xI#8@yI#<hz#@e{~#H|#L  ~ ~ ~9I~ 9pCfA#bBt #.(?cbC#{D# E7#evF7# G#H#I~#  JT#$OT Jy9~#get~#put~#u~# #9Y<_``#@aS#setbS#clrcS# AdS#@eS#remfe#cloge#_5h# 9i#$Bj#([%k#,Hl#04m#4n~#8N~ N ~ ~9 e NY | | ~Zk~ |  |p7k?4un5 in6p2u7#2-SC-O~#-P~#h-Q~# -R~#  -;uid-<~#gid-=~#->~#$-?~# ,-@~# -A~#!-B~#a-C~#-D~# |-E~#$ -F~#(<-G#,-H#0-I#4+-I#8J-J~#<-J~#@-K~#D-K~#H-L~#L -L~#Pm -M#Tu -M#-S# -T #Y-U~#) D##~#P# #:G "a"^#"_%#k"`%#"ae!+!,#!-#!.~#!/# R GP ##   F &0#f 0#0#_5)8len)90#cr):0#);0#b )Cv)D#y9)Ew#)Fw#.*)Gw#3)Hw#  (           D (¶](l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(]wD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(w#sl(#  (W#8 (~#@(3(#b(_# (z #req(#rsp(#\uri(# (#(#I(~#?(0#*^!T@IJ# K~#* L~#M~# N~# O#B P#(RJ"#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Y#Hk?[#Lp\#\?^#l`~#|oa# bT#@d#d#e#o f#wgw#h~#i~#;i~#%$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vP"#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#*J"(tDR# #O# ~# h~#r~#~##B%#,acl#0#8#@#H>#P>%#Xsrv#de ~#h? ~#lh P&#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#ب#G #R~#7~# .'##/~#߱#'Q'#id#+##t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p # ?# ~# o# J"# m # u # Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p # # ~# Z~# '# ]'#  # !# O"# q#'# #'# $~# w %# &~# ''# = (~# )~# *0# +0# F, %# :, %#H"; '' #'! #srv'"# >#D  ~# <# <# / <# # #  #$q& P#(} P#, P#0 i#4Q i#<# px J"#sv # w#D w# ? 0# iid ~#J ~#sid ~## " #($ iid ~#px J"#buf 0#sid 0# ptr ~#bol ~#R$ ( ># ϵ# #b$EV" t$ h$ $ z$ %x ,#t0#t1#9P"#P"#~# D~#$ ~#(%<#len0#pos0# sid0#srv#oeJ"#src#buf} #%beJ"4% !0#.#& srv&# ~# ~#+&Xact$#bck$#,P&act#bck#?'~#Q ~# ~#~# ~#~#8 ~# #map%# &#,V+&#T K'#7K'#9K'#/K'#K'# K' ?'' ~#3~#_9~#R;~# T@~#*~#\~#!~# .'! '' (z `(%*dow*~#h1*~#m1*~#h2*~ #m2*~#(*min*i#max*i#%*~#s%*~#(*k?*ϊ#`*Њ#(*i*~q*`(%*ѧ(%*())*ptr*str*reg*))G)%,**Ʊ#val*(#ptr*(#%*# len*~#$?*~#() *p*i*~ll*id*)a*)I)/*W%0*i*~#ptr*#len*~#?*~# ctx*)#*%*kw*# **# %*I+# B*d+# *0# &* ~#*~  * #/)**~ J"  ~ * C+*C+eB* *!#kw*"+#arg*%+# <&*&~# {%*'#)*d+~ C+ *O++D&* *#kw*+#+/*!"+*%#str*$/*$,%/ U%s. S&Z0p',),(#,)-,V)7,W*C,&.~+fd.~+sa.C,,`%.I,-S1*@~7U%fd@~.lA}.pBJ"W/sC .txnDS1}/tE.cfdF~}&&G~}0o&0@%0a&0%0y&0%0&m0&W1E/&k?P~&Q%Q}1l-.__pnV2-Y1л3j143j11-5t1}'1ɻϻ(12-1(12-1(12.1)1R(11(.(6pnJ2~6snJ2}1o.H6len\~P7!6pnl2}7;F8__vs>1.`6__pyR2.2(22.)2CJ(621.x6__pR2.2(22.B2(O22/Z2(k2(t2'~2;(2'1>D)1S(19x/@p6pnb)~7Zp8__vi>1/6__pQ9/ 8__s1/6__p"Q9/Yi8__s%1/6__p+Q202)2P7329:086msgz }9X0>6msgz }9s0.maxJ~P908__vU>108__vT>106pn:)~6sn:)~908__vE>4(8__vD>212(29(1 :\2?12(2'2(2}*1"/t;/__p*17+t<1P&F+feEJ"*1x1+tvx1<<1%1+ctr01+inc002-<)2%/+buf.t pxJ">l4 R>l7>dir~?C*?[%C+Q=4& ~U>pxJ">l4 P>l7>dir~?C*?[%C+R938__v >78__v >=s4"%~lU>pxJ">l4 S>l7>dir~?C*?[%C+V=50%)~pU>px'J">l4' S>l7'>dir'~?C(*?[%(C+V948__v0>78__v.>=5&:~ U>px8J">l48 P>l78>dir8~?C9*?[%9C+P@&P"UA[+5eAJ +5A qZA.v5pAw~A x~A -\~6BA.Q5A;0Cnow<<A=<A -X2A-^} Cone-`NA-ax6 2A $Aj /A, /A Q0AR0A U0A VAW6D%Aj+خ3- u00(y& 07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez  D E# F# [ > p##  Rp#J#t#  w 2>40YG Mo b'#p##n 2#" # 7 9 !-@5 !- ?"~# !" # " # b " # "# "# A"# "# z"# "#$ "#( + "#, M"#0 0"#4 ."~#8 e"~#< "#@ "">#D "#p#F H"$#G b"(#H "1#L "7#T d"8#X ":~#\ ""<#` " ""# "#B "~#M  F  3 b#  9  # # # bit~#u32"0m*+#key,9# n #p #m" - m#ref !#< H 0wq 1D#rq 2D# 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#y9~0#?0# -0#$4#(  )8#J #K0#* #L0#{#M#fd#N~# ?#O0#exp#P0#5#Q# 6#R#p5#S# 6#T#$ib#U0 #(ob#U0 #,x #V0#0#W#40 # #U?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P!3 #T9 #X_ 0tstru#lenv~#p p 0 v ' p z$m#L$m# $L# !$ #fe$ #be$ #$~# ?$~#$Z $0#(D$#,req$0 #0rep$0 #4si$"#8 $#%$#$M#srv$#p$#Q $#> $"#txn$# $~#$I #$0"#2$G"## $w#$w#,$!#$0#_ !- J ]s Tn  p#!s # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#k?P#  Q #R~#$S~# T0#U #Vm#*W #AXR#'Y #`Z# [0#b #)c# TQ4m #n~#So~#p~# qp# re# s~#$J5t #(a6u #,v#0w#4{x#8@y#<hzm#@e{~#H|m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#He#I~#  J#$   { Jy9~#get~#put~#u~# #Y<_``#@a#setb#clrc# Ad#@e#remf!#clog!#_5h># 9iT#$Bjf#([%kT#,HlT#04m#4n~#8 ~ ~ ~! 88~'T~8Df8Z) D##~#P# m#:lX a^#_%#k`%#aSe+,S#-Y#.~#/# _ P ##5'8len'90#cr':0#';0#5b 'Cv'D5#y9'Ew#'Fw#.*'Gw#3'Hw# &    D &;&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#9&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#V&rq&st&D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&#sl&9#  &W#8 &~#@&3&#b&# &6 #req&V#rsp&V#\uri&# &#&#I&~#?&0#F &0#f 0#0#  T@IJ# K~#* L~#M~# N~# O#B P#(R #S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#Hk?[M#Lp\M#\?^M#l`~#|oa# b#@d#d#e#o fM#wgw#h~#i~#;i~#%$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v #hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~# (tDR # 2#O2# ~# h~#r~#~#M#B##,aclm#0m#8m#@m#H>m#P>##Xsrv#de ~#h? ~#lh T$#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#d#G #R~#7~# .%##/~#m#'U%#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#2#z2#2#2## ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p M# ?M# ~# o#  # m |"# u |"# Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p S# S# ~# Z~# %# ]%#  # !# O"# q#%# #%# $~# w %# &~# '%# = (~# )~# *0# +0# F,## :,##HI ; %% m#%!p #srv%"#  D$ $~#$<# $<# /$<#$#$#  $#$q&$P#(} $P#,$P#0$i#4Q$i#<q!$px$ #sv$Ȭ#$w#D$w# ?$0# iid$~#J$~#sid$~#! $"$Θ#!$iid$~#px$ #buf$0#sid$0# ptr$~#bol$~#"$!($ !$q!!$׈! "  0"p $"G"p 6"I|"p7!k?4{un5J in6M"p2u7T"##x ,#t0#t1#9 # #~# D~#$ ~#(#<#len0#pos0# sid0#srv#oe #src#buf9 ##be !4# !0#.m#$ srv$# ~# ~#/$Xact"#bck"#,T$act#bck#C%~#Q ~# ~#~# ~#~#8 ~# #map##  $#,V/$#T O%#7O%#9O%#/O%#O%#O%C%% ~#3~#_9~#R;~# T@~#*~#\~#!~# .%! % % &6 <& +$+%~#kw+&# +-e&#e&~~  ~<&&+5+6m#kw+7&# && &(SC(O~#(P~#h(Q~# (R~# a( (;uid(<~#gid(=~#(>~#$(?~# ,(@~# (A~#!(B~#a(C~#(D~# |(E~#$ (F~#(<(G#,(H#0(I#4+(I#8J(J~#<(J~#@(K~#D(K~#H(L~#L (L~#Pm (M|"#Tu (M|"#(S&# (T #Y(U~#"(-'20gU#cap1~R"('BpU$B~R%=+'Y~U$ ?W$W~ $(W $'X #errX$ X~&'Z0p&[~l'cap[~W'res\P&4\S'tv] h'td^ V()@)&c%)c%*))&g%)g%*))&g%)g%+)=+TZ,N+* *)&l%)l%*D*)&p%)p%*h*Ta)&t%)t%**eq)&t%)t%**u)&y%)y%**)&y%)y%**)&~%)~%*+(5)&%)%-9G)&%)%.Z+43/(2 %,'~U$ ?S$~ $( $' #err$ ~&~l0cap~'resp)4'tv,W0td,'val0V(<,`)&%)%*`,)&%)%+,,!1,,1,P,,2=+,N+03,'3P414x142~"-' U$4$~ #cap~W&x S&V p*X-Xm)&%)%+o-=+,N+2=+,N+5-' dU647cap~V8x S8V W-,A9&%9%5r.'(pU7px(r.W64( 8.(*S8V*V-9&0%90%x. 5./]'H~U6xG S+.=+P\,N++.=+,N++.=+,N++/=+,N++/=+,N+2=+SY,N+5/;'r~+U6I'q~8xs V8 !t S8&u~W:erru~~8'v~~:msgw/~+/=+,N+2=+ ,N+ / c;/0 0U:p S2/01@0P1K0P.W0y#L~__v>-]g>__v>?v'pU@[!2@J !2@ q@.v3,@w~@ (\~ N3A @)Q=3B(( 4 B)~p@*;0Cnow*<<@ (X&Bh'~T0 @(b~8'k&ty80o}0w*y& 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz "D"E#"F#9 (-{5 (- ?)# !) # ) # b ) # )# )# A)# )# z)# )#$ )#( + )#, M)]#0 0)c#4 .)#8 e)#< )#@ )">#D )#p#F H)$i#G b)(y#H )1#L )7#T d)8#X ):#\ ")<#`  )] ))]# )c#B )#&{ y   3 $[ >   # #   R #J #t # % wNTn  #!N# ^ k2>40Y^G io b#ښ#t#n ܊#" # 7  b# -- }  # -# -# bit#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D5]4!w !x#!y#!z0#  !{0#'!|0#r!}0#y9!~0#?!0# -!0#$4!5#( E )8#J #K0#* #L0#{#M#fd#N# ?#O0#exp#P0#5#Q%# 6#R%#p5#S%# 6#T%#$ib#Ut #(ob#Ut #,x #V0#0#W#4Et # #U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)k #< 7#@7#AW#D<#L #P!w #T} #X+ 0tstru#lenv#  t  k p z#L# # ! #fe"#be"## ?#$Z 0#(D#,reqt #0rept #4si$#8 #%##srv#p#Q #> )$#txnD# #T"#;$#2R$## w#w#,##0# !q ] auid^1#gid_#`&# buxa  !LfdM# N#hO#k?P#  Q #R#$S# T0#U #V#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n#So#p# q# r# s#$J5t #(a6u #,v#0w#4{x#8@y#<hz#@e{#H|#L       7CfA #bBt #.(?cbC#{D# E7#evF7# G#H#I#  J#$   Jy9#get#put#u# #Y<_``#@a#setb#clrc# Ad#@e#remf,#clog,#_5hI# 9i_#$Bjq#([%k_#,Hl_#04m#4n#8 , CC!2_COqCep7k?4un5%in6p2u7w#*SC*O#*P#h*Q# *R# w *;uid*<#gid*=#*>#$*?# ,*@# *A#!*B#a*C#*D# |*E#$ *F#(<*G#,*H#0*I#4+*I#8J*J#<*J#@*K#D*K#H*L#L *L#Pm *M#Tu *M#*S# *T #Y*U#) D###P# #:w a^#_%#k`%#a^e+,^#-d#.#/# j P ##F &0#f 0#0#&5&8len&90#cr&:0#&;0#wb &Cv&Dw#y9&Ew#&Fw#.*&Gw#3&Hw# %           D %}$%l%މ#m_l%߉#u%#u_l%# v%#v_l%#{%l%#v_l%#c%#c_l%# r%#r_l%#%rq%st%$>D%P %0#sol%#eol%#som%0# col%0#sov%0#eoh%0#cap%>#sl%{#  %W#8 %#@%3%#b%&# %z #req%#rsp%#\uri%# %#%#I%#?%0# ^!T@IJ# K#* L#M# N# O#B P#(R"#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#Hk?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v"#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#"(tDR # #O# # h#r###BQ%#,acl#0#8#@#H>#P>o%#Xsrv#de #h? #lh &#pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉#o#G #Rډ#7ۉ# .ܗ'##/މ#߱#''#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# "# m # u # Jp# p# # # #  # # g# # B# p ^# ^# # Z# '# ]'#  # !# O"# q#'# #'# $# w %# &# ''# = (# )# *0# +0# F,$# :,$#HT"; $$ #$! #srv$"# #D #G# G# /G###  #$q&P#(} P#,P#0i#4Qi#<|#px"#svȷ#w#Dw# ?0# iidˉ#Jˉ#sidˉ## "##iidщ#px"#buf0#sid0# ptrՉ#bol։#$(#|#ד# )$E ";$ /$R$ A$$x ,#t0#t1#9"#"## D#$ #(Q%G#len0#pos0# sid0#srv#oe"#src#buf} #o%be"4% !0#.#% srv%# # #%XactX$#bckX$#,&act#bck#'#Q # ## ##8 # #map%# %#,V%#T '#7'#9'#/'#'#''' #3#_9#R;# T@#*#\#!# .'! ' ' 'z I"'J)5U# !4 Q$(+)LDU# K R% !M S&errN'(F())*)+(')N,8)V,C),N),Y))-d)_-o)-z)-)P-)W.).)s.)\.)') #()/')@*0 ! 1fd2)(k31j4uidj14gidj3j&5")l)5r)m)5k?n%6retp5 p7?)7*7\*7( )8)"T4fdS$`*\)^PXU# ] P% !_ S'`*0(r*'*,*~)-*~-*V-*P/**$0 !# 8*(315k?%5 ݉6ret݉9,*s`2U:fds&lt ~1su 1tv&cfdw~%&x~;o&9;@%6;a&4;(2{<,%k?~%Q%~<+ &__pS++,'-*,)8*,)h-,W++,(-<+&__sP< ,&__sP<$,&__pR+;, -(--+,H-(U-=>\72,"6t?6__p2 -74t8$-%/4buf.t 2H-h4tg4fg08_-4tǐ9/)C@U:sB #{.BQ% ?D/&argEW@->&^%>^%@.>&_%>_%+#./(/,/P(/+F./>A(/,/P(/@l.Xe>&l%>l%@.mz>&r%>r%@.>&v%>v%+./((/'0((0("0(.0+ //4C(/'04C(0("0(.0+T//O^(/'0O^(0("0(.0+w//(/,/P(/'/(/'0(0("0(.0 / 8/)4s 4bt 3)k A0Ki0hA;0 -0+0x+>0,9 1(U:s S:reqt V%{.W1p+0 1Sf,1R,%1Q+011,>1P@0&__sW+0J1(W1'11(>1211k3j4nowj8J1(4buft 8c1)4buft 9^5{)pU:t&s p%#*l%S*0h%**0W;)uv;)x;?(<2>?0'^5(k5@A2%?0R'^5(k5+X2w5(5+25V(5(5+25 ,5R,5V'5 @,5R,5V+25cv(5,5S+25(5(5+35(5,5V)(-5R+,3w5(5+W35*(5,5V)H-5R@q3>?0+35(5+311(>1+311GS(>1+35^h(5+35(6'6(*6+!446(E6'O6(\6+`4n6+(6'6+(6'O6,\6P+w4H-+R(U-+46(6+4 1,1P,%1Q+4 1 #,1P,%1Q+4 1+B,1P,%1Q'6B(6+ 5 1Of,1P,%1V+@5 1k,1P,%1V' 1,1P,%1V8w5&4buft 853*u4buftt 25I#u4t1t4t2t85`(c4bufbt 3@b055(d085O(4buft 26"4t246 ~4t}2O6 v4tu8h6]3\h6264t264t86o(M4bLt B)pUCB'K66 >C'L66 ~C'M6C[(7pCJ (7C q!C.vE77CwC xC *\ 7D C+Qr7C,;0Enow,Em?ERAE3CD^7roS UH 0oBTGQqF{z )D)E#)F#[37 3J3G# { .A3J9 /-V5 /- ?0# !0 # 0 # b 0 # 0# 0# A0# 0# z0# 0#$ 0#( + 0#, M0#0 00#4 .0#8 e0#< 0#@ 0">#D 0#p#F H0$#G b0(#H 01#L 07$#T d08$#X 0:#\ "0<#`7b \$y$0 00# 0#B 0#    3tm,wEx#6y#z#{# T|#h}#L~### #$\#($[> ##  !R#J#t!# 1 wVnV#pV#1" - 1#ref!V#]4(w (xm#(y1#(z0#  ({0#'(|0#r(}0#y9(~0#?(0# -(0#$4(#( . Q bQ# aa .  