ELF4 4 ((%4444448&8&8&88d&HHH Ptd&Qtd/lib/ld-linux.so.2GNUaiW@d,eL)NB>(&M/8a\K[cUVZ`Pf96H<Ig bX4EY 1A Rh3$_T;^O "!'2 #*.0=C:?7%QGSJ+F5-]DK(=H1;`Y/u=H0A7gM"//vD7IW1{o@b*:; :Z:5/%7q:;]:CPW:3!B5.AQ7*OWh i h,#3L:8#q@c6:8XGhg ;b3,b=^S#(@ t:hyuO:i$G;DJ:|h 8/t:  @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_putc_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii Bii Lii Vg&'3TW̷зԷطܷ       $(,048<@D H!L"P#T$X%\(`)d*h+l,p-t.x/|0124568:;<=>?@ABCEĸFȸG̸HиIԸJظKܸLMNOPQRSUVXY Z\]^` a$b(d,e0f4hUS[%WA[5ķ%ȷ%̷h%зh%Էh%طh%ܷh %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx% h%h%h%h%h% h%$h%(hp%,h`%0hP%4h@%8h0%<h %@h%Dh%Hh%Lh%Ph%Th%Xh%\h %`h(%dh0%hh8p%lh@`%phHP%thP@%xhX0%|h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%ĸh%ȸh%̸h%иh%Ըh%ظh%ܸh %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx% h%h%h%h%h% h%$h%(hp%,h`%0hP%4h@1^PTRhhQVh`CUS[t[ÐUPP=t HҡHuÉUQQtt hfÐUh4$(fU hh@hXPjQZYPj ÍUPP LPEh@Ph`Pj^v'UPPB衩UQQjRtfUPPF逩U]G&UVS5  h(9J^dQhTjV:uRR`P\PC4PC$P"Cuv"PPPhh^h` (h` h39h` hjVa: u^dNh RPPPPPPSNluPRhh^h` n@PPh` h8h` hjV9 e[^]ËQRPPPPPPSh(h^h` 0jPPPPPPPSQRFlPFhPPh&'UPP֨0UWVS$E} EEu3 E= X= : : jjlH: : : : 衍\CWkB0x_7(@  v@PPj/PuN8-usX@^HUtɋC d Sz9L= P؃u RXPXP${Eu F$EFPP_^SFYV R1ҊA% ŠC1ACC=C1C=CېUSQ]{t]Ë9| C]RRjPh= C]Í&USP]C~ t C]PPjPl= ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P1C1]Ít&PPjPl= C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]fABHHIHH]ÍvU |EPLHP@Lx|]Í'UUJLBPABPBLBPBL]ÐxUV1S=xXtC0uCLX=xue[^]à SЃ ƋCLݍ'xUV1S=xXtC4uCLX=xue[^]à SЃ ƋCLݍ'xUV1S=xXtC8uCLX=xue[^]à SЃ ƋCLݍ'xUV1S=xXtC뇍&E ;]%uve[^_]ÍE9sJ'UUEutËEPE PR/ ø7#ÍvUSQQ]jnjh $@1҃lwRPSh"f  Ћ]ÐUU0 vv %&]Í&'USMȊt-1Cu.t:t _t-u Au1[]É[]ÍUSMȊt*1Cu.t _t-ufAu1[]É[] UWVS]S1Åt^PPj:Su1t@jj jPƊ<*„ Шt7fff Se[^_]PhSju S`tȋ@렍&UWVSE}WDžPPj:W|1EtBCPPj-SƅFjj jSojj EjV]Ɗ<*„ ШtHEffE UfEE0 WEe[^_]PhWju W tNj@돍&B'UWVS(EPǃ1txEU PPj/WKÅpPPj.VtCMSQVjtRE RPWjtB W؍e[^_]ÍvEjj PV{t UtF:tA1à W$t@U 렋UE RPWjuà wt )ȋULE>'UWVSEuEuE}uF11ҊڍB=UuE@E}}EtOFYЀ ƒ.