6# a# a# bit#u32"0*+g#key,#` H0wq1#rq2# 3#04#450#86v#< 7$#@8#Dppp`)  D # # # P#  1#: | D # #2>40Y G Po b*#ڦ##n 5#" # 7 s )8 J K0#* L0#{ M$#fd N# ? O0#exp P0#5 Q # 6 R #p5 S # 6 T #$ib U #(ob U #,x V0#0 W$#4  s  #  U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D<  #L  #P! #T #X  0 tstr u#len v#     p  z 1#L 1# p# ! g#fe ##be ## # ? #$Z 0#(D #,req #0rep #4si &#8 #% # P#srv #p #Q #> &#txn # # =$# $&#2 ;&## Â# Ă#, %# 0# ! ] Tn# # ##! # ' k Z auid^<#gid_&#`1#m buxa' t !LfdM# N#hO#k?P#  Qa#R#$S# T0#Ug#V1#*W}#AXv#'Y#`Z$# [0#bZ #)c#a TQ4m#n#So#p# q# r# s#$J5t}#(a6u}#,v#0w#4{x#8@y#<hz1#@e{#H|1#Ltm }m  a CfA}#bB #K.(?cbCK#{D$# E7#evF7# G[#H#I#  J#$ [  Jy9#get#put#u# #a   !!#!#!#3 !!3#!#G!# .(!'7!(#&!)#!*#!+# +!+#6!,#?!-#-!.#!/3# !0#$99! ''9#4'#Z'#len' # \'!#E'"#gp"7k?"4un"5 in"6Pp"2u"7?# 1SC1O#1P#h1Q# 1R# ? 1;uid1<#gid1=#1>#$1?# ,1@# 1A#!1B#a1C#1D# |1E#$ 1F#(<1G#,1H#01I#4+1I#8J1J#<1J#@1K#D1K#H1L#L 1L#Pm 1Mg#Tu 1Mg#1S# 1Tm #Y1U# r %a%^$#%_%#k%`%#%a?%e %j%h}#s%i}#W%je$+$,#$-#$.#$/\#   r7P V#I#CC7F &0#f 0#0#5,8len,90#cr,:0#,;0#b ,Cv,D#y9,E#,F#.*,G#3,H#  a+!!!! ! !!!! ! D + +l+ޔ#m_l+ߔ#u+#u_l+# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#7+rq+lst+D+P +0#sol+#eol+#som+0# col+0#sov+0#eoh+0#cap+#sl+#  +W#8 +#@+3+a#b+# + #req+7#rsp+7#\uri+# +#+#I+#?+0#.+ {.+\#idx+#val+# 7+#  "T@IJ# K#* L#M# N# O#B P#(R##S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X1#@!Yp#Hk?[P#Lp\P#\?^P#l`#|oa# b#@d#d#e#o fP#wg#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v$#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.O# 0#i# i#i#Qi#U##(tDRg# 5#O5# # h#r##P#B:'#,acl1#01#81#@1#H>1#P>X'#Xsrv#de #h? #lh (#pK#Z #̔##Δ#0#Д#gє#[# Ӕ#R Ԕ##֔#ה##G #Rڔ#7۔# .##/ޔ#1#')#id#+#1#t#4 ##0#i0#0#0# O#0#+O# 0#i#i# i#$0#0#`0#5#z5#5#5## #8## 0# j0# G# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p P# ?P# # o# ## m g# u g# Jp# p# # # #  # # g# # B# p # # # Z# 9# ]9#  # !# O"# q#z)# #z)# $# w %# &# ')# = (# )# *0# +0# F,&# :,&#H6=$; ** 1#*! #srv*"# $D  # R# R# / R# # #  #$q& P#(} P#, P#0 i#4Q i#< e% px ##sv Ƞ# ɂ#D ɂ# ? 0# iid ˔#J ˔#sid ˔# |% " \# % iid є#px ##buf 0#sid 0# ptr Ք#bol ֔#& ( $ e% |% & $$& &;&  *&&x ,6#t06#t16#9$#$## D#$ #(:'R#len0#pos0# sid0#srv#oe##src#buf #X'be#4 }' !0#.1# ' srv'# # # 'XactA&#bckA&#, (act6#bck6# (#Q # ## ##8 # #map}'# '#,V'#T (#7(#9(#/(#(#(( z) #3#_9#R;# T@#*#\#!# ) ) #)5$3#$44)@/ 01# E1O*#be5)# O*C1 -?1# g-@1#pol-A# -B0# {.-C#)*P 8 91# E:O*#+x(= >1# E?O*# J@# A# %B# .C# ?D0# E# F#$t+%-dow-#h1-#m1-#h2- #m2-# +-min-i#max-i#%-˔#s%-̔# +-k?-5#`-5#,-i-Ȕq-t+%-ѻ+%-+=,-ptr-$str-reg-=,r,%,--1#val-+#ptr-,#%-s# len-ڔ#$?-۔#(, -p-$i-ll-id-,a-,I ,$ C-W%0-i-#ptr-#len-#?-# ctx-,#-%-kw-\# --# %-].# B-x.# -0# &- #-g-C,--# $-W.-W.eB- -!1#kw-".#arg-%.# <&-&# {%-'1#,-x.W.-c..D&- -1#kw-.# .C-"#.-%%str-$C- /+3a#len# /# /b  /&/ 1ƐU'iǔQ'tmpQ'msgɔS(t/)__s$*)__s$+/3rDU,bp ,msgp/W-bq/p- q\S.@sP/lens7+u0,PU,b R,msg/S-b/V- \,lenW.@P+0r3MU,hdr\,end\V-4\,lenW0val\R++1.\PU,s\P,e\S.-V.-Q+105U-4\,len ,sol\W,idx/R,ctx10eol\V0sov\S.0p1 41.2123N324!2PW3225!20<6;/5>2A2160/+2/ @kU-4\S,sol\ ,idx/,ctx 17G3*pU,t S,si V,err-* -I,msgG3W23R3{~8_3Q213k33x34383QM3 9k3*+:buf 931:buf~ 93&:buf +3&5)3 eU,s( S-3(Q ;,427apU,str6\p,len6l0m87P0h9,4S24 .;}4+PU,txnO}4P0ptrQQ0endQS<45S2sU,s~ ,si~  0txn}4V0rdr h.1Q0lenS445s3A525K5 8X5Q3c54u5Le359K5v/(:s'9o5%1:ctr0o5:inc00O95,&":ctr!o5<52U,s V,si S.x P~0hdrS26}79?87~87P27737372;77S3737*S> 8(U7/__vH>*/__vG> }7?7"@now!7@tm!7 G57<+:tv17:tv277 RA8)JP@tv1I7@tv2I7/retKP<92h U,somf,idxf/ ,capg-! g90eolip0solil0coliV0soviW.0jh0hk9S0lenld2823228!2'.322Bh0__p$Q+91.\ H U,msg/V-/\W- 0S,ptr\R,end\Q-+-,9 1]-y 1+  1@3 14) 10Y 10 1- 1X+ 0+:/+\P  U,msg(/S-/(\ - )0P,ptr)\R,end)\Q-+*W-,*9 1-0 1+ 1/FP 1,O 14\ 17/g 11p 11Q 13^ 1-i~ <</ $U,buf ,msg/W,idx/. 0R0ptrS0endV1+@ 1-1]->1*-1+131<4D 121- 1.01351+c1+O 15cw 1/1_3t1g1y1{11.102w<< 3<8<w 8<R2<<i3<8<w 8<R2<<HK3<*ag> =9<F+F6E/:lenE:crE9=&"6!/C)e$-$U,t -#P0txn}4d. .`.N"\=w0.0V0hSD>0__s$W23>232DI>/len82`>>3>2y>>8>Q2>>3?2>?3?3(?31?B0msgR h9>):buf 9>O(:buf 9?(:buf 9=?):s :b 6) +?3 0U,s  S,req V0txn }4W2??J]8?P8?R47g3737BE 8P5?k6j:nowj+3Aw2  U,s  ,req  0msg /W., PT.' i@0ctx X1)/ (@.0 0PB/c B(0hex 0R* .@ P2@?:N3?8?P2@>NT3>43AZv8DAR8OAP4[Apt8lAP3wA5[AZ$W:nowV6'V5Ay#L:nowK6'K&<)<3>4>)<,<3?2N<>>8<P*>>> =2NJP>>3WP8bPRDN`EmPPDN0len| S(5O@A0eol9 V0sol9 h2!O2AA324!22A9A3222LO>+B1B3>2cO>1B4B3?2zO>CC3>2O>C!C3?2O>CC3>2O>CC3?2O>DD3?2O>)E,E3>2P>EE3>2 PyP&FDF3P3P47DFF3737*DFFE 8P9yP`(c:bufb 6@b0F5(d09PM-:buf 6y9+VR1@G8bU,s ,req  .0W/txn}40msg/.45#.4VV12t O1, H1,V RDQ.EO*W.JWS=61#DQ0retPB(0retRBx0rdr .,\R2Q WII3W4K5II8X5R3c5DR.P0MS.Q.MW.%0M~.0N~.*N~.NP0valNP./O~42 JJ32DR.J!WWDR0ret R4 WaMM3W4K5hMtM8X5R3c52S WHNN3W4K5ON[N8X5R3c52HS WO]O3W4K5!O-O8X5R3c5D`S0retTR2|SyPRR3P3P2Sk3R)S8x3R2S>)S.S3>2S3A.S7S8DAQ8OAP2S[AVS^S8lAP3wA2T[AjSwS8lAP3wAD T80len PVD[Th.1\~.x-VB0qsPDT0lenS0pnVVDT0lenV0pnVW(T}X4Y0eolS0solV2T2XX324!2XX322D%U.EO*VB0retPD=U0__p$Q(YUYPZ.2SDU(.P.Q.S4<ZZ3<8<P8<R2Uu5[[35DU@0lenS0pn'W2U?\\3?8?P2Vu5^^352*V>^^3>2dV3A^ _8DAR8OAP4[A_ _8lAP3wA2{Vu5_3_35DVX0ctx 2Vu5__35Bp.3 i0ctx4 2V>e`h`3>4>aa3>U**9!W& O:be N#) 7W -;W3@bbU- gS-E-W-1/len.3P;#XO4bbU,px#,l4  ,l7$R,dir-C--[%W.Q.3P/txn}4;gX2b_cU-[%W.Q-E-S=2;X.`ccU- gS-E-V-1;GY0c dU,px#,l4  ,l7$P,dir-C--[%W.V/txn}40ptrR0lenQ;Y*- didU,px#,l4  ,l7$P,dir-C--[%W.V/txn }40ptr R0len Q;Z8,&pddU,px$#,l4$  ,l7$$R,dir$-C%--[%%W.V/txn'}4/ptr(0len)P4Zdd8ZQ8ZS*ddEZR5ZG0:s\:len)i0;P[Y.=deU,px;#,l4;  ,l7;$R,dir;-C<--[%<W.Q/txn>}4;[0U eeU,pxS#P,l4S V,l7S$R,dirS-CT--[%TW.S/txnV}4;\\)4uefU,pxs#P,l4s S,l7s$R,dirs-Ct--[%tW.V/txnv}4*ee/__v>;\4 ffU,px#P,l4 R,l7$P,sol -C-W-[%W.S/txn}40idx/Q0ctx1V;l]I,fgU,px#V,l4 S,l7$Q,dir-C-R-[%W.P/txn}4;]+ g_gU,px#V,l4 S,l7$Q,dir-C-R-[%W.P/txn}4;^1`ggU,px#P,l4 R,l7$P,sol -C-W-[%W./txn}40idx/V0ctxX0cntS;_J/ghU,px#V,l4 S,l7$Q,dir-C-R-[%W.P/txn}4;_#1hOhU,px#V,l4 S,l7$Q,dir-C-R-[%W.P/txn}4;`-PhhU,px#P,l4 R,l7$P,sol -C-W-[%W.V/txn}40idx/Q0ctx1S;`4+iEiU,px)#V,l4) S,l7)$Q,dir)-C*-R-[%*W.P/txn,}4; a:->PiiU,px<#V,l4< S,l7<$Q,dir<-C=-R-[%=W.P/txn?}4;aX0Pi\jU,pxN#P,l4N p,l7N$P,solN -CO-S-[%OW.V/txnQ}40idxR/Q0ctxS1WB0__s`$S#a`$!`0$$`>$`7/__u`a/__c`wa;{b-o`jjU,pxm#V,l4m S,l7m$Q,dirm-Cn-R-[%nW.P/txnp}4;bX,jjU,px#V,l4 S,l7$Q,dir-C-R-[%W.P/txn}4;c1jTkU,px#,l4  ,l7$P,dir-C--[%W.S/txn}40ptrP0endVG}, `krkUHB.Kcc >H.Lcc H.McH[/cHJ /cH4 H H.v%dHwH 1\ VdI HQEdH;0JnowLm?LRAL3CDe7roS UH 7-oBTGQqFpz #D#E##F#9 '-{5 '- ?(%# !( # ( # b ( # (# (# A(# (# z(# (#$ (#( + (#, M(]#0 0(c#4 .(%#8 e(%#< (#@ ("E#D (#w#F H($i#G b((y#H (1#L (7#T d(8#X (:%#\ "(<#`  (] ((]# (c#B (%#&{ y   3% %$[E ##   R#J#t # 0 w{Wڥ#ۺ#n #" #TnW  #! #2E47YG o b# >    b # .. ~    #  .#  .# bit %#u32 "7 * +4#key ,~# n #p #" - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 57#8 6#< 7#@ 8%#D6]4"w "x#"y#"z7#  "{7#'"|7#r"}7#y9"~7#?"7# -"7#$4"6#( F )8J K7#* L7#{M#fdN%# ?O7#expP7#5Q&# 6R&#p5S&# 6T&#$ibUu #(obUu #,x V7#0W#4  Fu # U?}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#,7#0 7#4H%#8)l #< >#@>#A^#D< #L  #P! #T #X, 0tstru#lenv%#  u  l p z #L # # ! #fe #be # %# ? %#$Z 7#(D #,req u #0rep u #4si &#8 #% # 6#srv #p #Q #> !&#txn # %# L$# 3&#2 J&## ~# ~#, %# 7#  !& %#<&!%# &"%#&# # r ] k auid^1#gid_#`&#$ buxa + !LfdM%# N%#hO%#k?P#  Q#R%#$S%# T7#U#V#*W4#AX#'Y#`Z# [7#b #)c# TQ4m:#n%#So%#p%# q# r# s%#$J5t4#(a6u4#,vZ#0wZ#4{xZ#8@yZ#<hz#@e{%#H|#L+ $ 4%%$ J Z%JCfA4#bBu #.(?cbC#{D# E>#evF># G0#H#I%#  J_#$ ` _ Jy9%#get%#put%#u%# # DY<_``#@aY#setbY#clrcY# AdY#@eY#remfk#clogk#_5h# 9i#$Bj#([%k#,Hl#04m#4n%#8Y%%Dk_%eq%5%8len%97#cr%:7#%;7#Fb %Cv%DF#y9%E~#%F~#.*%G~#3%H~# $    D $L$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#J$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#g$rq$st$ D$P $7#sol$#eol$#som$7# col$7#sov$7#eoh$7#cap$ #sl$J#  $^#8 $%#@$3$#b$# ${ #req$g#rsp$g#\uri$# $#$#I$%#?$7#) D##%#W# #:H !a!^#!_,#k!`,#!ae + ,# -# .%# /# S HP ##IK(tD# #O# %# h%#r%#%#6#B!#,acl#0#8#@#H>#P>!#Xsrv #de %#h? %#lh Ț"#pK#Z #%##%#7#%#g%#[# %#R %##%#%#ة#G #R%#7%# .$##/%#߲#'##id#+##t%#4 %#%#7#i7#7#7# K#7#+K# 7#p#p# p#$7#7#`7##z#### %#8#%# 7# j7# <# p# p# p# p# p# p# ) p#  p# Q p#  %#cap %# p 6# ?6# %# o# # m # u # Jw# w# %# %# %#  %# %# g%# %# B%# p # # %# Z%# &$# ]&$#  # !# O"# q#,$# #,$# $%# w %# &%# '<$# = (%# )%# *7# +7# F,V!# :,V!#HF &7#f 7#7#p7k?4un5{in66p2u7#   ;  #! #srv" #  T@"J # K%#* L%#M%# N%# O#B P#(R#S%# T%#$5 T%#($U7#,6U7#0tV%#44 V%#8'W%#<X#@!Y#Hk?[6#Lp\6#\?^6#l`%#|oa# b_#@d #d #e#o f6#wg~#h%#i%#;i%#%$j%# j%#Rj%#k%#l%#Fm%#ido#p7#b p7#q7#r7#us7#?t7#Vt7#gu# v #hw #yp#yp#jz7# {<#}p#}p#~p#~p#p#.K# 7#p# p#p#Qp#U%# V!x ,#t0#t1#9 # #%# D%#$ %#(!G#len7#pos7# sid7#srv #oe#src#buf #!be4" !7#.#J" srvJ"# %# %# u"Xact #bck #,"act#bck##%#Q %# %#%# %#%#8 %#  #map"# P"#,Vu"#T Õ##7ĕ##9ŕ##/ƕ##Ǖ### #$ %#3%#_9%#R;%# T@%#*%#\%#!%#! .$!!  $ <$ L${ $D  %# G# G# / G# # #  #$q& W#(} W#, W#0 p#4Q p#<t% px #sv # ~#D ~# ? 7# iid %#J %#sid %#% " #% iid %#px #buf 7#sid 7# ptr %#bol %#& ( $ t% ׋% !&F 3& '&J&  9&&,SC,O%#,P%#h,Q%# ,R%# ( ,;uid,<%#gid,=%#,>%#$,?%# ,,@%# ,A%#!,B%#a,C%#,D%# |,E%#$ ,F%#(<,G#,,H#0,I#4+,I#8J,J%#<,J%#@,K%#D,K%#H,L%#L ,L%#Pm ,M#Tu ,M#,SP&# ,T$ #Y,U%#"(5L%kkU#p6L%S#5L(Q#06L%R#66L(V$lenL,W#?LWP%@LS&(>6%knU'si p'bu S(%6%l(%h)ret%Q)max%d*#)x52 nnU'si1 S"*>5%nZuU$fd%+si p+bu S+ret%Q+max%W%%l%g6%h%Z5%d,"s,5hs,#xp-)oo)fwd9%R.)(5%V/**q/q0*V1*/^**pqr1*1*23*V3*Q4*4*3+V5+rs0%+R00+P5<+rr0M+P1X+6*h7tg7fg76+5h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6<+Z$W%7nowV%:'V%6d+y#L%7nowK%:'K%*+5`uvU'si S;,U6x%vyU'fdw%)siy W)bzu S({%p,"w,#v,5wv/:,+vv0%+R00+P5<+vv0M+P1X+/Q,,vv1,/o,*vw0*S1*/,+ww0%+V00+R5<+ww0M+R1X+5*ww0*S1*6,O5D%:C%*-5MyzU'siL W)ibNu V)obOu S)fdP%p/h-+yy0%+R00+P5<+yy0M+P1X+/-+yz0%+R00+P5<+z z0M+P1X+5+BzWz0%+R00+P5<+QzUz0M+P1X+* .d5z {U'si R)ibu P*8/6{g}U'si V)obu S(%P,#"|/o.,{{1,/.+{|0%+W00+R5<+||0M+R1X+/.*"|A|0*S1*//+}||0%+R00+P5<+||0M+P1X+5+||0%+R00+P5<+||0M+P1X+<['E/pEm ?ER AE3 C D^7ro S UH  09 -5 -? ~#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. ~#8e ~#< #@ ">#D #p#FH $ #Gb (#H 1#L 7#Td 8#X :~#\" <#`     #  # B ~#   / 3qFcz D E# F#oBTGQ n #p #"  - #ref !#x]4w x# y# z0# {0# '|0# r}0# y9~0# ?0# -0#$ 4x#(   b#    ### bit~#u32"0?* +#key, # H0wq1#rq2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D?))  D# # ~# P# #:] D]# ]#P # #)2>40YG o  b# $[ >*   # *# : q R # J # t q#  w # ۺ# n # " # 7 )8!J !K0# * !L0# {!M#fd!N~# ?!O0#exp!P0# 5!Q# 6!R# p5!S# 6!T#$ib!U #(ob!U #, x !V0#0 !W#4 # !U ?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H~#8 ) #< 7#@ 7#A W#D <#L #P ! #T  #X4 0tstru#lenv~#E E  K  p z "# L"# "# !"#fe" #be" # "~# ?"~#$ Z "0#( D"#,req" #0rep" #4si""#8 ":# %":# "#srv"# p"# Q "# > ""#txn"# "~# "#!# " ## 2"!## # "w# "w# ,"ؾ"# "0#4 !  ]H Tn  # !H # X k auid ^y#gid _c#  `n# bux aX  ! Lfd M~# N~# h O~# k? P:# Q#  R~# $ S~#  T0#  U#  V# * W# A X# ' Y# ` Z# [0#  b # ) c# T Q 4 m#  n~# S o~#  p~# q# r#  s~#$ J5 t#( a6 u#,  v#0  w#4 { x#8 @ y#< h z#@ e {~#H  |#L  ~~~  ~CfA#bB #|.