%u3 vE.…%t8}t2GEu}~E UE)[F^_]Ív1[^_]ÍUS1ۋU t&ABHЃ v[]É'UWVSP1ɋE]߉f@f@E E9vl1C9//:%uف//:u=K&UF‰U9wE E}pttht1e[^_]Íe[^_]ËEPS'^_tӸP;:t fUfBCSY'UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEAAFA U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&fFPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u(f | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPƃ1tPSWV9e[^_]ÐU jhh u: %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVS1M]Q]U EE)Ћ})NjS :9s}C 9v9~ME)VRURPE EPEPE PC;E vCC$;E vC$CCхu;C(r e[^_]ÉCuv'UWVS 1}U ])ЋU)‰USE 9sqC 9v9sy)PRUWPuEujC;E vUЉCC$;E v}C$sECхu;C(ru e[^_]fuCu{}uM PWVQo|vUWVS 1ۋu}N99r e[^_]fRE )QE PE PEE…%uTF;E w>F$;E vF$FFхu;F(re[^_]F뻐PEP]SM QE U D 농t&UVSEu] PEPF)RPV)9Fe[^]ÍFe[^]fUWVSE} EE]EWhMQJ W$RG PGPGPGXPh@EP%E G9EvEEPSh`uV;]}3ރtvPD;XPh&EPt2C;]|͋EEEE E,e[^_]'G냋EH9tPPEPj C봍vQSh1URdPD;XPh&EPLwEPjjh:믐USDt0tf: EčERRPEPi蔿 ] PEPEPEPEPhPͿ S]SQiZPݿ]ÐUSDttf: EčEQQPEP Uȍ] PERPEPEPhPMESPP[ Q]]ÐUSQ]ttERPE PS$(]ÍUVSuPPVP蔾tKye[^]Ít&'UVSuKxPPVPOue[^]Ít&'UWVSEE u]= Ȩ: ;HG9EPS)PRbE^);EQED Kx(EE‰EEEx2M D ÉD D D }G}1;}t&D1һ@fftD3 G;}|1;}Dž||G;}|[|E@t*f>tED|E 9D)|D)D);E }E »tt dd0gfffttKttU)ʉttw)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]fA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh: ]\: ‹ : uȁ?BEU;: %PEh: P~E 9E%EU: :  : Mb)ʉ: ҍ)Ѝ: : £: e[^]f@B@UE;: 4;: )E9FRU ؅t1Ph: V: U)‹E +: x:#: : EU@BBUWVSE]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9ufu#P<ERhPe[^_]ÉڹQPЉ )ʋMRhQүU‹EHUE%&E.P)Rhh莯EEvڹPЉ)ʋMRhQFU‹EHUEf?ډ)UWVS}W|= 5L0$\0 … ШuAf\AY C@Y ;|rA D3$WDX= Hx4 Ȁxu t&Jx (ʀ8t X= e[^_]ÉA됍t&'UWVS 1=9}-1PPEP4; P[u ǃ8; F<9|Սe[^_]ÍUWV1=19};; tF89B8~A<9|tF8t VV$uF8te1^_]`= e^_]UV1S9}1; F<9}"tS8t FSS(<9|ލe[^]Ð&UWVS EPjjhEEE 19; t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<998; uP4; PEhP֧8; MQj jhC; $,; EPjjh~E@EPPEPCj 軩 <9cv}19} tUB4uMPVSh4Qe1[^_]Í&UEPjjhziRPEh)PҦ'URR= uà h`= Ѓu h`= = 1ɉÐUSt'B  HC Ћ]á19p~tLJ AJ 1҅t̓ EP4x8ڋEC CEC@뒃 RhV믡P JP 1i&US]CPqXKQgtP JP ]HÍv'UUu&B @ H]]x&U jjhYLT ÐUWVS }u}t<\tFGuEe)[^_]F1ҡDPt50MFT~~ӋM )RSPW߃듐xtFGFF 0F0 w< v`獶UVS1]t <\tCue[^]Éލ[Nt1ҡDPuHxtVVPh` 1C븃 FPt ^FPt1C눍vUVSu]t VXt e[^]ÉËuPPjjU PUp Pe1[^]ÐUWVSP\`8`dRRj,PJ`t @`PPj:dP蓥Å PPj:CdPrUhPhjRS pfDžh PdWj 2 PPj-S譡W@jj jP2jj jS!