(?cbC|# {D# E7#evF7# G# H# I~# J#$   J y9~#get~#put~# u~# #p7k?4un5 in6,p2u7#m(S C(O~# (P~# h(Q~# (R~#  (;uid(<~#gid(=~# (>~# $(?~# ,(@~#  (A~# !(B~# a(C~# (D~# |(E~#$ (F~#( <(G#, (H#0 (I#4 +(I#8 J(J~#< (J~#@ (K~#D (K~#H (L~#L  (L~#P m (M#T u (M# (S,# (T # Y(U~# a ^# _%# k`%#ane+ ,n# -t# .~# /# )z 5%8len%90#cr%:0#%;0#b %Cv%D# y9%Ew# %Fw# .*%Gw# 3%Hw#  Z$!!!! ! !!!! ! D $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#0$rq$est$D$ P $0#sol$#eol$#som$0# col$0#sov$0#eoh$0#cap$#sl$# $W#8  $~#@z$ 3$Z# b$# $ #req$0#rsp$0#\uri$# $# $# I$~# ?$0#F  &0# f 0# 0# "T@I J# K~# * L~# M~# N~# O# B P# (R # S~# T~#$ 5 T~#( $U0#, 6U0#0 tV~#4 4 V~#8 'W~#< X#@ !Y#H k?[#L p\#\ ?^#l `~#| oa# b# @d# d# e# o f# wgw# h~# i~# ;i~# %$j~# j~# Rj~# k~# l~# Fm~#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hw# yi# yi# jz0# {/# }i# }i# ~i# ~i# i# .z# 0# i# i# i# Qi# U~# (tDR # # O# ~# h~# r~# ~# # B'$#,acl#0 #8 #@ #H >#P >E$#Xsrv#d e ~#h ? ~#l h $#p K# Z # ~# # ~# 0# ~# g~# [# ~# R ~# # ~# ~# c# G # R~# 7~# .m&# # /~# ߋ# '%#id# +# # t~# 4 ~# ~# 0# i0# 0# 0# z# 0# +z# 0# i# i# i# $0# 0# `0# # z# # # # ~# 8# ~#0#j0# /#i#i#i#i# i#i#) i# i#Q i# ~#cap ~#p #?#~#o# #m #u #Jp#p#~#~#~# ~# ~#g~#~#B~#p n#n#~#Z~#y&#]y&# ]# !]#O"]#q#&# #&#$~#w %#&~#'&#= (~#)~# *0# +0#F,##:,##H#!; # # # #!E #srv#"# !D" "~# ":# ":# /":# "# "#  "#$ q&"P#( } "P#, "P#0 "i#4 Q"i#<K""px" #sv"Ȇ# "w# D"w# ?"0# iid"~# J"~#sid"~#b" " ""ζ#""iid"~#px" #buf"0#sid"0# ptr"~#bol"~#""("!"K""b" "   #E "!#E #I#x , #t0#t1# 9 #  # ~# D~#$ ~#('$ :#len0#pos0# sid0#srv#oe #src:#buf #E$be 4j$  !0# .#$ srv$# ~# ~#$Xact.##bck.##,$act#bck#% ~# Q ~# ~# ~# ~# ~# 8 ~# #mapj$# $#, V$# T %# 7%# 9%# /%# %#%%g&  ~# 3~# _9~# R;~# T@~# *~# \~# !~# .g&! s& & & #C' 7W~p}>~U$6X~D %'C'}}&T''&T'(&)^'R*k'}}+|'%/''}},'P+'*'}~+'-k'".t/.__p-'70t-'y#L~0nowK~1'K~2'T1 #:(6#~@~iU$6$~H 36%~4s&S4p' W5~=$ 7/~V$6/~p#)6gpU6tf4ph p$6i)l$6jS$ *jW4ik~h%(),)P+*)%('(,'P+'7(Ix.lent~'3\}c-6)k~1j~0nowj~#)E~U86P86P36375ƀڀ3&%3%9)=U86S9*6@ U4p S%x**zɁ+*%<**z+***+***+***Ɂ++*+Ɂ+*+**,*P*4+Ɂ,A+Q-*"0t-* ~0t}-* v0tu2*]1\*-+0t-4+0t2K+0t:[X+:J X+:LX+;4]1 ;41 ;  ~1 :.v+:w~ +< :&Q+:';0=now'<:: (Xm:(^ >(I : Q0:R0: U0: V]:W*$6@ 9Pl>@0:y& !07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz $D$E#$F#9 +-{5 +- ?,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 e,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7 6 B  , ,,# ,#B ,#I{B3$[> ## 8R#J#t8#Hwty6 7# w8#2>40YtG o b#ڽ#ۊ#n ܠ#" #73 b3#CC  # C# C# bit#u32"0*+I#key,#n#p#" - #ref!# H0wq1#rq2# 3#04#450#86#< 7#@8#D K]4"w "x*#"y#"z0#  "{0#'"|0#r"}0#y9"~0#?"0# -"0#$4"K#([ ))8&J &K0#* &L0#{&M#fd&N# ?&O0#exp&P0#5&Q;# 6&R;#p5&S;# 6&T;#$ib&U #(ob&U #,x &V0#0&W#4 5 5[) # &U?#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#,#0#0 #0#4H##8)# #< #7#@#7#A#W#D<#5#L #5#P!# #T# #XA 0#tstr#u#len#v#    p #z%#L%# %# !%#fe%"#be%"#%# ?%#$Z %0#(D%#,req% #0rep% #4si%$#8 %#%%#%#srv%P#p%P#Q %P#> %$#txn%# %#%"#%$#2%$## %w#%w#,%؈$#%0# !  ] Tn  #! # k auid^1#gid_#`&## buxa * !LfdM# N#hO#k?P#  Q#R#$S# T0#U#V#*W3#AX#'Y9#`Z# [0#b #)c# TQ4m?#n#So#p# q# r# s#$J5t3#(a6u3#,v_#0w_#4{x_#8@y_#<hz#@e{#H|#L* # 3 #O_ OCfA3#bB #.(?cbC#{D# E7#evF7# G#H#I#  Jj#$ej Jy9#get#put#u# {#OY<_``#@ai#setbi#clrci# Adi#@ei#remf{#clog{#_5h# 9i#$Bj#([%k#,Hl#04m#4n#8d d O { do   p   p7k?4un5 in6p2u7#H0SC0O#0P#h0Q# 0R#  0;uid0<#gid0=#0>#$0?# ,0@# 0A#!0B#a0C#0D# |0E#$ 0F#(<0G#,0H#00I#4+0I#8J0J#<0J#@0K#D0K#H0L#L 0L#Pm 0M#Tu 0M#0S# 0T# #Y0U#) D###P# #:] a ^# _%#k `%# a*e+,#-#.#/# h ]P ##  6F &0#f 0#0#u5)8len)90#cr):0#);0#b )Cv)D#y9)Ew#)Fw#.*)Gw#3)Hw# 6(           D (s(l(މ#m_l(߉#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(sD(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(ۍ#sl(#  (W#8 (#@1(3(#b(u# ( #req(#rsp(#\uri(# (#(#I(#?(0#{.( {.(#idx(#val(# 7(# t!PT@ I JP# K#* L# M#  N# O#B P#( R"# S#  T#$5 T#($ U0#,6 U0#0t V#44 V#8' W#< X#@! Y#Hk? [#Lp \#\? ^#l `#|o a# bj#@ dP# dP# e#o f#w gw# h# i#; i#%$ j# j#R j# k# l#F m#id o# p0#b p0# q0# r0#u s0#? t0#V t0#g u# v"#h wP# yi# yi#j z0# {<# }i# }i# ~i# ~i# i#. # 0# i# i# i#Q i#U #"(tD R # #O # # h #r # # #B %#,acl #0 #8 #@ #H> #P> &#Xsrv P#de #h? #lh Ȱ&#pK #Z # ̉# # Ή# 0# Љ#g щ#[ # Ӊ#R ԉ# # ։# ׉# ؾ#G #R ډ#7 ۉ# . 0(# #/ މ# #' '#id #+ # #t #4 # # 0#i 0# 0# 0# # 0#+ # 0# i# i# i#$ 0# 0#` 0# #z # # # # #8 # # 0# j 0# <#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  #cap # p # ? #  # o #  "# m # u # J p#  p#  #  #  #  # # g #  # B # p #  #  # Z #  <(# ] <(#  $#  !$# O "$# q #B(# #B(#  $# w %#  &#  'R(# = (#  )#  *0# +0# F ,l%# : ,l%#HV"; '' #'! #srv'"P# #D% %#%G# %G# /%G#%#%#  %#$q&%P#(} %P#,%P#0%i#4Q%i#<$%px%Ǫ"#sv%P#%w#D%w# ?%0# iid%ˉ#J%ˉ#sid%ˉ#,$ %"%#$%iid%щ#px%Ҫ"#buf%0#sid%0# ptr%Չ#bol%։#$%(%̞#%$%,$$[" $ $ $ 5$l%x ,  #t0 #t1 #9 "# "# # D #$  #(%  G#len 0#pos 0# sid 0#srv P#oe "#src #buf #& be "4 -& ! 0#. #`& srv `&# # #P&X act $#bck $#,& act #bck #'  #Q # # #  # #8 # P#map -&#  f&#,V ‹&#T ë'#7 ī'#9 ū'#/ ƫ'# ǫ'# ' P'*(  #3 #_9 #R; # T@ #* #\ #! # .*(! 6(R( b( (%*dow*#h1*#m1*#h2* #m2*#)*min*i#max*i#%*ˉ#s%*̉#,)*k?*Ϡ#`*Р#_)*i*ȉq*(%*)%*b()*ptr*str*reg*׉)])%,**#val*,)#ptr*_)#%*0# len*ډ#$?*ۉ#('* *p*i*ll*id*'*a*.*I>**W%0*i*#ptr*#len*#?*# ctx*)#*%*kw*# *+# %*+# B*+# *0# &* #+ $ + 9)*E+ "  E+ +K++eB* *!#kw*",#arg*%,# <&*&# {%*'#>*++ + +++D&* *#kw*+#,*!",*%#str*$*$,;)U%px"&op&totW'l&curPQ'8PV(, &maxɉh)@*vω+,U<M0U%pxL"Q&srvNPR,,bv----.-7;/ :/g7:+@-X7iU%pxh"R+-G8{ U%srvzPS&p|"V0.:c,,9=----+-~9U%srvPS&p"V0.:DŽ,,DŽ----$h.7rU%p"W&srvPS'<V&actp&bckl1Cf2w`1Tf3t 4k/:8U5srv7PS2p9"W2grp:k/P6.:ec6|8bS7.,----7.,ˆ----(/X8x RPR7+/,/----7W/q/-/,/9/P,/-/$:/;I;sHP07FU5p"V2srvPS?;70,----,M009[0W-g04~19PU5sPQ3p"2grpk/R7F1~1-1)p@1P7]11-1,1Ԋ-1)@1P:158;sP3grpk/:17x;swP:1;~;s}P3grpk/42b8rU5srvqPS2ps"V2grptk/W6.:6|87T2,----7p2,0C----)8x PP43: U5srvPW?8?*72p"p2grpk/l72,LW----73,Wu----7B3q/+:-/,/+:9/PAj3888Q?773q/I`-/,/I`9/P73q/`o-/,/`o9/V,M0ox9[0S-g04@48kU5sjPV7,4@4Ў-N4,/Ў9/S,Y4 -g4:Y49X;sWP:r4:a;s`P4g59y U5srvxPS2pz"V6.:c6|8S74,;?----74,?S----( 58x PR7'5,Ϗ----7S5@4-N4,/9/P,g5-u5:5:R;sQP4-67+U5srvPS2p"V6.:36|8 75,/3----76,K`----(68x PP,Y4ِ -g446:0U5srvPS?8?*72p"p76,\g----76,g----76Y4/2-g4,@4֒-N4,/֒-/>[7Z;U5p"V2srv PS?;!7G7,œ----,Y4ϓғ-g4B78tP fU5pxs"5urisVC7s8[uPp2pvS89wl8?:xhB8b:Pp U5s P8[PT2txn8P2req V2msg8S2px"L8?:0H8,PW2lenPD89@2ctx1X2pS)8001x3c)2hex0R18@PB9}7P&U5s S8[PW3txn82msg8T2px "V8?:!0P2len"PS2ctx#1X2p$Q1&8[:BLB6>;v0fU5su 8+;xPp2erryV6(Dout™71:6>ۙ-G>9P>P(I:(2lenW7:p>n9>W9>D)H@>S@>@@>V@>7:>!->9>W9>V)h@>X@>R@?T7;?"-%?9/?V-:?( ;@E?Q@N?P1EX?7;e?"-w?9?W(X;@?P@?\@?V7;?=N-?,?=N-?,@=N9@P-@)@?S,+@l-<@,H@l-Z@1l@f@P,@9@P-@7=q@ٟ-@9@l(R<@@W@@h@@d@@V@@`F@̟7<@<-@)@@Q@AR,?-?,?-?,@9@P-@7<!AMY-/A) @;APAM=pEA79=?p9?P,?s-?,@s9@P-@,1-17i=HA-VA-bA,q/-/,/9/P7=p>>9>W9>P)8@>S@>L@>V@>H7>?-@-?,?-@-?,@-@9@P-@,M0+9[0S-g0.Z>;9FGsFZ>GpFe>`> k> V.>75PGpx4"/;4PHy;6H76*srv7PH:7P.?9PGpx"Guri/7H[P*cH8.e?5;zPGpxx"/k?yGleny*h{0*l{0I*__v0J?u:BP;pA"=;AP3srvCP?:CP?D/I3sWP.?7// 6"J?6?= 5"IJ+@?=R+C=F0.H@C//B/Jq@T?=S?3tUCJ@;P;p"=;P3srvP?mP?:P3grpk/?p;K470J!A8P;grpk/?/3sPI?8/:HA;;grpk/?:":mA;;grpk/;sPB&B/<pU5s SAA3__v->AA3__v->13__v->13__v*>AB3__v*>13__v*>BiBM9b{U5sa V2pc$P2errdSBDn79U5s 3fd2errP(mCP8i$DT2retP8?L1ǧ8#*H2src+X7(CD֦9DQ9DS7SCD3}9DQ1B}@D@12__v@>P7CD %-D(C8i$_DW2ret`S8?`S(C2msg7CD9EQ9EP7DE˩ө90EP-;E70DD9DQ9DS7PDD9DQ9DS7pDDƬ9DQ9DS,Dح9DQ9DS߰-G>-P>7ED9ER9EP7FE90EP-;E,iFQm-vF?&m%?m%)82beg}V3end}1 ?&%?%LIK i= hLI -= +=x += ,MJE<еdU5px"S5l4  5l75dirCCE+VC[%+W1?&%?%M%KD7p1U5px"S5l4  5l75dirCCE+WC[%+V8:PR1?&%?%MK8@·U5px"S5l4  5l75dirCCE+VC[%+W1q?&%?%MILD:зRU5px"S5l4  5l75dirCCE+VC[%+W1?&%?%ML< `ٸU5px "S5l4  5l7 5dir CC E+VC[% +W1?& %? %MmM: YU5px "S5l4  5l7 5dir CC E+VC[% +W1&?&# %?# %MM81 `ٹU5px/ "S5l4/  5l7/ 5dir/ CC0 E+VC[%0 +W1?&6 %?6 %MNe9I U5pxG "S5l4G  5l7G 5dirG CCH E+VC[%H +W8O<J P1&?&P %?P %N9u UO[+NpOJ +NOL+NO-LNN ~O-MNO qpO.vOOwBOPO.Q1OO/;0Qnow/Em?ERAE3CD^7roS UH 0oBTGQqFez "D"E#"F#9 %-p5 %- ?&~# !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&R#0 0&X#4 .&~#8 e&~#< &#@ &">#D &#p#F H&$^#G b&(n#H &1#L &7#T d&8#X &:~#\ "&<t#`   &R &&R# &X#B &~#p n   3 $[ >   # #    R #J #t #  w2>40YG %ao b;#ڏ#0#n F#" # 7    b #  9    #  #  # bit ~#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H0wq1D#rq2D# 3~#04~#450#86R#< 7#@8~#DLLL<]4!w !x#!ym#!z0#  !{0#'!|0#r!}0#y9!~0#?!0# -!0#$4!#(  )8J K0#* L0#{M#fdN~# ?O0#expP0#5Q# 6R#p5S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U?}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P!3 #T9 #X_ 0tstru#lenv~#p p 0 v ' p zm#Lm# L# ! #feQ#beQ#~# ?~#$Z 0#(D#,req0 #0rep0 #4siq$#8 #%#a#srv/#p/#Q /#> $#txns# ~#"#$#2ª$## w#w#,G$#0#_ !- J ]s Tn  #!s # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#k? P#  Q # R~#$ S~#  T0# U # Vm#* W #A XR#' Y #` Z# [0# b #) c# T Q4 m # n~#S o~# p~# q# r#  s~#$J5 t #(a6 u #, v#0 w#4{ x#8@ y#<h zm#@e {~#H |m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#H#I~#  J#$    Jy9~#get~#put~#u~# ##U5$8len$90#cr$:0#$;0#b $Cv$D#y9$Ew#$Fw#.*$Gw#3$Hw# #    D #¬S#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#SmD#P #0#sol##eol##som#0# col#0#sov#0#eoh#0#cap#m#sl##  #W#8 #~#@#3##b#U# #6 #req##rsp##\uri## ####I#~#?#0#d) D##~#P# m#:X a^#_%#k`%#aue+,#-#.~#/#  2P #D#>>d2IW(tD # F#OF# ~# h~#r~#~#a#B4 #,aclm#0m#8m#@m#H>m#P>R #Xsrv/#de ~#h? ~#lh  #pK#Z #~##~#0#~#g~#[# ~#R ~##~#~# #G #R~#7~# .z"##/~#m#'!#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#F#zF#F#F## ~#8#~# 0# j0# 1# i# i# i# i# i# i# ) i#  i# Q i#  ~#cap ~# p a# ?a# ~# o# Q# m  # u  # Jp# p# ~# ~# ~#  ~# ~# g~# ~# B~# p # # ~# Z~# "# ]"#  o# !o# O"o# q#"# #"# $~# w %# &~# '"# = (~# )~# *0# +0# F,# :,#HF &0#f 0#0# p7 k?4un5J in6a#p2u7# 2!i;  m#!p #srv"/# /T@"J/# K~#* L~#M~# N~# O#B P#(RQ#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#Hk?[a#Lp\a#\?^a#l`~#|oa# b#@d/#d/#e#o fa#wgw#h~#i~#;i~#%$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v5#hw/#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#ix ,#t0#t1#95#5#~# D~#$ ~#(4 <#len0#pos0# sid0#srv/#oeQ#src#buf9 #R beQ 4w !0#.m# srv # ~# ~#/ Xact;#bck;#, act#bck#!~#Q ~# ~#~# ~#~#8 ~# /#mapw #  #,V #T !#7!#9!#/!#!#!/!t" ~#3~#_9~#R;~# T@~#*~#\~#!~# .t"! " " "6 ]#D ~#<# <# /<###  #$q&P#(} P#,P#0i#4Qi#<#pxQ#sv/#w#Dw# ?0# iid~#J~#sid~## "Θ#G$iid~#pxQ#buf0#sid0# ptr~#bol~#q$ (]# # # $ 2$p $$p $"$<,~ݺU#si+Q$$%%P%%R&%k~'j~(nowj~)@%<6 U#si5R)%|<DU#siCQ#msgC%S*%%Q%%R$%Q%%R% 6 +%1(buf~0 )&<URU#siTS#msgT%Q* &&Ȼ%&P*#&%Ȼ,%*:&&,&*t&&%%&Q%&P$&#%&P,&$ '%','+&*+(buf0 +&O((buf0 &&Z$W~(nowV~''V~& 'y#L~(nowK~''K~+#'&(buf0 -[%0'e-J %0'-.vP',-w~ t'. -'Qc'-(;0- )Q0-)R0- )U0- )Vo-)W'D5E$`0<y& 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz !D!E#!F#9 +-{5 +- ?,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,h#0 0,n#4 .,#8 e,#< ,#@ ,">#D ,#p#F H,$t#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7  ,h ,,h# ,n#B ,#1{  *  3 0 #3#4#n#5##6# #7# Z #8##9#!#:#N",!"-#- ".#!"/#"0N#  $[ >   _# #   R _#J #t #  wtm,wEx#6y#z#{# T|#h}#L~### #$#(2>40YG o b#_#ۦ#n ܼ#" # ,7 O bO# __ ,  4# _# _# bit#u32"0*+e#key,# n #p #7" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D7g]4w x$#y#z0#  {0#'|0#r}0#y9~0#?0# -0#$4g#( w E )8%J %K0#* %L0#{%M#fd%N# ?%O0#exp%P0#5%QW # 6%RW #p5%SW # 6%TW #$ib%U #(ob%U #,x %V0#0%W#4Q Q wE  # %U? }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D< Q #L Q #P! #T #X]  0 tstr u#len v#     p  z$#L$# $# !$x#fe$_ #be$_ #$# ?$#$Z $0#(D$#,req$ #0rep$ #4si$g"#8 $#%$#$#srv$#p$#Q $#> $w"#txn$[# $#$ #$"#2$ "## $w#$w#,$="#$0#  ! & #<&!# &"#&# #  ]( Tn  _#!( # 8 kk auid^1#gid_#`&#~ buxa8  !LfdM# N#hO#k?P#  Qr#R#$S# T0#Ux#V#*W#AX#'Y#`Z# [0#bk #)c#r TQ4m#n#So#p# q_# rT# s#$J5t#(a6u#,v#0w#4{x#8@y#<hz#@e{#H|#L~ ~  rCfA#bB #\.(?cbC\#{D# E7#evF7# Gl#HT#I#  J#$ l j Jy9#get#put#u# 0#r) D###P# #:b a^#_%#k`%#a/e+,#-#.#/# m bP ##C5)8len)90#cr):0#);0#b )Cv)D#y9)Ew#)Fw#.*)Gw#3)Hw# (    D (šA(l(މ#m_l(߉#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(A[D(P (0#sol(#eol(#som(0# col(0#sov(0#eoh(0#cap(N#sl(#  (W#8 (#@(3(#b(C# ( #req(#rsp(#\uri(# (#(#I(#?(0#0F &0#f 0#0# ? T@IJ# K#* L#M# N# O#B P#(R_ #S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#Hk?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# ve #hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#?_ (tDRx# #O# # h#r###B##,acl#0#8#@#H>#P>$#Xsrv#de #h? #lh ȭ$#pK#Z #̉##Ή#0#Љ#gщ#[# Ӊ#R ԉ##։#׉##G #Rډ#7ۉ# .&##/މ##'%#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# <# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# _ # m "# u "# Jp# p# # # #  # # g# # B# p # # # Z# &# ]&#  )# !)# O")# q#&# #&# $# w %# &# '&# = (# )# *0# +0# F,i## :,i##H 4 ; '' #'! #srv'"# S!D$ $#$G# $G# /$G#$#$#  $#$q&$P#(} $P#,$P#0$i#4Q$i#<!$px$_ #sv$#$w#D$w# ?$0# iid$ˉ#J$ˉ#sid$ˉ#! $"$#="$iid$щ#px$_ #buf$0#sid$0# ptr$Չ#bol$։#g"$!($S!!$!!$! w"w k " }"" Q "I"p7!k?4jun5 in6"p2u7"#i#x ,4#t04#t14#9e #e ## D#$ #(#G#len0#pos0# sid0#srv#oe_ #src#buf #$be_ !4*$ !0#.#]$ srv]$# # #$Xact"#bck"#,$act4#bck4#%#Q # ## ##8 # #map*$# c$#,Vˆ$#T è%#7Ĩ%#9Ũ%#/ƨ%#Ǩ%#%%'& #3#_9#R;# T@#*#\#!#& .(7(#&)#*#+# ++#6,#?-#-.'#/(# 0&#$'&"! & & & (' 1$1%#kw1&# 1-Q'#Q'N_ _ (''1516#kw17'# '& '  '###'( (##G#'I(-SC-O#-P#h-Q# -R# ) -;uid-<#gid-=#->#$-?# ,-@# -A#!-B#a-C#-D# |-E#$ -F#(<-G#,-H#0-I#4+-I#8J-J#<-J#@-K#D-K#H-L#L -L#Pm -M"#Tu -M"#-S(# -T~ #Y-U##,=<`U$ ?:N~$<: $ =:_ $';_ %err;$ ;&V*X'&>%'>%&+(su? ~)@S**Cp'&^%'^%+Cp'^)^P**x'&b%'b%*+'&f%'f%*,+'&q%'q%&C+)r,P*+0'&Z%'Z%+0'Z)ZP,+,8Q-,.,8Q-----'-/)N"g4-P*+'&%'%*,'&%'%&^,'$.,پ-,.,پ-----'-,,, -,., -----'-,,, 9-----'-/()'0~(resP 0,n1m04- -1+1x+N1,2r-< :U%msgr-$y9  3.=o@U4sn 4pxn_  4urin&R5repp d5svq`5svsq\5msgr h&.H6#*.E6}(S7len~+8&%8%+86P&.6"?.@/6+$0P&.6".\/ 6+$0P . 3/1=KLU4sJ V4repJ  4uriJ&W7pxL_ 5msgM h5upN0S,t//=J-/,//-/./ B-/9/j,:buf ;/<U:nTP2c0|=PU%s V%rep W%uri&1P*_1y7__v>*y1"7__v>/H 8\;1=[:tZ=2=U4s 4rep  ?25msg @&2` 5es3~,52/%(-/&2 8=6)=~. 3-3-*3-63-B3>N3~/ AZ3~Af3Q&2 5pnq35tm.3>3~>3P./-/ 3 i#Bq3=JCoutHr-1y9HCerrI31{.ICptrI7endK7cL7 3 -D3"Cnow!3Ctm!3 <EK=UFB*K33 >F*L33 ~F*M3F[+4pFJ +4F.v/4FwF -\ `4G FQO4 x4GF҅4 m4?(I_ F.;0Hnow.GF -XI(Hpid-ZFX-[F-^ F/F/F, 0F Q0FR0FiS0FwT0F U0F V)FWu56'W' 7H0 ?y& !07i  "02-y &ik 27 5int 60 >Em ?ER AE3 C D^7ro S UH  0o BT G QqF<> >G? 0z #D#E##F#9 +-/5 +- ?,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 e,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7$#T d,8$#X ,:#\ ",<#`5 7@ :$W c $ , ,,# ,#B ,#jc3$[> ##" YR#J#tY#iwy6 7# w8#Tn  #!#k 2> 40YG o b#Z##n #" Z#j7 b#j  r# # # bit#u32"0!*+#key,#FnF#pF#!u" - !#ref!F# H0wq1#rq2# 3#04#450#86#< 7$#@8#D u]4"w "xK#"y!#"z0#  "{0#'"|0#r"}0#y9"~0#?"0# -"0#$4"#( )8$J $K0#* $L0#{$M$#fd$N# ?$O0#exp$P0#5$Q# 6$R#p5$S# 6$T#$ib$U #(ob$U #,x $V0#0$W$#4   # $U?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8) #< 7#@7#AW#D<#L #P! #T #X 0tstru#lenv# $  $ *  p z!#L!# # !>#fe0#be0## ?#$Z 0#(D#,req #0rep #4si8!#8 "#%"##srv#p#Q #> H!#txn,# #s#Z!#2q!## Â#Ă#,!#0# !  ]1 auid ^<#gid _&# `1#D bux a K ! Lfd M# N#h O#k? P"#  Q8# R#$ S#  T0# U># V!#* WT#A X#' YZ#` Z$# [0# b1 #) c#8 T Q4 m`# n#S o# p# q# r#  s#$J5 tT#(a6 uT#, v#0 w#4{ x#8@ y#<h z!#@e {#H |!#LK D T Dp 8pCfAT#bB #".(?cbC"#{D$# E7#evF7# G2#H#I#  J#$2 Jy9#get#put#u# #8 ) D###P# !#: - a ^$# _%#k `%# a}e+,}#-#.#/:# 8 -P F##  5'8len'90#cr':0#';0#_b 'Cv'D_#y9'E#'F#.*'G#3'H# &    D &e &l&ޔ#m_l&ߔ#u&#u_l&# v&#v_l&#c&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st& &D&P &0#sol&#eol&#som&0# col&0#sov&0#eoh&0#cap&&#sl&c#  &W#8 &#@&3&#b&# & #req&#rsp&#\uri&# &#&#I&#?&0#F &0#f 0#0# T@IJ# K#* L#M# N# O#B P#(R0#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X!#@!Y#Hk?[#Lp\#\?^#l`#|oa# b#@d#d#e#o f#wg#h#i#;i#%$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v6#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#0(tDR># #O# # h#r###B''#,acl!#0!#8!#@!#H>!#P>E'#Xsrv#de #h? #lh '#pK#Z #̔##Δ#0#Д#gє#[# Ӕ#R Ԕ##֔#ה#؎#G #Rڔ#7۔# .m)##/ޔ#!#'(#id#+#!#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z#### #8## 0# j0# G# i# i# i# i# i# i# ) i#  i# Q i#  #cap # p # ?# # o# 0# m &# u &# Jp# p# # # #  # # g# # B# p }# }# # Z# y)# ]y)#  # !# O"# q#)# #)# $# w %# &# ')# = (# )# *0# +0# F,&# :,&#Hrs; %% !#%!$ #srv%"# $ D #h# h# /h###  #$q&P#(} P#,P#0i#4Qi#< px0#sv#ɂ#Dɂ# ?0# iid˔#J˔#sid˔# "L#!iidє#px0#buf0#sid0# ptrՔ#bol֔#8!!($ !ϛ !ײ H!< Z! $ N! q! $ `!!%)dow)#h1)#m1)#h2) #m2)#")min)i#max)i#%)˔#s%)̔#A")k?)#`)#t")i)Ȕ!q)!!%)"!%)w!")ptr)$str)reg)מ"-#%,))!#val)A"#ptr)t"#%)Q# len)ڔ#$?)۔#(<# )p)$i)ll)id)<#a)C#IS#$#W%0)i)#ptr)#len)#?)# ctx)## $%)kw):# )+$# %)$# B)$# )0# &) #%$ E %$ Z" $Z$ 0 $ $ Z$ $`$$eB) )!!#kw)"/%#arg)%%# <&)&# {%)'!#S#1$$ $ %$$ %D&) )!#kw) %#%# "/%)%#str)$#$%acl)* )+!# 4),# C)-!# ).# )/0#5%%C)> )?!# g)@!#pol)A# )B0# {.)C#&p7!k?4un5in6.&p2u7%#&x ,r#t0r#t1r#96#6## D#$ #(''h#len0#pos0# sid0#srv#oe0#src"#buf #E'be0!4j' !0#.!#' srv'# # #'Xact.&#bck.&#,'actr#bckr#(#Q # ## ##8 # #mapj'# '#,V'#T (#7(#9(#/(#(# ( (g) #3#_9#R;# T@#*#\#!# .g)! s)) ) %) 1$1%#kw1&:# 1-*#* & 0 0 )2*1516!#kw172*#A*) */SC/O#/P#h/Q# /R# , /;uid/<#gid/=#/>#$/?# ,/@# /A#!/B#a/C#/D# |/E#$ /F#(</G#,/H#0/I#4+/I#8J/J#</J#@/K#D/K#H/L#L /L#Pm /M&#Tu /M&#/SA*# /TD #Y/U#7,>?($(%!#E(&)#('# `,? =8? >#d> ?R#%,? F! G]!k? H7,!? I],? Bop D]#v J`,#&.j>nU'fdmV(?mS(>m.(i$m.)f?oX)p?pW*retqP)?t+-&B,__s~$-~!!~0!$~>!~7,__u~.,__c~w-V)?,H)?,.!*__s$R-!!0!$>!7,__u.,__cwU--&.*>U( !>V( ( /[?W/>*fdS*errd*msg:`0.1.2."T3fdS4/>(U5 '8R6 !)>S7err*V8@/>: qU5 !9>Q8g/%?HU5 !G>Q9l0>g<U:sf$ V:reqf W6Jhl0S6=ip;/r0<0R<0Q=/!7retR; 0010;"00<0P;9001000#101000#<1P11,>0k?j3nowj20*+3buf 20)3buf >0Z$W3nowV?'V>1y#L3nowK?'K43>@U5 ?&5< 5 =05'0:err5 7ptr:l7val0p6?Q+1_l@&%@%+ 2t@&%@%=33@!6h6{?d7polQ6E)S@Jl0+~2@&%@%+2@&%@%=2p!@&%@%.!@/6P+ 3 @&%@%-X7acl%P64:Q;L33"6<4P;e33<4P;~33:N<4P;33m<4P;33<4P;3314;33*<140314>443:?(2044F>2U:px00:l40$ P:l70$:dir05C1Z$5[%1$R45=FU:pxD0:l4D$ P:l7D$:dirD5CEZ$5[%E$6Gp6?GV6>GR6H/S/Q?/>.!6fQ6?:fl6^>fh6|>fd6X>f`A>UB*L55 B*M5B[+5BJ +5B.v5Bw6CB-Q 6D(I0B.;0Enow.;K `)>MK 6' *е6%$B5wL 00@y& $07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez 'D'E#'F#  n # p #e" - e# ref !#R]4&w &xR#&ye#&z0#  &{0#'&|0#r&}0#y9&~0#?&0# -&0#$4&X#( h ! %%#4%#Z%># len% ># \%!>#E%"#h2L40YG o b#$[L[ '#[# k R'#J#t#  w'##n #" # E 0Tn! ! '#!!0# @ k hp 7 k? 42un 5in 6p 2 u 7@# b#   ### bit>#u32 "08 * +# key ,# H 0 wq 1# rq 2# 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#`#  buxa !L fdM># N>#hO>#k?Pk#  Q #R>#$S># T0#U#Ve#*W%#AX#'Y+#`Z# [0#b#)c#  TQ4m1#n>#So>#p># q'# r# s>#$J5t%#(a6u%#,vQ#0wQ#4{xQ#8@yQ#<hze#@e{>#H|e#L%>>> A Q> A,SC,O>#,P>#h,Q># ,R>#  ,; uid,<># gid,=>#,>>#$,?># ,,@># ,A>#!,B>#a,C>#,D># |,E>#$ ,F>#(<,G#,,H#0,I#4+,I#8J,J>#<,J>#@,K>#D,K>#H,L>#L ,L>#Pm ,Mh#Tu ,Mh#,SW# ,T#Y,U># )8(J (K0#* (L0#{(M# fd(N># ?(O0# exp(P0#5(Q # 6(R #p5(S # 6(T #$ ib(UE #( ob(UE #,x (V0#0(W#4    E # (U? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) <#< E#@ E#A e#D< #L #P! #T #X t 0 t str u# len v>#  E  <p  z e#L e# # ! # fe # be # ># ? >#$Z 0#(D #, req E #0 rep E #4 si &#8 k#% k# # srv !#p !#Q !#> '# txn # ># .%# '#2 ,'## Å# ą#, &# 0#t ! ) >#<)!># )">#)## B ]5+8len+90#cr+:0#+;0#.b +C v+D.#y9+E#+F#.*+G#3+H# y*    D *4* l*># m_l*># u*># u_l*># v*># v_l*>#2* l*># v_l*># c*># c_l*># r*># r_l*># O*rq*st*D*P *0# sol*# eol*# som*0# col*0# sov*0# eoh*0# cap*# sl*2#  *e#8 *>#@*3*y#b*# *K # req*O# rsp*O#\ uri*# *#*#I*>#?*0#) D##>#^# e#:+D##^ #a#^##_%#k#`%##a+e"+",#"-#".>#"/# i^P ##9 -- 5 --?.>#!. #. #b . #  .#.#A.# .#z.# .#$.#(+ .#,M.#00.#4..>#8e.>#<.#@."L#D .#~#FH.$#Gb.(#H.1#L.7#Td.8#X.:>#\".<#`. ..# .#B .>#     3/C fA%# bBE #.(? cbC#{D# EE# evFE# G#H#I>#  J#$  2 Jy9># get># put>#u># #I&z(tD# #O# ># h>#r>#>##B"#, acle#0e#8e#@e#H>e#P>"#X srv!#de >#h? >#lh Ȉ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#ؿ#G #R>#7># .%##/>#e#'$# id#+#e#t>#4 >#>#0#i0#0#0# z#0#+z# 0#w#w# w#$0#0#`0##z#### >#8#>#0#j0# 1#w#w#w#w# w#w#) w# w#Q w# >#cap >#p #?#>#o# #m h#u h#J~#~#>#>#># ># >#g>#>#B>#p ##>#Z>##]# # !#O"#q#%# #%#$>#w %#&>#'%#= (>#)># *0# +0#F,D"#:,D"#HF &0#f 0#0#  ;  e#! # srv"!# !T@"J!# K>#* L>#M># N># O#B P#(R #S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#Hk?[#Lp\#\?^#l`>#|oa# b#@d!#d!#e#o f#wg#h>#i>#;i>#%$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v!#hw!#yw#yw#jz0# {1#}w#}w#~w#~w#w#.z# 0#w# w#w#Qw#U>#D"x ,# t0# t1#9!#!#># D>#$ >#("<# len0# pos0# sid0# srv!# oe # srck# buf# "be  4# !0#.e#8#  srv8## ># >#!c#X act!# bck!#,# act# bck#w$>#Q ># >#># >#>#8 ># !# map## >##,Vc##T Ã$#7ă$#9Ń$#/ƃ$#ǃ$#$!w$% >#3>#_9>#R;># T@>#*>#\>#!>#! .% % .%K %D  ># <# <# / <# 7# 7#  7#$q& ^#(} ^#, ^#0 w#4Q w#<V& px # sv Ƚ!# Ʌ#D Ʌ# ? 0# iid >#J ># sid >#m& " ΐ#& iid ># px # buf 0# sid 0# ptr ># bol ># & ( %  V& m& ' '  ','  '"g'H@U# V#!!S$5(;@/'U%s. V&txn05(p&fe1 l'"2;(R' *2;(S('A()R(*[(P+'&h^S, (!-\l,(!-\r.&hXS/e(;9F>0sFe(0pFp(k(v(&1[@>0oU$(?pRU%s V'@eQR28)@>`U%s V%si S&reqE P&repE Q38))J))V)4!5b)P6o))J^7tv1Io)7tv2Io)8retK^u)<2)w@>U%s V%si W())**P)*()A()R()[(3A('V)R()[(/'*y#L>0nowK>9'K>"*h@AU:s@ V:si@ W;reqBE p;repCE S(**)*)*3*sz)*)*<*M-0bufE 9y9>"`,?jU:si V:sii S((+8)?W)J))V)4"5b)P(Q+8))J))V)4 "5b)P,+8"=8u>P3`,)m,3w,*,Q),(+8))J))V)4h"5b)P(+`,_)m,3w, ,*,R),( ,A()R()[((5,8))J))V)4"5b)P(L,,:Q),3,c}),1)6U:t5;s7 V=#*8>p=S*90l=**90h?)?)??($ ,-"@?031)1,-"=?0R31  )1(-1  )1((.1  )2)2( .1  *2R*2W31  *2R*2W(F.1 ! )2*2S(b.10 B )2)2(~.1T f )2)2(.1  )1(.#2 9 )02*;2W4#5F2R(.