Ã@=G=v)f fFVh  = AC = 9cPPhjY hƍ@ hRPCFfh uf fFVX 뎍`t`8[ \Pe[^_]PhhjPdfDžh<*„ Шt+DžlPPj-SVjj jSPlPdPj虠g dPtl@l?SSdQhB?\ZP&e1[^_]PdVWh PdPSh QQdRh]PPdPh{뤐&UVSM ut~,tt1te[^]û܍v RUt,RSRPuV]SMQhPe[^]ú7#͍v'UPP1ɋEP89P8tEM PEPQh UPP1ҋEuËEPEPE PhRÉ'UPP1ҋEuËEPEPE PhPÉ'UPP1ɋEP@9P@tMEU PQRh UPP1ɋEPH9PHtEPEPE Ph  UWVS E} u]ESVWPtEEe[^_]fESVWPuًMSVWQ!uƋUSVWRNt뱐t&UWVS E} u]ESVWPtEEe[^_]fESVWPuًESVWPtĐ&UWVS E} u]SVWURktEEe[^_]fSVWEPuًEe[^_]fUWVSEDžttu$te[^_]Í&t"u.븋 t e[^_] t# ugu  u uu5UB8jj jPt*u2=UB8tqjj jP1{1uu1Ciu1Cdu1Cu~5`UB8tjj jPٜ`#:Wu V]ShpsDžtSu V]ShNDžt1gu1Ciu1Cdu1Cu5dUB8rjj jP2d|uG`u+v E@P_t{@ SM QURh69d E@P还td@QPE PEPhՙ_3V輙ZYPWÙ^SUJQU REPhXDžt {茙_3VsZYPPz3_VUZSM QURhPE PEPhF?u5hUB8jj jP褚hFlurUB8jj jP^l=@= @ h@PE PEPh l@DžtERXN u1puۋUB8jj jPǙpW u1xuUB8jj jP腙x`u3 RUB8 P!g U1۾B8E Y X}D8(%U tV贇;uӋE;jPE PEPhD-PE PEPhhDžlX MQ:t&SPPR2BuU EQRPhDž 6މ(PP;u鋅@ L޿/}_@I lP贆X\P訆XXP蜆_5dV菆 x[Q肆ZPvXPjXlP^X=WQ^XSDY`R\-d tP @~H(@ZF1iu1Cdu1C@,UB8jj jPă5(ll 9tꋽl9luփ E QRPEPh DžcE }SPWhDž>M UVVjSQRjP t DžUB8PE PEPhXsu}PE PWhDM} uPWVhyuPE PEPhJ1tu1Ccu1Cpu1CBg n1ہ@ UB8 M 3 UUUU}@:1au1Blu1Blu1B! 1ou1Bdu1Bdu1ByE _}PE PEPhWDž(x1au1Ccu1Clu1C@} OQ芩t* WRPE PEPh趻Dž PP(0PEP$E} u@PWVhLnu]>u WVSh?Dž޿j  @}PPjPE PEPjW t DžUB8( T? DP~MX(AP} D(DP| uHjj jF P| LjPFPt] >]u WPVSh ruE RPEPh߹DžH(PRRh Pz=(G%GEp>uRF@FC}~~PE PEPhDǸ+MuD81C <*NN7T ?^G+@u1^iu1Cfu1CtM8PQ0PEPm#E u A(]PX ]uD8DžCtX5(FFu@;u=(PЃ H!ƒ t1PE PEPhΦ(QЃ4H!ƒ4u ]WVSh胦PPjG=(PE PEPPWi ](J!J މuC5(FPE PEPhDإ<މu?5(Fs(Z ÉZDžމ{ 5(~~#uvuD8t9DžEPE PEPhDžZU } uPPWVh Dž) I uD8 CDžMPPjPE PEP(jP t DžuF8( H,Qgg}Z(GPfC,USSjE U QRP(jPV t Dž (@t9du ǁdu^t%uu1Cru1Ciu1C}G8tuRRPdPԉPE PEPhD膢PE PEPh(Zu ]WVSh0UB8QRRPdP聉QPE PEPhDá' >J @ UPPjPE PEPjPr t DžMq u1viu1Ffu1Ft%M8 P(S0PE P #E A(tQtp E RPE PEPhk DžMPPj} u(PWVjSY t Džu^uB(H@Hv} uPWVh8J" (PPu ]WVSh葟+I/uF8txSSPdP豈EU QRPhDw}u} PWVhH}PE PWh8躞-}G8WWPdP] MVSQhDMMPjPAPЕ} uPWVhtcPE PEPh՝93: G E@81=12fGu*u% _t-€.