#2R y )02*;2W48#5F2R(./R2 R)`2)j238)*J)W)V)4X#5b)P(E/v2)2(\/v2)2(s/2)2+/@?0(/2)2(/v2)2(/A(]c*R(S*[(P(/2gj)2(02t*2P*2Q(202*2P*2Q(R02*2P*2Q(027)2(02*2P*2W(02*2P*2W32**2P*2W,0p#;len.>P( 18))J))V).5b)P(41236)23336)3(^13@a).3383@I)E3(1W3a)h33r3k)3383ky*E3P(13)3.8len><1&0bufE <13*u0buftE /#2I#u>0t1t>0t2t>9j>0nowj>/3"0t/3 ~0t}/83 v0tuP;err>S;fin>RBZ %%B ,XB y>B,^BB[-N4BJ -N4B.vn4/Bw> 4C B/Q4B;0Dnow<<B $B0#Ej (1 E, )e1 B1>B Q0BR0B U0B VBWQ3=P00@yd58len9d#cr:d#;d#7b CvD#y9E#F#.*G#3H# % 3@30U len3 cr3 :W @3 e%V new3Q intk&PC<05Ay7i "%2-y&^kint6%>:m?:RA:3CDS7roS UH % 9z DE#F#[7 [JG[# k9 .AJDoBTGQ[ 3   # #   R #J z#t # " w( 234%Y-G 8to bN#ڗ#C#n Y#" # , 9 -g5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .s#8 es#< #@ "3#D #e#F H$#G b(#H 1#L 7#T d8#X :s#\ "<#` # #B s#t  m  3 b#  `  # # # bits#u32"%*+#key,`#n#p#: H0wq1k#rq2k# 3s#04s#45%#86P#< 7#@8s#DJJJ:]4w xg#y#z%#  {%#'|%#r}%#y9~%#?%# -%#$4#(  )8J K%#* L%#{M#fdNs# ?O%#expP%#5Q# 6R#p5S# 6T#$ibU. #(obU. #,x V%#0W#4. # U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) Q #< ,#@ ,#A L#D< #L #P! ] #T c #XE E . K p 4 !W t ] Tn  #! # k auid^#gid_v#`# buxa  !LfdMs# Ns#hOs#k?P#  Q #Rs#$Ss# T%#U #V#*W #AXP#'Y #`Z# [%#b #)c# TQ4m #ns#Sos#ps# q# r# ss#$J5t #(a6u #,v/ #0w/ #4{x/ #8@y/ #<hz#@e{s#H|#L   ss s  / s  V CfA #bB. # .(?cbC #{D# E,#evF,# G #H#Is#  J #$ 5    Y<_``#@a #setb #clrc # Ad #@e #remf #clog #_5h# 9i1#$BjC#([%k1#,Hl1#04m"#4ns#8 s s s    s 1s!C7qp7k?4un5t in6tp2u7I# SCOs#Ps#hQs# Rs# I ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm Mq#Tu Mq#S# T #YUs#@'sUfd& Rdir&sQ (P,A,s Ufd+ Pdir+sREA2s @Ufd1 Pdir1sRTA8s@uUfd7 Rdir7sP!ret9sPG` :P@AsUfd@ Pdir@sR!retBsP"# CP#@JUfdIsP#@SqUpRexpRsR ITsS!fdUsW!iUsQ Vh #AWsd AXsV AXsS!fdsYs` Z_$| P$ P%&&'&&(ks)js*nowjs(+Q's*nows*expsVAsOUpV+_A +@+jA,+A= @sS#APUpS@sUp#tA<U!pR,[,J ,xrs 2 ,t",.vLV ,ws p- , Q_,;%, X,s, Q%,R%, U%, VV,Wk  k NAL  AT &SA @0AyintCBC#SZS72A,A0a& !Ղ7i "-y&k6>m?RA3CD roS UH   S _ %qF p oBTGQz #D#E##F*#24YG o b#$@[E #E#US R#J#t#Sw##n #" #S9 -5 -?%#! # #b  #  ##A# #z# #$#(+ #,M#00#4.%#8e%#<#@"#D ##FH$#Gb(#H15#L7K#Td8K#X:%#\"<#` K # #B %#  S S3( b(#88S   #8#8# bit%#u32"*+>#key,# n #p # " - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @]4"w "x#"y#"z#  "{#'"|#r"}#y9"~#?"# -"#$4"@#(PS )8 J K#* L#{ MK#fd N%# ? O#exp P#5 Q0# 6 R0#p5 S0# 6 T0#$ib U #(ob U #,x V#0 WK#4 * * P  #  U? }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0 #4H %#8) v #< #@ #A #D< *#L *#P! #T #X 6 0 tstr u#len v%#    v p  z #L # # ! #fe i#be i# %# ? %#$Z #(D #,req  #0rep  #4si q!#8 U#% U# #srv #p #Q #> !#txn e# %# # !#2 ª!## # #, G!# ق#  ! |  S] Tn  #! # Sk auid^#gid_u#`# buxa  !LfdM%# N%#hO%#k?PU#  Q #R%#$S%# T#U#V#*W(#AX#'Y.#`ZK# [#b #)c#  TQ4m4#n%#So%#p%# q# r# s%#$J5t(#(a6u(#,vT#0wT#4{xT#8@yT#<hz#@e{%#H|#L   (% %  %DST%  D{CfA(#bB #.(?cbC#{DK# E#evF# G#H#I%#  J_#$ZS _ Jy9%#get%#put%#u%# :#  A %#AM#p7k?4un5 in6p2u7#") D##%#Z# #: f a ^K# _w#k `w# a3e+,#-#.%#/j# q  fP ##   " G5&8len&9#cr&:#&;#b &Cv&D#y9&E#&F#.*&G#3&H# %           D %žE%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%E_D%P %Ղ#sol%#eol%#som%؂# col%ق#sov%ق#eoh%ڂ#cap%_#sl%#  %#8 %%#@ %3%#b%G# % #req%#rsp%#\uri%# %#%#I%%#?%#:F &#f ##I!ST@IJ# K%#* L%#M%# N%# O#B P#(Ri#S%# T%#$5 T%#($U#,6U#0tV%#44 V%#8'W%#<X#@!Y#Hk?[#Lp\#\?^#l`%#|oa# b_#@d#d#e#o f#wg#h%#i%#;i%#%$j%# j%#Rj%#k%#l%#Fm%#ido#p#b p#q#r#us#?t#Vt#gu# vo#hw#y#y#jz# {_#}#}#~#~##.# ## ##Q#U%# Ii(tDR# #O# %# h%#r%#%##B"#,acl#0#8#@#H>#P>"#Xsrv#de %#h? %#lh v##pK#Z #%##%#ς#%#g%#[# %#R %##%#%##G #R%#7%# .$##/%#߼#'w$#id#+##t%#4 %#%##i### ##+# ### #$##`##z#### %#8#%##j# _##### ##) # #Q # %#cap %#p #?#%#o#i#m #u #J##%#%#%# %# %#g%#%#B%#p ##%#Z%#%#]%# -# !-#O"-#q#%# #%#$%#w %#&%#'%#= (%#)%# *# +#F,2"#:,2"#H   ; $$ #$! #srv$"# ] D  %# # # / # # #  #$q& Z#(} Z#, Z#0 #4Q #<  px i#sv # #D # ? ʂ# iid %#J %#sid %# " #G! iid %#px i#buf ӂ#sid Ԃ# ptr %#bol %#q! ( ]   !PS u ! ! ! * !I2"x , #t0 #t1 #9o#o#%# D%#$ %#("#len#pos# sid#srv#oei#srcU#buf #"bei4" !#.#&# srv&## %# %# Q#Xact!#bck!#,v#act #bck #e$%#Q %# %#%# %#%#8 %# #map"# ,##,VQ##T q$#7q$#9q$#/q$#q$# q$  e$$ %#3%#_9%#R;%# T@%#*%#\%#!%# . $!  $%S (% S"m%>B @U#W%Pd$__s"K%du$__s#K&%A(/U'sig'%S&%.BB0U'sigA%P(AAMR"&A]A U)sig^%R*A^%V*+_&P*A`l~ e+[$& +J $&+L$&+.vQ& {+w%u&,S+'Qd&-%5 &eS-B&6 &%S-B&1 -"Bl> <]U6P 0By& 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 09 %-&5 %-?&#!& #& #b & #  &#&#A&# &#z&# &#$&#(+ &#,M&+#00&1#4.&#8e&#<&#@&">#D &#p#FH&$7#Gb&(G#H&1#L&7#Td&8#X&:#\"&<M#` 7    &+ & &+#  &1# B &#&G]3 n #p #]"  - ]#ref !#qFo BT G Qz D E# F#2>40YG Mo  b'#$[>  X# #  RX# J# t#w( X# # n 2# " (#87 [  b [#kk8   @# k# k# bit #u32 "0 *  +q#key ,#j H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7#@  8#Dzz zj]4w x# y]# z0# {0# '|0# r}0# y9~0# ?0# -0#$ 4#(/ )8J K0# * L0# {M#fdN# ?O0#expP0# 5Q# 6R# p5S# 6T#$ibU^ #(obU^ #, x V0#0 W#4  /^ # U ?}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H#8 )U #< 7#@ 7#A W#D < #L  #P !a #T g #X 0tstru#lenv#  ^  U p z ]# L]# z# ! #fe#be# # ?#$ Z 0#( D#,req^ #0rep^ #4si'!#8 # %# #srv# p# Q # > 7!#txnR# # b# I!# 2`!# # w# w# , # 0# ![ x ] Tn  X# ! # k auid^#gid_# `# buxa  !LfdM# N# hO# k?P# Q # R# $S# T0# U # V]# *W# AX# 'Y # `Z# [0# b # )c# TQ 4m# n# So# p# qX# rM# s#$ J5t#( a6u#, v3#0 w3#4 {x3#8 @y3#< hz]#@ e{#H |]#L    #3 #ZCfA#bB^ #.(?cbC# {D# E7#evF7# G# HM# I# J>#$9c> J y9#get#put# u# #)  D# # # P# ]#:D a ^# _%# k`%#a+e+ ,+# -1# .# /# 7 eP # w# q qeF  &0# f 0# 0#p7k?4cun5x in6p2u7#45"8len"90#cr":0#";0#b "Cv"D# y9"Ew# "Fw# .*"Gw# 3"Hw# !           D !‹2!l!މ#m_l!߉#u!#u_l!# v!#v_l!#!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!2LD! P !0#sol!#eol!#som!0# col!0#sov!0#eoh!0#cap!L#sl!# !W#8  !#@! 3!# b!4# !d #req!#rsp!#\uri!# !# !# I!# ?!0#!T@I J# K# * L# M# N# O# B P# (R# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X]#@ !Yz#H k?[#L p\#\ ?^#l `#| oa# b># @d# d# e# o f# wgw# h# i# ;i# %$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v%# hw# yi# yi# jz0# {# }i# }i# ~i# ~i# i# .}# 0# i# i# i# Qi# U#(tDR  # 2# O2# # h# r# # # B_"#,acl]#0 ]#8 ]#@ ]#H >]#P >}"#Xsrv#d e #h ? #l h %##p K# Z # ̉# # Ή# 0# Љ# gщ# [# Ӊ# R ԉ# # ։# ׉# <# G # Rډ# 7ۉ# .ܥ$# # /މ# ]# '&$#id# +# ]# t# 4 # # 0# i0# 0# 0# }# 0# +}# 0# i# i# i# $0# 0# `0# 2# z2# 2# 2# # # 8# #0#j0# #i#i#i#i# i#i#) i# i#Q i# #cap #p #?##o##m #u #Jp#p#### # #g##B#p +#+##Z#$#]$# # !#O"#q#$# #$#$#w %#&#'$#= (#)# *0# +0#F,!#:,!#H@b;    ]#  ! #srv "#  D # # # /# # #  #$ q&P#( } P#, P#0 i#4 Qi#< px#sv# w# Dw# ?0# iidˉ# Jˉ#sidˉ#  "Έ# iidщ#px#buf0#sid0# ptrՉ#bol։#'!( ϊ ס 7!/+ I! =! `! O!!x , @#t0@#t1@# 9%# %# # D#$ #(_" #len0#pos0# sid0#srv#oe#src#bufg #}"be4"  !0# .]#" srv"# # ##Xactf!#bckf!#,%#act@#bck@#$ # Q # # # # # 8 # #map"# "#, V## T  $# 7 $# 9 $# / $#  $# $ $$  # 3# _9# R;# T@# *# \# !# .$! $$ $d 0%C1#?]#g#@]#pol#A##B0#{.#C#$%%#dow##h1##m1##h2# #m2##%#min#i#max#i#%#ˉ#s%#̉#&# k?#2# `#2#3&#i#ȉq#͔%%#%%#6%]&#ptr#str#reg#]&&%,# #]#val#&#ptr#3&# %## len#ډ#$ ?#ۉ#(& #p#i#ll#id#&a#'I'c'W%0#i##ptr##len## ?## ctx#&#'%#kw## #'#%#}(#B#(# #0#&# #'  ' c&'(   ( w((w(eB##!]#kw#"(#arg#%(# <&#&#{%#']#''( w( '((D&##]#kw#(#(c'!"(#%#str#$c'$M)acl#*#+]#4#,#C#-]#  #.##/0#)TD#3#4]#acl#5)#neg#6# ()C#9#:]#B#;]#%))4'#C()#)&]*kD<P f U'px:'l4:  'l7:'dir:(C;(([%;w(P&*EGp  U'pxE'l4E  'l7E'dirE(CF(([%Fw(P&3+CT  U'pxR'l4R  'l7R'dirR(CS(([%Sw(P)y+E`  U( _(E_' (1_ )+tBg  U'pxe'l4e  'l7e'dire(Cf(([%fw(),Cm  U([%lw((El' )_,Et S!U([%sw(S(Es'Q*2u),FD`!"U([%w(V(E'P+MCS,ret-!"+CS)-QE "x"U([%w(S(E'Q*2)F-C""U([%w(P(E'V*2)-D"#U([%w(S(E' *2ɉ.endW.cS/-#+@ԉR-?#B#*@ԉ&._E# %U([%w(W(E'R(}+s+Bl+2h.cW.endd.psV.plS/q.#0@ 1#2@ P3. C%&%U4[%w(P4E'R3.C(0%F%U4[%'w(P4E''R33/E.P%%U4[%-w(4E-' 3x/C6%%U4[%5w(R4E5'Q5s7x/R23/DD%-&U4 CS4EC'W41C 6lenE7/CP0&9&U8ptrP3]0BW@&&U4 VP4EV'V41V 2X]&S22YP3M2]Dw&(U4 vV4Ev' 41v 5ixiVW5jy0Q2.*y0p2D y0l5ptrzS981&'0&~%0~%-&'0~2~P91'0'0&%0%-'0'02P/1#0&%0%1$02P/2$0&%0%10$02P-''0&%0%-''02P394"D(,U4 V4E' 41 5iih5j0V2.*0d2D 0`5ptrW9$3:)P)0&%0%-:)P)02P9n3T)l)0&%0%-T)l)02P/3H$0&%0%1`$02P/3x$0&%0%1$02P-))0&%0%-))02P34B! ,K,U4  P4E 'P41  :4D-P,n,U8kwl,4P(:4D5p,,U8kwl44P1$0\63P5B>),,U44=W4b=V5acl?)S-,,0&A%0A%35zDK(,y-U8kwJ0\L2_CMP5kwlN4W75E_--U8pat^'S;6|Es(-1.U4Cr(W<6--=,6--->86P>D6V?Q6Bl@bk6patm'6tmpm'3277D(@./U4 ?VACe.AvC/AE/2C(\2B(X2E'S21`2BW5argT/7$6end0>E-P//5retR37B)/S0U8acl)2C(S2nB(V-"0-00\38D)`0x1U4 ?V4DWAC 1A\B0ACE02tE)R2eB(S24V38-ED)12U4CCW4DC AClv2A\Bic2ACEgW22tEF)R2eBG(S24HV2\IV-110&L%0L%349Cr0%22U4Eq0%2Ds49W2Es49p2Bt:9P2Et:9S)M)3Y:D0%34U4 ?4D 8polPACd4ADK4ABK45arg`5negW2eEV2tE)\2VC:9S2D49X2E0%T-330&%0%-3302P3i;D4D6U4E0%P8px 8l4 8l78dirAE852D492B:92C(S5acl)P2E'W2[%'2D2jE2SB-556__s 3;.Ca)P66U4E`0%P48C`0V2Db49S2Bc:9R5acld)PBB66UCB$K;; >C$L< < ~C$M<C[%)<CJ %)<C.vI<ZCwm<DC'Q\<<< 0EJB<`p z<+@C/( << )FeC)<n <2%v(&Y^960'Fy& 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez  D E# F# n# p#e" - e# ref!#R]4w xR#ye#z0#  {0#'|0#r}0#y9~0#?0# -0#$4X#( h n 2L40YsG ~o b#$[L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 -C5 - ?># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 e>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#` # #B >#J  C  3   b #  6    #  #  # bit >#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8J K0#* L0#{M# fdN># ?O0# expP0#5Q# 6R#p5S# 6T#$ ibU0 #( obU0 #,x V0#0W#40 # U? }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) ' #< E#@ E#A e#D< #L #P! 3 #T 9 #X_ 0 t str u# len v>#p p 0 v ' p  z e#L e# # ! # fe # be # ># ? >#$Z 0#(D #, req 0 #0 rep 0 #4 si #8 #% # P# srv #p #Q #> !# txn # ># 4# !#2 2!## Å# ą#, # 0#_ !- J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#k?P #  Q #R>#$S># T0#U #Ve#*W #AX#'Y #`Z# [0#b #)c# TQ4m #n>#So>#p># q# r# s>#$J5t #(a6u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    Jy9># get># put>#u># #>p7k?4un5J in6PWp2 u7#) D##>#^# e#:W a^#_%#k`%#a>e+,>#-D#.>#/h# J xP ##x5#8len#90#cr#:0##;0# b #C v#D #y9#E##F#.*#G#3#H# k"           D "&" l"># m_l"># u"># u_l"># v"># v_l">#$" l"># v_l"># c"># c_l"># r"># r_l">#A"rq"vst"D"P "0# sol"# eol"# som"0# col"0# sov"0# eoh"0# cap"# sl"$#  "e#8 ">#@"3"k#b"# "6 # req"A# rsp"A#\ uri"# "#"#I">#?"0#F &0#f 0#0# s!T@IJ# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#Hk?[P#Lp\P#\?^P#l`>#|oa# b#@d#d#e#o fP#wg#h>#i>#;i>#%$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hw#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B8"#, acle#0e#8e#@e#H>e#P>V"#X srv#de >#h? >#lh "#pK#Z #>##>#0#>#g>#[# >#R >##>#>#O#G #R>#7># .~$##/>#e#'## id#+#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z#### >#8#># 0# j0# 1# w# w# w# w# w# w# ) w#  w# Q w#  >#cap ># p P# ?P# ># o# # m ># u ># J~# ~# ># ># >#  ># ># g># ># B># p ># ># ># Z># $# ]$#  # !# O"# q#$# #$# $># w %# &># '$# = (># )># *0# +0# F,!# :,!#H4; !! e#!!p # srv!"# D  ># <# <# / <# 7# 7#  7#$q& ^#(} ^#, ^#0 w#4Q w#<\  px # sv ȗ# Ʌ#D Ʌ# ? 0# iid >#J ># sid >#s " ΐ#  iid ># px # buf 0# sid 0# ptr ># bol >#  (  \  s ! !p !2!p !!I!x ,# t0# t1#9##># D>#$ >#(8"<# len0# pos0# sid0# srv# oe# src # buf9 #V"be4{" !0#.e#"  srv"# ># >#"X act?!# bck?!#," act# bck##>#Q ># >#># >#>#8 ># # map{"# "#,V"#T ##7##9##/######x$ >#3>#_9>#R;># T@>#*>#\>#!># .x$! $ $ $6 "'%E6P7U#4#y90V#?0$ES$-IR$R+W%O 0&%4FP77U$E>\ $-IS'outa7($$0R$V"%FU7L8U#ETS)retVP*% FjP88U#EiV$0kP$kS"6&E88U#ES($%\*&E89U$-IS$ ^V$^W$E>p+[&+J &+L&+.v&,+w> &, +$Q&$Fe(Q[:90^Fy7i 2-y&Skint3CzDH7roSz UzH %z  D E# F# $[ 36   # 6# F 9 -Q5 - ?h# ! #  # b  # # # A# # z# #$ #( + #, M"#0 0(#4 .h#8 eh#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# ?O%# expP%#5Q4# 6R4#p5S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U? }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P! #T #X:p ! ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    F &%#f %#%#<F %99Uctr<R!%VzF!%Qage"%PB99T^imF=%a<%b<%=F:%:F:Uctr9<SuF9%Vv9%;%QzF;%Rage<%PB':1:T^{MFX%P::UctrW<SuFW% vW%Y%QzFY%R HZ%ageZ%PBs:}:T^[FJ .vwh  Q :%!now <b\<:0Fy7inti 2-k7r b#k y  # # # bit3# G:p;U W Z:L;%E;R :: ::+7 T::f ::+7 s:: T;;f !;#;+7 's);,; @T1;4;fQs9;<; vsS;V;s`;c; GFF%F%#G%GG F DFFDtagO Jy3sF3FF tagO Fp;<UsubnewV ~z;;W %R&2 .s;;C;;CP Z;;+ qs;;8%Q T;;fR ;;+7 s;;s;;_FsubnewbFF_G_F_ P.*!F3 W^ @<0+Gy7inti 2-k7r b#k y  # # # bit3# u32"% s32#3 ;* +#key,#oU unewo #y=3>5pAq%MVYleSqh}dT==f%==>>!>%>P%S>V>>>#Go$ u%newo"oldo F% F G3 G F G F VG! F G F }G!"retN~JG#o>[?U "uPx"Vj~>>'&SPRT>>fHG{o zuxz|oF}y~HaG(o`??U 'uPx'V4Hg?l?Yd'H&mSxPWRT??f_Go uxoFkeyy3nG1o@@U 0uPx0W2o(F3VT@@f3h@w@APM3@@APM)N$R+$F%` @A@0Gy7i 2-y&Sk2,int3CDH7rH %<>3G?%9 -w5 -?s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8es#<z#@"3#D #Z#FH$#Gb(#H1#L7#Td8#X:s#\"<#`   #  # B s#~  w  3 $[ 3&   # &# 6 4%G 6go  bA#5)8 J K%# * L%# { M# fd Ns# ? O%# exp P%# 5 QG# 6 RG# p5 SG# 6 TG#$ ib U#( ob U#, x V%#0  W#4AAg5#  U ? }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#,  %#0 %#4 H s#8 ) #< ,#@  ,#A A#D < A#L A#P ! #T #XMp ! ]ss C f A# b B#.( ? cb C# { D# E,# ev F,# G#  H#  Is# J#$   ?= 8?>L# d>?#?FGk?H?I-? B opD# vJ#G"s@@AU?#hfd$sPx&__s&S&!&%$&3&,__u&__c&as[J . v ws  Q!a :m?:RA:3CDS7rH % 0G"fd#s# H$l# G%l#[7 RJ GR# b0 .AJ;oBTGQ[ 3   # #    R # J z# t #  w 234%Y$G /ko  bE# ڎ# :# n P# " # , 9 -^5 -?s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8es#<#@"3#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`  #  # B s#k  d  3 b#  W ### bits#u32"%* + #key,W#n#p#1 H0wq1b#rq2b# 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1]4w x^# y# z%# {%# '|%# r}%# y9~%# ?%# -%#$ 4#(  )8J K%# * L%# {M#fdNs# ?O%#expP%# 5Q# 6R# p5S# 6T#$ibU% #(obU% #, x V%#0 W#4% # U ?}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )H #< ,#@ ,#A L#D <#L #P !T #T Z #X< < % B p + !N k ] Tn  # ! # k auid^#gid_m# `x# buxa  !LfdMs# Ns# hOs# k?P# Q # Rs# $Ss# T%# U # V# *W # AXG# 'Y # `Z# [%# b # )c# TQ 4m # ns# Sos# ps# q# r# ss#$ J5t #( a6u #, v& #0 w& #4 {x& #8 @y& #< hz#@ e{s#H |#L   ss s  & s  M CfA #bB% # .(?cbC # {D# E,#evF,# G # H# Is# J #$ ,    Y<_ ``# @a #setb #clrc # Ad # @e #remf #clog # _5h# 9i(#$ Bj:#( [%k(#, Hl(#0 4m#4 ns#8 s s s      s  (s : .hp7k?4un5k in6kp2u7@# S COs# Ps# hQs# Rs# @ ;uids# $?s# ,@s#  As# !Bs# aCs# Ds# |Es#$ Fs#( <G#, H#0 I#4 +I#8 JJs#< Js#@ Ks#D Ks#H Ls#L  Ls#P m Mh#T u Mh# S# T # YUs#@*s@AdAUfd) Rdir)sQFA_A +P,A/spAAUfd. Pdir.sREA5sAAUfd4 Pdir4sRKA;sAAUfd: Rdir:sP!ret:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 es#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#y9~%#?%# -%#$4~#(  \)8 J K%#* L%#{ M#fd Ns# ? O%#exp P%#5 Qn# 6 Rn#p5 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P! #T #Xtp !  ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#k?P_#  Qv #Rs#$Ss# T%#U| #V##*W #AX#'Y #`Z# [%#bo #)c#v TQ4m #ns#Sos#ps# q# r# ss#$J5t #(a6u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a Y<_``#@a{ #setb{ #clrc{ # Ad{ #@e{ #remf #clog #_5h # 9i #$Bj #([%k #,Hl #04m#4ns#8v sv s sa  v    s   s     p7k?4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5$H 7H8#>#cH*H+%#fd,%#0H"s@FgFU y9"sS!@"S@UspFFU"fdTv Q"dirTs #fHgFGU$ofsh!HisQ!HjsS!jsR%chgksp%fdksW&f1G`G'wS(('V)| !H?s %evD   #s !THc03gqXN0Iy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - ?s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 es#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#y9~%#?%# -%#$4~#(  \)8 J K%#* L%#{ M#fd Ns# ? O%#exp P%#5 Qn# 6 Rn#p5 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U? }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P! #T #Xtp !  ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#k?P_#  Qv #Rs#$Ss# T%#U| #V##*W #AX#'Y #`Z# [%#bo #)c#v TQ4m #ns#Sos#ps# q# r# ss#$J5t #(a6u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a Y<_``#@a{ #setb{ #clrc{ # Ad{ #@e{ #remf #clog #_5h # 9i #$Bj #([%k #,Hl #04m#4ns#8v sv s sa  v    s   s     p7k?4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5$H 7H8#>#aIe%#s1%#0HEsN'NUy9EsS @ES!"I0NzNU"fdv S!INNU"fdsS#pos%V*@sNOU"fdv P"dirsQ#retsPu,AsOOU"fdv S"dirs $IZO#i%P%EAsOOU&fdv S&dirs 'IO(i%R)@&PPU&fd%sS)H0 P?PU&fd/sS)@9@PUU&p8 &exp8sp*I:% *GI;% *I<sl(eo<sh(fd=sP*H=sQ* >sd*cI?s`*G@sW*IAs\'3I(VP+&*7+OsW,:QR-S-Q../QR0X+P&(esQ,xST-"S.-.7.A1T%T0LS,XYUbU.i.t2oUtU..3 HGs4gHGs4HG 4IGs4'Gs5@G 3XHFs4gHFs6opFs6fdFs4YHF 5@F3ks4js6nowjs3Q's6nows6exps%VA2sUVU&p1 S'VILV'vINV'=HPV'_HSV)$A]V`WU&p\ S%Z@ts`WWU&ps (fdusP%HsWWU&p )tAWqXU(p R7[X7J 7xrs  7t7.v 7ws "8 7Q7;%7 XZ7s7 Q%7R%7 U%7 V7W @Is  Is  Is  [I 5 lI % H   Hs #ev  Ki5p0Jint7ri 2-y&dk3C/DY76H 9 -G5 -?!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8e!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3II!IJ(JMdJNRIII  $IElowE#E#CPsNllOJP$9IgpUnfVWdfPQ'9KU_'judtpVRWlhWPQ(' RPP#IUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$)  Jm1m0 C![;!J ;\kb0Jint7ri 2-y&dk3C/DY76H 9 -G5 -?!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8e!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3II!IJ(JMdJNRIII  $IElowE#E#CPsNllOJP$JTJ[bUuZvZPQw\pJ\fpl@'{`VW\DRPPXT8h'P'L&)P4IUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: J!m1m0"C#[L#J L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; @ '1(1).? : ; ' I *: ; I+.? : ; ' @ ,: ; I -: ; I ..? : ;' @ /: ;I 04: ;I 1 U2: ;I 34: ;I 44: ;I5 U617.? : ;' I 8: ;I94: ;I:1 ;.: ; ' I <.: ; ' =: ; I>.: ;' @ ?.? : ;@ @1A.: ; B.? : ;' I@ C4: ; I? < D!E4: ;I? < F4: ; I? < G4: ; I?  H4: ; I?  I4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I .? : ;' I@ : ;I 4: ;I 4: ;I  : ; : ;4: ;I% : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 2 : ;34: ;I4 : ;5 : ;I64: ;I 7 U8.? : ;' I@ 9: ;I :: ;I ;1 <41 =.: ; ' I >: ; I?41@.: ;' I A: ;IB4: ; I? < C4: ; I?  D4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U1 24: ;I 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I*4: ; I+ ,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;41 <.: ;' I =: ;I>: ;I?.? : ;' I@ @ A.: ; ' B.? : ;I@ C41D E4: ; I? < F!G4: ; I? < H4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1.1 /.: ; ' I 0: ; I1: ; I 2 U34: ; I? < 4!54: ; I? < 64: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I04: ;I 1 : ;2131415.: ; ' I 6: ; I7.: ;' @ 81 9.: ; ' :: ; I;.: ;' I@ <.? : ;' @ =4: ;I>41?.: ;' @: ;IA.: ;' I B UC D UE41 F4: ; IG.: ;' @ H4: ; I? < I!J4: ; I? < K4: ;I?  L4: ; I?  M4: ; I N4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I 34: ;I4.: ;' @ 5: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH4: ; II J.: ;' I K : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I. /.: ; ' I 0: ; I1.? : ; I@ 2.? : ; ' I@ 314 U541 6.: ;' I 7: ;I84: ;I9: ; I:: ;I ;4: ;I <.: ; ' =4: ;I >.? : ;' I@ ? : ;@4: ;IA.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < K G src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdio.hstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hPdd9T9,V  99,VV9,Vj:Ve%9^a;dKY#lq [a9+V0co>rzq< +w 9(WVVVVVUrGr<:t=_g'Yf՜W qt8,HFGsuOf39M939M{79I979Ig-9exU59K959KsƠȎWr ՠIrdV꣜H,Kȏ.d-)-WT ȂST%9&DIz~s~GI&d8H~c@999H cU"G2yG~c~+~9 +w qw9~c~+~9@c~+~99~qV~UVe9+~UVU,zU~ wqc~Ɓ)W:bbƚbV:8d6.R:8d6.R7,,vcrWrVddVWƸʳ~Ņƺ7,,vcrr ᭎~uIdH:8d6.RH:8:8Vd5/Q:840Pb,d:*Q>Jb,d:*Vtzt8:/ce7OU19ae9U:V✀v-7;zGJ8dd,d+r<7e5=|-8Vz9W=sW)-b Ȏx9.xqn=5=+nU  ;%urrVg ׀8Hdh  8rr0˸V-rsU s csU+rd5 (V8:VXYXWW~ V^<d32R<RYU9U#rqq4c~9vqUU gVkU)LqrV}2 srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesessionhash.csessionhash.hmini-clist.happsession.hstddef.hHTu,erVq4*:W7:XH9,rU/#'HxcHF$ srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeprotocols.cprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hstandard.h@GHkyUtzUƠGHWrS U<.U<.GHZyU<.9:hErYb+:$9: PK'"pʊPK'"pʊPK'"pʊPK'"pʊ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeuri_auth.curi_auth.hstddef.hUd8,J:,1|8,YJJ:1n8,fŏ)g H cz91|,j8,G )g H cz91|,j8,Gfe8,);!98,gJ=5W-;:8-e3qNJ 4>.=5- =8: Ux93mUc8, src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h;|t*:V*,:eU,I;,qs{>>V: fsU *rey29d**V\GYԸV< 9 R,dW:W;G;*s,5/G<*t,z91%"Lz9>:d8,J&rG f6dqJ>:V8, s+ UtqIH"Gi# f6,6-nJmqU:*J:8dede9 9W/FtGw;7eu+WHsl?n=Gj+9qԫ,rymcrI UdeHsff:8,:t +}G*:5rUc/4 9t+0VrhvU qFd*: Ժ /:uU,8I,cV qw3W<ude }+}+:~+9~9=T:~G+~9 9QrVW2V*gHjCrVUuc;rVW *LPgJydrrU[tGWrVdtV,"P.6.Dr8d*,8H8,H' [tVr8d8,*H8,"8, Œsy9@7su 8:^d\&+,::-W8,ZU&t9 +ZUUsa*vg*h:*IH,l srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonbuffers.cbuffers.hstream_interface.hbuffers.hstdarg.hstdio.hlibio.htypes.hfd.hsocket.hsockaddr.hstandard.htime.hmemory.hmini-clist.h`d8V, ccsf~G~c:::)*-*;d_<:r*,,VV;7x!5fqfq~GGf~Ԁ8;8:*,r*,,VVX8xӕ'5=d8dX<;)-a;,HVV;).lcz+T:;)Wcgm:drwJ,S,Wuc0dpH Tf#~9T(\x9#W2--Ӡ:Rt:s;a;H`I%;hAUdU 7WU v<8:j"OG1cO6dbdq09bS srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h`G GfU9aG@y+@ GVeu%GdS;Td;tr*d,fwqqQ=8-^G.$+hUzG?|G+(Gc+~U=zG9qxqzG?G|9e99sY*GVQqbqdTdV,Wed8++\ 9~=zG9qxqz?G|98f99/cW7Q/9WrԏW:8:*:~+oU~?9A+GY9Y9hUzG?|G+"od;**8V,~ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Ucu~~q-~c~+~U~+9~ocT:::,IR<9ch~+~ cc~qf,?~$cc}d:}+9~9+:~97Ud}+d:*d~Ucd~~U~UF:,b,,}U}+GVdrV}U@UF:HH}Gq/d}qc}U%Gf*:,H}iqU}UUd}q9c9!9=cE;E9;E =Ƨ;,~8R/G8:cӪVd:~9Ye:hR.9 ӏoh)sZC@&#s18,F:z&8 18,F:ml srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h@%:ydH;Hrq:8d:W U[,)s8,BYv"P>&".5! + 5rrr:s4V rtsc s+:d9/bz92zUzGTI.r srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.hP%u;aVdVcoqV*e*J/h';o:etq:V8d9:gbdVdVy+ cV z src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hd9dcG::8,`q f7,8, U<t98:sVrhyqV*9kcGti,:s UXt9<8:2 cUfIqvqe8::.8,O src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hstat.hport_range.