%u F<1ut <7t6E HQE RPEPhޜ BUPPBPdP݄} uPWVhp菜Q M1I9tx1} CQm^t08uRRVj_NjE @PhuJW`U4B 8uv8u (dVVWPx W_PPdjP臃} uPWVhDi(dQQRP艄PE PEPhD}PE PWhDžX [މ5(^^M U ES QRPh荚 Dž duD8tJCDž<#މ5(N Nu PPE PEPh DžTqBuD8Cjj jP[--k PPE PEPhh DžvމH}D.W@RRj.PXAu \SH( LQ[F}u} PWVh莘Dž }1 PxZZËUDPbZt 4$VY}XDP(PhVSM[(W[( #u TRPE PEPh(y EU EQRPhJDž6 uyAAU] M2VSQhp_u M U~WSQRhŖ )޿F 0}W:QjPRO(( dPV|vPE PEPhDLU}BPE PWh8+ WY ] MSQhp蒕MPE PEPhPcMPCPhtJVYUƃ8u܋J7UPPj=(BPE PEPHPW ](DJ!J= @UPPju :]WVSjQ蝴 t DžMRRj:APT} GP蒂tL(BAB AB$A B(EPE PEPhDžhu ]WVShד;uPE PEPh訓 @MPPjPE PEPjPW t DžuF8\ } OQ踀  W}RPE PWh DUM USQRh豒Dž1lu1Cou1Cgu1CEX;t-@8u;t uF8u%U EQRPhD*Dž P菓Å)}G 8U1B8pUB8/. P…xB|BEB fDžxEfzu fDžz(ue xQjpPR2T((u]~u WVShDžzu ]WVSh|DžUxQjpPRS(( P}…t\xQjnRPbSfDžx P褑DžzMAPE PEPh>$S Mu ]jkyWVSh  Dž} P9ƅG PE PEPhD떋^M USQRhLBAtv@1iu1Bdu1BLuD8jj jPQO=|` @dt9t ;|n苅E<>RuBǃt tI tC (PlBPlCCtՋfu_fftfffuCCufffu*(t7fx t&f@f%ftKKPf@f؋} uPWVh詋 PE PEPhP (xhGxhMEU IQRPh>fDžEPE PEPh^j}D8jj jPL~6tUw}EU QRPh rM} uPWVh؉<  Vw5# CC}@4!} DPK CLQJC_] MVSQhd脈 PPE PEPhJ 鮿} DPAK CDPAJC W66F6  (L2}D8 PeJ}jj jDPaIff} DP?u…tOBBB 뮋EU QRPh 讆UDPE PEPhw۽"u_tDž@t4P}jPDP}uGMb uFǃ } uRPWVh 褅 5}D85CCP PP|Wzt…4C\BC`BCdB Ch9tgA=N4F4:4924)PPrD6PjH1ɉ‰p 0~fDJA9󋅸U8*5}t>_48%4CC55u 9n}jj jTRFC<}RjPDPX{tLuV}jPLQ{p4VV}SE U QjRPh\  遺 RPE PEPh  JP}jPDPbz=tz}jj jDPDƒD8.Fu]}  (Džwǁ$ >[}D8PPPDPl (!ÉE;a鵲UM ZUSQRh4!{Dž銲 YYQ>$(<tRjhP=5(}džwDž> }D8BP PPDPj ( !ÉE;agUPP} uPBPPWVh\y Dž-މ}D8/ Pd=XD(P<(  Po; $UPP} uPBPPWVh\x Džbމ}D8 Pb jH8tRjhP9,(ǀ0Wϻ:MAPE PEPh8vDžu U ESQRPhxuv DžޭDžuPPj} F(uPWVjSS t Dž( ,Q:=(UGLJ,% GB8}w > P74$7MAZ8ts P7à S6=(,ZUYB8uMPA PAPhS,P8 0骬Z 떃 PU7p4$J6(,WhV,VB8 0[ j 6tRjhP7,(ǀ0ESSjU HEQRP(jP螔 t Dž(t B BA A饫}PPj5(G}PE PWjV) t Dž( ,S7(Bǂ,% B7tuh P5_V5t4$4(,EYP R@PhV,W6 0颪 jQ4tVjhP5,(ǀ0`EU QRPhDr6} uPWVhr V(jphPJ5( jp(h$ P 5(|@uPPjPE PEPjPܑ t Dž}G8&QQj je5 ËEjPRS&(jjSP M}P5(E PWVÓ 鶨MUM SQRh#qDž錨@}PPjPE PEPjP t DžUB8\&QQj ju4 MjQRP&(jjSP}5(P}E PWVӒ ƧuM USQRh3pDž霧@UPPjPE PEPjP t DžMA8QQj j3 ujVRPu(jjSP-}5(P}E PWV ֦EM USQRhCoDž鬦  @UPPjPE PEPjP t DžMA85QQj j2 ujVRP(jjSP=}5(P}E PWV EM USQRhSnDž鼥 @UPPjPE PEPjP t DžMA8QQj j1 ujVRPG(jjSPM}5(P}E PWV EM USQRhcmDž̤ *@UPPjPE PEPjP, t DžMA8tA8u/u} uPWVhLl4QQj j0 }jWRP9 E @P/P(jSPU} u(PWVSώ £EM USQRh/lDž阣FPE PEPhlk} uPWVhk?FPE PEPhk} uPWVhkFPE PEPhUk鹢} uPWVh)k鍢% @uPPjPE PEPjP t Dž}G8t G8Eu ]8WVShLj/1@tsPPEjPE PEPjWU t DžUB8tB8uYM] 1MVSQhi]}E RPEPhiDž3PPj j- ujFPS@} W,P(jSPu ]PVShGi髠7/@MWWj] 1MVSQjR t DžuF8PPj j, }jGPSu`(jjSP@EE RPEP(P UPE PEPhWhDžu ]WVSh/h铟PE PEPhhg? /@MWWj] 1MVSQjRLJ t DžuF8PPj jP+ }jGPSxu`(jjSPEE RPEP(P賉 馞UPE PEPhgDž|u ]WVShfOPE PEPhf#H /@MWWj] 1MVSQjR胆 t DžuF8PPj j * }jGPS4u`(jjSP踂EE RPEP(Po bUPE PEPheDž8u ]WVShe PE PEPh{eߜQ /@MWWj] 1MVSQjR? t DžuF8PPj j( }jGPSu`(jjSPtEE RPEP(P+ UPE PEPhdDžu ]WVShcdǛPE PEPh7d雛[ /@MWWj] 1MVSQjR t DžuF8PPj j' }jGPSu`(jjSP0EE RPEP(P ښUPE PEPhGcDž鰚u ]WVShc郚PE PEPhbWf @MWWj] 1MVSQjR跂 t Dž5( }W:td CRx%M UE(SQRP$ 駙UPE PEPhbDž}}PE PWhXaQuPE PEPha"mttY@t=MA8tA8uTu}PE PWhKaDž鴘UPE PEPh!aDž銘}VVjM USQRjP t DžPPj j$ ËEj@PS4M qV#P(jSP>} M UPQRhm`їGPE PEPh@`餗{@ESSjU EQRPjP t DžUB8WWj j# MjqVP (jjSP5|PE PEPhd_Ȗ}u} PWVh5_Dž鞖@ESSjU EQRPjP~ t DžUB8WWj j" MjqVP(jjSP/{PE PEPh^^•}u} PWVh/^Dž阕@EVVjM USQRjP} t DžUB8tB8u/MPE PEPh]PPj jN! uj~WPv} GPp P(jSPyPE PEPh]x}}PE PWh\DžNuM U^SQRh\PE PEPh\F@UVVjM USQRjPR| t DžMA8PPj j uj~WPuw(jjSPxGPE PEPh[E}PE PWh[DžNEU QRPh_[ÒPE PEPh3[闒 I@ESSjU EQRPjPz t DžUB8WWj j MjqVPuw(jjSP,wPE PEPh[Z鿑}u} PWVh,ZDž镑uEU NQRPhZePE PEPhY9@trESSjU EQRPjPy t Dž5( MQ:tK CR^馐}u} PWVhYDž|9u ]WVShXXPUPE PEPhX! t$ t AuRRjPE PEP(jPrx t Dž}G8Ejj jXS_U 2\ Q$MZËAPD$ uË~5WVhS^ Dž9<@~ۋM UVQRhW$Y؎v] MVSQhGW髎 PPC tރ~ F uӡ( 4W(48# Q}ZËGPD$ËGPP}PE PWhTSV鷍PPEP~ W* U$S