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hcfgparse.hgrp.hacl.hstat.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h0e9+d;EefaHGd8Hea;ppcH؉fa.7sd8Hu5/@U~&~ U~9~~U}9 &~eV8r]*+IV8rY+2V~v4+~H~U d~~~9K6 +yUb:pdT8,p:*f GGKd:> w9v q9B &,;qH|U+8,H)Ԝ=8V 8, 8d8,)W9j8v8,8dq09Q9ddw69K9dd`8,;)V81B+ԎpGmsude8#dR:V::::z9U%xU}ƚI: r yBb-oUo9ey9dy9dy9dycy9dy9dy9jyUdp9c5df6f Ԁ,Zd{G*:/ո8ddb$<,,'⪪7Ԫr6ddfz9ddi:: fK8s)g){)d8d$ 8dk+K>) ( ) ~UAKd8,Tdr3R9.Tg\T:bea;7ecI~,d8-8~9H1t8dgGH~,ԸƸ~V:TV!9ycyc9c\V)8~-8I8cs8Zs8js8*<H.?zUb:pW:Re8,Vp:*:H8d8dW7jG&G'.8+IJ87Gb9lcg**Ht8e*r8qs8GJ'~,8dxE99wc;cr8is8bVv,d8kId8G GKTIT %dHH9U  *d:8:8:bd" ֎8%,d8J7-.VĂdTb:u=F,d8/Hd8C,8s8np:*GM%',s8b,1&rWuVd8os8w8&V85#U9 c: )I'8,Hks8I'b,iHks8I'b,iHks8I'b,iHks8I'b,iHks8I',s8b,i&js8@V8xHd8 V8xHd8 V8xHd8)I'ds8I',s8vs8 b,i&W8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8I'b,1Hks8Vd8xH8H'Mbrls8 Hd8yr8 %,t8xs8 '8,&W8~V8I'b,iHW8hs8I'b,iHW8hs8I',s8b,i&W8gs8o8xH83I'b,1HW8hs8Vd8xH8I'b,1HW8hs88xH8H'Mms8 Hd8yr8 =&ffUcfcf+9*8,~ ~Vd8GpG=z9rvs,uHd8vde8ze8 8&8,fdbTd<8dd8hru9Hd8!f@9c* -{Gs8 b,i&~tV8=z9rv~8xH8f8~8}8,xU/U-8sVW7d| cy9=`V;Phd7s w9 c8,oco+9q}cr9}&oUoUcjN圢Vqd}Z-d8dr8rirIst8x}-d8uՎ8oUo+c2%cc#8Վ8vd8=~$V8:~V8: $m98>-d8dVb Ua;);-k*-);k+-Qc~Yc@9Bq :e>g_=5g"c*d8x83#8mَ8j8Hd/Վ8Q:8:b:u%e8#V8d cw9:o9s8m@@@[dwUe8 d8{7,d8pId8r6dd8d}nc̀Վ8*8$8U*8x8md8lՎ88xHd8 8xHd8e[Hs w9d 8xcdv9s8$d8#d8}*8x8 q6S8~$e7`e b;+L'IIZ-;4pd@.brpHVHsd G1 9w9dtn0t+9IxGA"NGqrk#dG39zY*GyY*GjV{:*:֪H;q8z9YU*`RxU39YUi8fT,r&y@;}:d ןf.t8fT,&'h_2a:zY*`xU39YU Kz*^;TRzN+4GL+6GOU1+O9q6 '~q6t?({9zcUrHVzRzӜ'UN+4GL+6G::8u*`Ry:p.& qwU b $,&zcoUqpqU9rrq:ry9;}x9GoUm+mc~98,V+x93y+o99yU ~ srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includequeue.cqueue.htime.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hqueue.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.h&cJW@#re)Jj9d8V,9::8H<DUQ/+Qc uc +,d8:~G8,z* G:f:b;af ndVǢHs ,:r}c*G}G,N+4GL+6GGRHp}'cY+(GN+4GL+6GWo9Y,d9s+$p:'Lm;a Ydbd$xyqqqtoe&v+d   srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.h9:iEas,Sd=cc~'$#sv, G~9,~qUQ:I:~;9~ qoq(i6qt'U;OU qv'vo V_zU<D%Vq 9t+ cK~HM1>@yq2~+( )#~Uc, 9vGJYK&UZ+H|9|;*rVQMK Gv+H|99|*rr}G;E9;9Ec;E9;9Ec;E9;9h|9+|;*r;E9;9cf7YF:H: {Y*G`Gm+n+q{:|9|ZUḟ @y9@yG@f:.  (t{qs)-ui2y+@!>sf6.@(t!7-zUUs)-xyc91 +"!=s Ԑ-7rd xq1dN+4GL+6GdN+4GL+6GN+4GL+6GcxqO92+N+4+L+1xN+6Gc9~z|Yh zc|Yh,pxr X+~=qyqyqLcrzqzqƜ x>9B9nf99c8V1c7sO197e:}qwGp⸎pUzqY*GdUY*GhY*G_dqY*GdUY*GhY*joyq{qxGxşd Z0 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hG",8rycH:,}gV}Xp,tXp,u8VZqdsdpV c:sVF:pV q!'<6&rrftz9 qwydHxqx*:sscUd;JJJol crqMnMq;:8de c"/|Gc||c9SqHHss;XJharr~VdHH5!'gQ{{G,b:b:~bh{4z(I*HHH5!'gQ m&yG:Gy+ybvU qu9ae7-;&V$':8VH;o+,8:yU8s tU=c8:9ǿ+Ir,T: GVr,T:N!rVrV,fUcqhq q,plc+GUƸ:OƸ:#rVH,,_Uhq\qqPqprpx+4>:7/JU,k}qr:T:ckDGI7-v::8e :rt:/V8:a:[r8k>rV%+8d}I7-v::8e :G/V-~H~Uȏ؎UfU:Mȏ؎`H8,gvq 98:v9e 9vUd Jr$+:b:;7:,iwUA+T:8:'Xb:8,d$ ~$yU?z9[zc:>J*f6f6* zc[_= z9w=z9M=fL ^"Gy+ %z^S9-9S+-9!9^!9^!+^U!+^9!9^c!+^q*r!Vi8rV8:H:8dqUA+l 4'4dpUdjmUY*Gcooco95c,6rsԀd Ŏ: 9t9 t9 9t 9vc qy*V:<6f6<6X$Ax+A 9:8d:pcr9UbUrklY*G~c+~++vGE +c7-UmqR d_ c_U!q^9!G^9!9H:::8dx+AyqxVr%$q]WN: #*wcu_xVDvUd GVrilvq qm?z9hUhqFq:9q9 V;%;8pHZ,@y+@y9@⎸d :pyH=53x9<Tld28,.78;+ wU5=g*Z}s 9s9: qV;V:jy9@⎸dd8y+d8 UVd[<6/5ly9 uqe99 Ut9 9e9ce+pq}:beưyNy@Vr9~%9~9.nfrq~U<e@%Ȑ:8:gE:9Ha;&,sts:8,*=6;:7;)-b8f=) ss7- 9:8);:~ 9u99?h99h99d~o ', e:8:ct`.:8HV8=6,;6;:~80=9+:8Ԫ:7eb ct+ 9sxq 9z9bcc?b9b+9bqFq:9q9 V;'HZ,PI#>d +7;88-(/6;H=53x9<TD, wU*Z}t 9s9: +V;(V:]xI Vd1<6/5չ5=d8 ;a>4=a;7e  9wG p9UdHdb:r pcbq aqd qcHddƽb:Vd pcbq aqd qcdddƹZƀ pcbq aqd qc vȪ o9U}$e:6rrV{/rddb*;),b;7T dcKbe7-T:a3Gb + =!9"-#'oŜU@ycjn<<6mrssH9Uqm:*dvG} +9m+9m+W}c X|Ub:8dd8-7:dA)edd1C]\d<6XHr +dE@ycj,)&7-|8e}+ -?@ycj,)&7-~<|d:7V8:,tŨ:u+ qu+ 8 (<&>`<`f rc Udy/eVd7I8g6tH;7WE;u5/rb:8d8e +r88;7drT~r7*:sc Ue*,t;^>d{tY*G d87;7drԎ~I8,Ÿ{Ӝd87:;*7drdnqsc cs +s+c:*vGHR +M*:sc uG+asn*:sc,DH,eI;R :7V:7V:l% Y9*G%L9R:cl.d8 4kƹG:rfGnct8:/cW7Q/9W9dV\c$_qPU l$ srcinclude/commoninclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includebackend.ceb32tree.hqueue.hbackend.hebtree.hport_range.hfd.hticks.hserver.hfreq_ctr.hstdlib.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hctype.hstandard.htime.hglobal.hproto_http.htask.hPAh cv9 Hf**sVFcd~e9dcn[*ddl++xU~?z9.ԜhG:IGHdHw rtc + :8,H:b 9wd@6dU<7;Grrs:dGW>!U<7;IWU:drGzGrr 95V;96eVddH40P G;ǙfrrdpVpy92fq'Er8;U=`<~~d⁝8d:?'#,}IG}Pd:dT 9~q8d,<{+dIU{GU+*:ccb9zӍ 94-d8:8hrtKK6uc<<f{GIIG*Sr:=XkGX(9^GhGv}=`<}G:d}ICdIE;,jy+ G,Ha#curr*dY}Gq;<6<}cWWӀ:<6<`VdƸ6fKdQ!i x]:rsv9 +uqJsgV|W2rsl9+kqK8cuG cfVu)LwUcrs 5/lJ8V1rs 5/lJ8V1rs 5/lJ8Vrs 5/lJ8Vrs 5/lJ8V rsq9+pqJsd*J;H.8VRd p srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.h+?Ac+?9Y9*GCc,'XY9:rs G;q<7snssdyU<7snssdAUT Gq:Y<7snssdUU++:*dvGE++9uGR  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h`;STd8d"؎8Fe/Sc+V98&U`95 ,=\92~=pcU!8,aUGG~d9~,v2c/S9-9U5x+j`% Ud m@7zq:9{U@++o+[| $#zc 'SgWBd*ho,8[?W 9%'d* v+u;d8J<:pg5=,;(7-*=}FY,8E 9F#-K W̎*#tU&F O IG /$*J&#~:pl/3A;d*?:c 9RL,b9N }<G}q~G~w~zGlis#/dK|\}'g;sdȓEe*|cq|*-z9?H(=>4h +*ed : q:*~}9}-9|9}}ӒlishّԀ"*izd Gzd G+Uqg*f+9GHR:6<~nsxw +~cV '$ 8'$ 0 6v' U#'>>zwwzzwzzP=<Gw =<Pe7bd~:b,+s&67e,Ɯ:Vu9 9u9 ~c~99~c9~c_h )ac9erfeG*:*Ǹ*d*H8:̰ :~d~&"uH*:*d8:bdurnd6qf6dw vc +O>g= m <9,+ 9krI+v9 qd $ srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h)jHV:r:YL*KG,`:hq)y96<:Mv+ qxyzUM(ts+Wv+tz?f*cs"6ˢ< ~#9,~qUQ:IƁ>zHUrqUryr,"8rs<8rsr:p:p#)=\9:iEas,Sd9:iEas,Sdc}cY*GsnGr:8,}+Ic:pf8VR~*:c~qr +~~+9~9+~+  9D}]u!GN4vpI:p 7-TIT  *7b<H?|&8:8&:RUq&|b,9UU|q8:8F:|8:8:8'|:,|9:*9d0(:p-V q=,::7VV UZrsf6.J3'u7-zU9z9+s)-uyc91 E U!>u7tź.dd wq1UdN94GL96GdN+4GL+6GJ29N+4GL96GcxqO92+N+4+L+1xqN+6GxN+6Gc 9|7zzc|Yhx|Yh,p{rdT:Vrsb~~q9z%Wur +e6} qxu{qJy=:LGrycr} 9HEƎd?:?zwGG~rbdrdsz3ke}dԀdd+|dqY*GdUY*GhY*G_:qY*GdUY*GhY*jż  +<dyƨ_cf)w>9B9 n f99b 8V1c7s O197e:{HH~H~VeV~zx?wq6qq6#zU>Q8:bHE/7i )WVYEHW,m  srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_select.cticks.hfd.htime.htypes.hstdio.hlibio.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.h&9::8:-J:8:-JG;#HII7;HI<b+:x usU 9T,T,+d8)),zc1sOXZPYMG f *[crH8:+(BrrP>8dtXX RGx*srb:ddS-  `.Wgrtrrrrrrrrr srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h@d:GH-, GdwɜQ 9vJZerUy+ru;xc^0rƎsz Uy+ srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.hP ;9:9:d/V19: S-S-)-G!'fdVWQs,%U=<6:I5=5/::i:),Jr8;%G!'fdV-QsVY'fdWSHI 4>d*Je7-d]YxHeR]8,][z9 9(<#:*L8bs8:rzq,[rv9l H%f9dr9drdNWmf,!'+f\':<rf:):I:,;U=:*Jdv:rVyqz91cWqs +wcrwc,%..  qH8rdH#:X*d)Yr;7e٫?&?IV:H,9*~+<(-Y*HD; srcinclude/commonebtree.cebtree.h:cU~&04 +yz9?z99~U89 q q}U:}++}c89}+q89 czqq88UzcG:J+9qG9/qK+8GM+7cCcw989v9+:cl9|999z+19+9999c8+;{9K srcinclude/commoneb32tree.ceb32tree.hebtree.h<yqk,d&8:9P8~+9999e1d:8::,9~9E9}+:b;,U~+9~99~99~9 U/:8>5:,;+~cqU}:8;*;+p~~yqk,d&8:I9P8+a-9S9/Q9-9e1d:8::,~9~9eE9|+:b;,VU`+9i99i9>4 U/:8>5:,;r+cqq>U|:8;*; +pJ}+U99,c8}+q}Gqqw+q+q9zG}+lG+c*~99.(gqb}+q}G~qw~+~+9zG}+lG~+\g5=-*c|9q|*X=z}9+h+zc?}GRUV9z}+cU9h+zG?}GkU3 srcinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/typesinclude/commoncttproxy.cip_tproxy.htypes.hin.hstdint.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h@!uI<:T[6rs1z+@zq[4> srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_poll.cticks.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hstdint.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hselect.hpoll.h@A)9::8:-J:8:-JG;#HII7;HI<b+:x r6d8:8:eHr8: Udd:Hmqz Ud +8:)WWS;|;);-l9_:Tif9i9 8,*z9P>TfEt6XJX R Gz*srT:ddS-  `.Wgrtrrrrrrrrr srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.h@F!G3,T+:,,*7:T:<:(tKrb UvUJ/+f`.y6;,XcI8*>6=(,:JTHVcI8*>6=(,:JT,8,Vc<)WXxaIS;HrtzU?HXr q~G,as@drrc?lqp~fG~q *G ńP>pdWJ6XX8VJ8YRGu*s[,GHW⸸dzk9.*IV 9,e `.*Krtrrrrsrrr srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_sepoll.cticks.hfd.hepoll.hstdint.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hNG,Hb+,VưJ`+.:t:=Kdb::[ wc +w9 9 v+G U]Z,tqd*r] U +v+ 9;Uu+[X/H*:dG:r$xqcbr9;)H-U,TV  ;7W)7W=7+՜|4f9 vc: qTV*R<(bbc"~;;S/ 7W,}9c}cGVl$VV$p:T}f9}9 T9`qqq>ae6XJ8YRGfGr,fq!rT:dǸd39.*IV 9,e `.*Krtrrrrsrrr. /var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/i586-flx-linux/include/bitslibgcc2.clibgcc2.hstdio.hlibio.htypes.hp}7:;.IKqU~q,lUH qS~r՜UqW)-7;T;V8,-I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$ .C  f.). <.e. E.9.0.*. !.&.x..x.. %.-. 5.=. .. $.. >.. /.:. ... .. n.W. .. j.0. .6. R.. ).D. 1.=. .R. .. .A. S.. .. T.w. T.w. .. g.. .. .. .X. \.. .". X.. 4.. !.. /.(. /.. f.\. 2... 2.1. ... .=. 7.. 1.. <.*. q.F. +.. +.. +.. +.. +.. <.. @.X. <.. +.. +.. +.. +.. +.. C.e. .. +.. +.. <.j. +.0. +./. C.. 7.+..A..z. B.\. [.W.  .<.  .D. .. 6.@. .X. /.J. 4.=. .. <  '.. .<Ќ"  . . A.   | @: R | 4, j !.8. 0, P B.4,  7.`, p E..D. Q.0.V.N.  .X, 06 ..D. \.3.S.,. X, pL ..D. \.?.6.  .T, - ..D. \.'.6. X,  @..C.].0b..^.8, 0 T.., v   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8, @T g..| (# $#@(  .#p} 8# .:.8#_  ..,#@ .| 8 % ` . ".t %  .?. .. .o. ..0#..C.  %@J  %S , %| ?., %p{ ?. % $ % .| &07 &p* T& .... @.. .D&Y a.Y. .B. T&  <.5.... .0&d 0.0&pz ".x& c........+..*..L&  _...=..H&0 .%. ... ,& .,&S .<& [..d.|&5 .J. ...  . . ... )..t&g  .2. ... 3.l....  .$&p .| H+Q pH+T  . K.........<H+P  ?...0H+`  U.0H+@ .0H+0 =.0H+` U.$H+p .| 4(-9 ..0(-t  .0(-Pc .0(- /.((-P\ 8(- ^..4(-@+ . . 0(-p .$(- E ((-pa ((- <(-  .x.N.X(-. 0.....2..D(-E  w.. .. 0(- .((-  ((-P  D(-  .S.:.. 8(-0 G.a. 0(-$ .8(-0 . .8(-  R. ..0(- .4(-` %. .<(- . k.. L(-  b. .. 8..0(-" Z.0(-@#s ^.8(-% B.a.L(-&T .D. ;. . .<(-, . .. L(-/ [. n.. 5.3.0(-0 U.X(-@1- .B. . .L. L.. <(-p8 E. &.*. (- 9 =.F. G.`... ].. .p. }.. g. .z. g..H. d. .M. Z.<. .+. .\(-@G  1.F. ... M... S.. .@. 1. .G. a./. K.8.z.. q.8.. .. .w. *.. .. ..~. t..S. ^.K. &.j. v.T. ;.<(-@b\  ..&.(-bD ,(-bo =.,(-`cA  .((-cY ((-dY ((-pde (-d: ,(- es 5.,(-ev 5.0(- f *. ,(-fE ;.,(- g? 5.0(-`g_ -. ,(-gE ;.,(-h? 5.8(-Ph *. ^.,(-iE ;.,(-Pi? 5.8(-i /. w.,(-`jE ;.,(-j? 5.((-jd $(-`k .| (<kC D<kA M. {. .C.,< nx I.T<n .I. .\.1.$.,<`u 8.8<v ..0<y 1.$<zj '.0<{W .| $>p} .<>@~) %..P.0>pJ .$>& .$>M ,>@ .| (L? L?0 L?Q (L? r (L?n <L?b ...0L?A $.0L?Ї x.0L? u.(L?P (L?" LL?   . .{.'.r.,L?c %.,L?  .4L? . .DL?0 $. .B.0.,L? .8L? F  ..<L?p . ...8L? W. f.|L?06  2.\.U.E.t.l.%.+..<.;.0.,L?pt O.,L? c.L?   .{. .. 1..&. `.. Q.. O...0L?@J B.L?; 0L?б .0L?е 5.0L?p 5.0L?@ 5.0L?з 5.0L?`y 5.0L?y 5.0L?`y 5.0L? 5.$L? .| 0G- 0G* ,0G .,0G .| 0G`  R.$G  .XG@e  .. .v. .4.0#.. .... ..@ ..0.X. ..pF. e.=.0./. .-. [.....l. #..0#. .@4. L.7.p...TG .. ..pd. .<GPY 5..` .,G9 .G . '.\. '.T. ].p. D.!. -. %.?. E.?. #.. D.XG   .). s..0+..@.$G .