Qhh^h` P(Eh^h` h@RjPV |/HE h` PEPh6VDžE h` PEPhUDž $M} PuPWVhZU DžÌPPEjPE PEP(jPIu t DžUB81QQjPsƅRPVjD^~8 }]h^G} PWSh(U^ S SPVk9E PR@PE PEPhLTVG_V*隋M APAPE PEPh<S x VS} uPWVhS' VUjj jJQDž94<KA~E VPEPhSXP%養MU E QRPhSDžzRRj j UjBPSu FPP(jSP_o>]u (WVSQu uPE PEP(PtEE RPEP(PtɉFPE PEPh8R霉( 4R(48\|uEU NQRPhQ'PE PEPhQUBPE PEPhgQˈMAPE PEPh7Q雈}jj jDPKC0}jj jDP'=wi}jj jLQC, M UVSQRh$P  u P]WVShXSP 鷇u} DuPWVhP逇 xCM UhQRhO, E hhPEPhO .PE PEPhXGO髆 _}D8tbt PU TR P C|U} uPWVhN P<…t^{ClBCpBCtB {Cx M UhhQRhXN wEDPE PEPhM@ E hhPEPhXM Dž}PPjPE PEP(jPm t DžUB8a( PPP)(MǀǀXAP_;(}ZAAA ZDžw>2}\;~8މ;(HH};{馃EPE PEPhLDž|PPj j }jGPSuwE @PP(jSPeht(PE PEPhKU}5(PE PWVm߂w] MVSQhNK鲂 މ(PPE hPEPhJWUBPE PEPhJ'u} PWVhJuFPE PEPhgJˁ} uPWVh;J韁u}FPE PWh Jou ]WWhhhVShI 5 މ}D8(t Pc (} DPk ( PZ ==}M USQRhHOMVVhhUM SQRhH  S6t9(AAA B Bu}DPE PWh.H&UWVSD DžuDžhDžV, IRPhP  ADžV <0)=1F1DB u1ۊtot&\#€  Шa X1DB F1DB uCƒ?%u8{t}<#t)< t%< F€#%t t uPPP)Ѝ{@PWPEPh@JF C@~‰1nu1Bou1BDž1ۀ8t C8u싅t4uPWVhEtS t:t)t  $DžQZP$}PPPWu ‰ $PX$Poe[^_]ÊN €\ Шu~#tyrntxuSF9s FP1lPPEPhCFDžQ)F@RPV)׃ =EhRPhC    tFtjU]WVSh<CQ $DžPXP$MVPSQf FP 0|F F00 w< vDžݍ&'UWVS$EEjjSEE존 uЋ]쉘Eu裴 E t&u~  UB M싑t 9Du~NpFMy @t ,uFt F Ex,JExMϋqHH9t^Sj]KQV R=EÅ;E N Q^ M1ҋxtx ‰x69u]{wlt xt"tTuFdtJt u6E P?U WPht@uu}@tEM싑|9Mt9MAFu싆U싂Pjhh]u u1Fdu ЋUBd8EҋxduMApǁ%ǁ=6= }W]f{yu~w!tt L Exd2UztBwu_ t4M Q=] RPh>uFu?uu~dW0G,9BW,uPPj/VXÅPPjVJCCEPPSuVCƅ@E9EtMË@Q%@@9 P?.EÍx\0t&EpXu9X\tuF@t BBu쉊ǂ0ǂ`t~umUBVjXSH,QAÅ;Eru ~,Wx1҉^,tx ‹E쉓xxaS E{uVjjK Q@ƅ;E. { W"Us x1҅tx ‰x뛋E싘CHd8RRPh;E@EuF [V PNp< %FQ:RPh"h;EE R:] VPh\8;MAM] %CWY:VPhho;]]! }W@uƉuMAP R9 RPh:E@EF R9] VPh:MCMPF PU싂Phd1:]C6]jt uG09E싘 Q89U RPh9E@EbU싒U}  M @t71ҍu싂Ft5 Ɖ5uхt11ҋu싂DFt5L Ɖ5@uыE싀EuE~ }}Ee[^_]PF PE싀Ph P8ZYVSQu싖RPh8E@ ?E]쉃|[u]uPPSuV=ƅME Q7$RU싲VPh|M S\7ZYV]䋛SQu싖RPh;RjPh<MQjPh ǁ0~j~] ,0ShPNu싆t[|4tb]쉃D EP VAET Q?U쉂|u싆tm MQ<MUƒUu^d Q5 RPh@6iU쉂[PMA,PPhp16E@ERUB,PPhPC Pu싆Ph5E@Ev h5EEe[^_]à P 5] WPh<5uFu P4 RPh5}}M S44$Q]싓RPhRC PM싁Ph(!'UTEPPT]fUEPQP@ ]ÐUMAt : 9}]Ë : )Ћ]ÍUUJtH9ttu]ÍuދܐUSá: 0(@(QS3 RPh\3XP13YRPhjS5]ÍUWVS x@P@E9tg2 f69tYZC@%@HuC$u߃ C$R[C$u S<C0@6C0E@9EuEe[^_]Ít&UWVS1 tn1Qt&FtVtLX PW[S$u SA<C0G@C0F,t VT9re[^_]ÍvUWVSƋ9tJVNЃ މEࡸ: ylYh VV E` }EEXZPFF\"Qu7#Phd"h^WY0  F4N$PEPFQPlt Hh{"t7#RPlR@hPhh^W0(h` huJ2}tlh` huJjNQ43t FPltTvFtt&udže[^_]h` huJj뒋xhu롃 R@Ph"h^W=/ t&UWVS Ƌ9t%u9|He[^_]ËNAlu yhm : 9}Ӌ)߉F ƒAFAqt!8& ]VE` XZPFEF\"Qu7#Ph"h^S. F4NPWylt Qh{"t7#PAlPyhWh h^S-h` huJ/Nh` huJjQ1 FtYuc0: 9})É؋,É,0d VЃN R@Ph"h^S - Vv'UWVSËHu H@S E` XZPEC\"QCu7#Ph\ h^V, C4PWCxlt Hh{"t7#RPlR@hPh h^V:,h` huJH.h` huJjCPs/C xluphtTCt&ue[^_]à R@Ph"h^V+ 8륍t&UWVSËHu߉H@SE` XZPEC\"QCu7#Ph h^V4+ C4PWCxlt Hh{"t7#RPlRxhWh h^V*h` huJ,h` huJjsV#. Ctue[^_]à R@Ph"h^V{* PvUWVS|}t|^@DtBF$u V25F0F0PPjWl= de[^_]ËSB u 0,EBta: ȉA h@@EPQWK;ES8 ED1v tPEPQh` C@UM` Ev"UE"E"E"E"E"E"ǁ` X-HaBproxBy-SeB rverB-StaBte: CEEREt )эQRDPEPZYEC4PS)PC$PЋH|щTPSэD1PPPCQh EUP2M0C@Mt\ E: 9}@9|<)ʍ}RPh"EMPU‰UUM B EDEU` Ƃ`  BƂ`  BUƂ` de1[^_]è@FCLECPECTECXEfffEPEjPWu &rtswt j%dCt : tUB4: t )Ѕ$LJEe[^_]ËE: H4t)ЅGS Gx F LJPjjj>ƃtl9tL$D E… Шu"AUfTAQ B@Q ;A D$V  EH4: )…uUɉB4: uf;H  LJV91~f QWȉ)΍6P$]P$ "M}fEƴ fEm]mƋE)ƃ : WcEX4W@tJ :  9!⿉WWBqt=\Wt:G@@t1 tn uuЋH9|~ LJV71 QWnȉ)΍6P$]P$ "M*BmE9WUBq)ًET}U WЃU: J4k)…_EɉH4: u;t&;H E5: H4)|WuuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jh0jjV @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPV9AE#ET L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV WMSPQVY@tJu-G QW RPh k]PjSV@srj t&GLE؋GPE܋GTEGXEPG\PEPVt?EE[}}8PPGPhL!t&A jh(j jV VDF;X= ~X= MLDDpD \DDPPjVh= : uEH4G: uڅtʅt )؅~ڋMQ4G PW SPh!/Ӆv)ЅjuUB4у G|@PSjjV jOlEMJQRGPh!Zv'UWVSE EEEfEXdtCvuEEuЋ}D j?$ EEXdEU‰E Ct: 2DB @B DF @F$EF0FDF8sHF<@^@=: t S;E S‹EЃ}~4tF t;~y V"uMEFuMEEe1[^_]Í& Sg=~'Et SM;E} S<EE@EDU@ RgVSEQh4"e[^_]ÿ UWVSQ]CE9r`s,C@tI : 9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjh"= %Ð&UMQPQQA ǂt)H4BJ= P JP ]fBBJ= P JP ]ÍvUWVSu} N41҅tV@хtkta@tZ uVCRE”EAUU䋀9tw%tUى &1t2YQK$K$V BV Xu ؍e[^_]à VЃ됍t&&EU@9BxCEy'UWVS uFVExZ9~ }7PPEPVt$XC$u SC0@C09~ |ɍe[^_]ÐUSR= ] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 R聅JUWVS}]EW(VjPjCDP @tC$ C$e[^_]QWVSDRgC$ C$e[^_]UWVS\ET 9: 9lJhDžPQSEP@ `? 