| <K f. .S. LK O.F. v.!.. 0KT .K Q KQ 0K\ m. tK@x .\. .. b.Q. ;.X. ..0..K+ (K $K6 .| ,M{ _.8M ..$M0? #.(Mp 0M`C .0M0  .0M }.LM .6.t..t.Mo M .&...$.I.4..8._.F..2.. .R. .H. .$Mp | (P0 | P$ P  P   $P@5 $P0 P$ 8P . .,P .,PPL  .P  P | $R@C .,R %.4R0t 5...0R  .| hSP  hSp 0 hS  hS   hS   hS  ,hS c ,.4hS`! *. +.,hS "X !.,hS"e &.0hS" [.0hS#\ .$hS% .$hS0% .(hSP%m hS%) 0hS%=  .$hS0&  .,hS@&d  .(hS&4 (hS(. $hS ,+ .hSP, hSp, 0hS,@ .0hS, .,hS-L .0hS-a <.<hS@. .X..<hS/c ./. .<hS`0  .. .<hS1 !.. .0hS2h +.0hS3 .8hS4 . .(hSP6; $hS6 .| 0Z6 M.,ZP7 Z.8Z7\ .#. .,ZP84 .,Z8Q  .<Z8 .R.0D. | (l[9O (l[:F $l[P:S | (\: (\p; | 0l\<_ .0l\p=n .(l\>{ (l\`? (l\@ | 8l]@ .1. .| ]@A$ ]pA  ]A  $]A5 $]A0 ] B$ 0]PBR .,]D ".,]`E@  .]E  ]E | $t_@F' t_pF" (t_F ,t_G? (t_GU (t_0HX (t_HN (t_HK 0t_0I x.,t_K- H.,t_@L .$t_L( .,t_M2 ..t_PM | $aN' ,a0NJ ,aNP aN2 (aOt (aOc ,aP .$a P Da@P ..T.X.,aU  K.,aV  .$a`W( .,aW2 ..aW | (tdp | (d totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavail__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgosrc/haproxy.c__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnputcharbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognameforce_persist_rulesdowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authnode_copystats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_namestats_set_nodeout_realmstats_add_scopestats_set_realmstats_check_init_uri_auth__lendesc_copyout_base64ulistnew_nameout_ubase64stats_set_descsrc/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sunout_nofree__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_rvalue__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpfromdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.chex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_strst_sizeatoiforce_persist_rulest_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalnew_leninit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportnew_ptrcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uphttpchk_build_status_headerout_errortask_newsrv_hlt_stprocess_chkfd_insertpc_endevent_srv_chk_rsv_statependconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledtick_addsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterratioevent_srv_chk_wsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrv_dynamic_maxconnpendconn_addsrc/queue.cpendconn_get_next_sesspendconn_freependconn_from_srvinit_pendconnprocess_srv_queueget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportout_free_sessionladdracl_testsalensrc/client.cmax_setpatternsacl_keywordmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchbuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_closeout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockfindproxy_modeproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxmanage_client_side_appsessionhttp_msg_oodhttp_msg_rpbefore_crbuffer_abortdone__tv_isgehdr_idx_set_starthttp_msg_rpreasondebug_hdrHTTP_200delimhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdrret_ptrapply_filter_to_resp_headersret_stateprocess_responseacl_fetch_stcodeacl_fetch_chdracl_fetch_shdr_ipbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stveracl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiepathlenquotedhttp_msg_rpline_eolacl_fetch_chdr_ipacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqverhttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urlapply_filter_to_req_linedel_colonacl_parse_verdel_cookiehttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentbeginfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valsessid_tempother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crrequest_linecur_ptracl_fetch_hdr_iphttp_is_tokenauthenticatedhttp_find_header2http_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setreturn_srv_prx_502http_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntasessionreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxperform_http_redirectnext_responsehttp_process_request_bodyacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitmsgnumhttp_header_add_tailhttp_msg_rpcoderesync_namenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapapp_cookiesacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrprst_rulehttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshappsession_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_erracl_fetch_queue_sizeprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queueacl_fetch_avg_queue_sizemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvparamsfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serveracl_fetch_be_connsrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdacl_fetch_fe_connbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serverssrc/stream_interface.cstream_int_returnstream_int_check_timeoutsstream_int_retnclosestream_int_report_errorsection_typesrc/dumpstats.cultoaprint_csv_headercurpxstats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cafterfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_match_subacl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_strtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrprevepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01BT X b C Q y \ M h A 9 Ay\ d HY 58;Cru~x{ct~7V~-L PSYx1;Oc?I9CQeFPcjEcj C*0yq s Ni$,68BG^4vAFchQY^h T }nq@C    X |   7bqCn@ #09""!! UL"{" ! &A&$"%$$"#*OTOENbN7% &N*OMMA&X&`%w%N*OMM% &z%%)s*-7-c,,*[,CC =[=<<564544c-1/0001}2222A34CEG[=C"<<5544Q99::H:~:=?A]B\@'A >>>3>9?\@]BB'AAW?^?d??kDDD E EFEIETEFFFGIJJPJ}JKKKLMX6ZWXV)WVVTOOMENPQ˕CuQpSu!RpSWWXX[y\]]\][:\]]^*_2___ap˕/aaa bbbpbbccfWgcccdWggdddeg heeefrrffhhā|hiƀjjj/kDkkksll,m4mmmpnxnnooo?pqrāss8 ttHvvuHv{{z{3||zz{{{ {|3||}}8Lń-V܆K!buwȊbڌb ڌJEڌqsvxӒ˕CbӒKƖBowPo8@6)̥٥ʥ~͡OС֡W)BOwW)BOwv eflE ;  @ H K E [  Q X `  ; }fV:Xp[p7pfy  7 e +&9n9Pn9P&7 o P rPc06cySfNP -G " GZI O -] p U W y&Zkqv~  0&%B _ ] i U W H T o    V \ J119>Ts{Nf#qv6u "  `!!!!!!!!z!!!!!!!!#$8$%J+d+r++++.#.2,M,--,7--.T///D54114441:144=1R1X224h4244D5h44h4444J9d9r99 :c:Q@@3@>@^?@>>"==:<o:r:i:l:;<p@@<<;;@@;;d<y<?@<=>@Q@@3@\?^?>U?=>=>>@Q@@3@\?^? ?U?>?=>@@>4>>?z>>>@Q@>>3A8ACAIAAAEJOEJBEF2FbEECCbEEsGvGGGGGHAINbNPaQzjjggg?gffMdvdcd``k__\^Y ZJXiXQaWPPzjjP\Q\QaQffcd``__\^Y ZT?UTT\QaQffcd``__\^Y ZJT?UvRSYYYrYQU{VggeUiUggsU{VWW ZZWJXO\\jjBjLjGhigh%]^ffcd``_]z]ff^k_fg$`` e!ea0b]jzj jBja%b jBj0bKbggbecf;fvd e;fUfghGhshshijjrrrrV2 _- p'rm o s {}={"gV ~^(0<!0'HV ,`=IP`:F$%h,,,+V+P*$+*-*8)d)&',,V+f+$+,+)8)'(''L,h,d)*U0c0u11U0c0u11k0u133a3p3?3L3z2$33333%'/"[}SV=P %+ik}SVCP _ =!#1E! l 1T 1;!P1;;EP;EP!#&$&%%#v%F&U&[&]&&'@+[-'* ( *,,7** ** (&(,,7**G();(A(2(5()(,(@+,,[- 04<@t l    9 # BKNP{/ G M m  ) * O T ( H z ]e$7vg$SBV Se)BJOi73P369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_'*xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh07 ?(( `GoTo\\@c 8l ԏ u%pԒ{.GG ||t  <HHPPTT  x|  (h ( 4FQe@Ƶl2؈ /m- 9 dF0z ^JQ W 'R e @8'v 8- 04Hh(\ԏ  Ԓ   | HPT   !"#$%&' (/Ę >I/Ę Ę  HP8   D!L.<PHp >^/ DHL`(5 (2=HnMR WagsĮȮ@@\ldpx 2 Ю  &1 >tDGR[dj uP  p 06 pL -  0  خS *@J 8| Fp{ V f t|t Y p TT P p D'@b\ 6bD Ebo T`cA bcY rdY pde d:  es ev fE gE iE `jE  g? h? .Pi? Aj? Sjd b$pp pa  @  f `g_ Ph i `k kA &3@ CD QH _@iе yp @ з `y y `y  0 Q 3 r Nn gA Ї "   P c      0 7  F Y | e ` x @ \   +  |е @x T T  `T / 6 C M W c $ o L w     @5 0 $  T   PL      P     p 0 % 2 #\ = 0&  J -L W -a f 6 q z ( \       ` c @A$ o d w pA  A  A5 A0 B$ PBR D `E@ E  E  l  p  t  0 @F' c pF" o x  F      % G? w GU 0HX HN 4 HK 0I = |  K- @L L( J M2 PM S _  g  q  x     N' 0NJ NP c N2 w Ot Oc P 4 P     @P   =      U  V `W( J W2 W  @ D X Y   \Y" , Y" B Y< R Yk f [ m /[ y r~ sH /l^ u v8 v v H  l^/ `| a a *Lb> ;c\ Hc@ U(d keF z`eO e] f\ lf2 f0 f t     /\ $ ,&4\v >ԙ! D/l S/l _/ m/ F /p  ж= b  C ^ #; /Pc Ef Mnh^ j  |K ** `0 ``(  "` 'p8 1d <#H 5 Y2 _@h H1 . p} ;,@ Z1 )` #  .` =O1 X1 i2h x 1 @- 7\ YLZ; 7 - %'  -   :p; H1 O VM ^ t/T@ T   0 p 0% - t &5 4@ KV` fPS r@~) =H0 @T v  0 8 - 0@ <"6 (79 I Y- \ szMP    <_ 0 Z/  ^//5 "N /`u AS3 \`& e sPY   ' 0v D7<@r 1 @& '  A00 J@( Xp j" :F T0 I  w 1PK   !kC (4 6PY  B Of W0t g@ wpz  # P    @1 '@ 2@O GY c "X q@ ~`-  C  x  nx "e :I p ;pJ )`+ 5 G:[ ly&4 Z 3 1 v :k P:S 6  P $- %57PU G$Y= iR v/  @1- _ `1 X0?  7 5pP ?`C V ex:   б `0 &  ;@#s Q (p, @ c No b E p:p: Z ,- $(0  @: P, $:: ` E3V \gB{P\ 0 C Ќ"  .% @7@. 0" #A3 C@L{ cP0 r  P%m / P7 X07 pC /  7 O $  - A pt W   i  v (  P) $ `z p 06  Q 0 0 !D-  !)!%= 7!P84 C!`? P!W!` i!,! !, !1 ! ,+ !` !4 !p{ !H !{ "= "= -" C" M"Ы} ["@C g"9 w"/"O""1 "p "" "p@#0#@*#̮7#P6; I# X#0\ `#- m#l) z## #P #иC #: #\ #@ #J #4 $#$`1 <$Y$86 k$6 w$гW $\ $(. $,$9 $A $d $@ %S %0 (%` 5%@&d C%S K%b% m%P{%&T %Z %3%  %:%  %8& &#&P %&q7& N&8]&  j&/s&c&:&&&> &`- X&X&[ &t &>{ '0 ';''+' h C'bT'3h' v''=' '4 ' '@: ''p' 'H' (8Q (^1(`  :(SO(p=n \(" j(0 (&((((E ((@+ (\ (@e ) ) -)@C :)p} H)ЍQY)`' a) h)`p u)%) ))3 )) )t)> ):)0- ) 9 )p */c *@I 0* F*hX*@J o*0* A*u*zj *:*4*{W *5 *L + Q +A 2+D=+/ C+S+ ]+/ <h+<q++ F +p8 + + ++= +++% ,> ',E,  M,Y X,/g,7 ,,8 ,9O ,, ,;, , F ," ,0# -  -` 4-   ?-DT- c-:s-\ {-/--`! -g -  -0 P--n --:. %.@G :.1 H.X.`p<a.m.@ w.j. ` .03 .@. .   .p .l .p* .9 . /=/8#/ 2/3 D/pN/\ ]/g u/1 / /8- /$ /y // /70l abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidscfg_nbcfgfilescfg_cfgfileoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.2sa.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerdefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_chdr_ipacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_shdr_ipacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_valacl_fetch_hdr_ip__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_rateacl_fetch_fe_connacl_fetch_be_connacl_fetch_queue_sizeacl_fetch_avg_queue_sizerecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleunix_sock_usageenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroyinit_default_instancegetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlinefindproxy_modeeb32_inserthttp_capture_bad_messagetcp_splice_initfdtrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserverhostnamesess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0manage_client_side_appsessiontcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0stderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_mallocstats_set_desccfg_parse_listencheck_config_validitywaitpid@@GLIBC_2.0acl_match_dirunix_sock_usage_msgparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0str2sa_rangea2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requirestats_set_noderegcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingurl2ippcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info