2 J AJ FF$F FF(fh) \? : F5\? 0X?  B @B  A C C$C0CDC8RhhRP9 t]ShjQi@ jh0jjR% @gG@RV^r@BwU Q'w= Qw‹^0~$,HjSPjBXjPPj f*fff8#% t=#RRXQSPRBX Vt: P JP JtX KX tH IH HXtP JP t: X KX I FBF`? 0P JP Pe1[^_]à R`uF CXR@u R-u V QG`? 0P JP  h#[Q/G  h#Z)ÉHBB h#XVG Bs pj a 5X= VSh#jW > hP$As)ƉHttCCg: X= PPh$됃 X= PPh$viRBC눐&UU Mf%tA A]ÍA A]ÍUE Uft ff%B ]ff%B ]Í'UVS] u{$y/f(%t<0F Fe[^]à Sf(%uŐ,F Fe[^]Ít&UVS] u{$y/f(t;f*f%F e[^]à Swf(uf*f%F e[^]Ðt&UE @E]Ðt&UhXeÐUUЃt uuuf]É'UW%Uttt[%]ÍUWVS.%EEE؉u}}UU؋]ع8t+% Eux8ExEP:PEjPRTUuQPuRUWPSh%uV]SE UEEe[^_]ËMtU9tSh4&UREPlE_t+: u^EuƐE Uu||U SPhh&EPEPe[^_]tTA% tDc%t6% ubEuc%ƄEgUuˆƈUCSh&EPEPDT"uUu”ƔU  t1]KuuZUu€ƀUVh&MQUREuƌEE{EPh('.t&'UWVSL%]EE uuE k%uS}:EjjPRƋEUtREt=UM9t) hk%hL%h'EPEP謿E 7Ee[^_]ÐPM$RPhk%hL%h'벃 hk%hL%h(]MSQL몃 PhL%ht%WsVPhk%hL%h@(&UWVS E}  t&t;!9uPPEPPjuϋC;E uLEu]뻋Ee[^_]ËEP4$$PEPhx(%e1[^_]P$] S$MQh(XE ZP}$h )빍vUWVS 1u  t0!9uPPEPP薺uхuɍve[^_]Íe1[^_]ÍU1WVS 1}t-_dt$t&PPE PP2tue[^_]Í&uދSQU Rh,)e1[^_]ÍUSP]uRuthCp0C%C1]ËQRPhh)tQRPh)kQtRPh*hIQDRPh\*bCp'v% CpQRPh*%0t&ϋQRPh+C%C1]Ít&UWVSDžt5 fF uDžputz{uPxjdPS NjEutt ttpۉpupuF Ph%jVtte[^_]ËQ}x$RPh%t t[ppeP%x$QPh%:릐t&US 3  jjPv{ tj(PPP$h%(ZYPPP$h%jS( : tu]ø䐍t&UVSuFt&PPjPu"PPtuP QtF ue[^]ÍvRRjP蘶uPPjPl= ~ tF 뺍&'UVSu t&t+ S{~ S= H= F e[^]Í'UWVS : }5 9l~ _tl9rЃ~ u SuF 뾐 SuF t~ u͋3 5 }t&PPPPPPPht+ SQRPPht+jVVectG~ t : t )ȅa9YӅt˅t )Ѕ~Ӑ믍e[^_]Ë S'uF {SjQPHfP: tڅtʅt )؅~ډI܍'UVS1 PPjjC PPP$h%XPQ$h%jS SD{ tKRPPt$h+XPPS$h+jS %ue[^]à h+J h+jjye[^]t&'UVS PPjjJ t&{ uPPV$h%YRP$h%jS3 C tPPtuPPu;: 9l~9sPPjPh= C 렍e[^]f~ thfFfƋPQ$Vh,XZQR$Vh,jSSKfFf떉'UhÐUMyt]fAǁ`ǁ@] UWVS DžtUB@@9Љd`!t ‹;dt`R1{uҋsplh{A @ RVh-hPT = @ PVh-hP& = P) PPPPVPjlPzPfDžx蛲 ƅjjjDžc9tRhjP@0PxjnPW走pƒl ШhWPPjWPPVP: P;C DG;X= ~X= DDD D\DD1te[^_]PPVh-` h-耭8PPVh.c8uPPPV?8 PPVh`.u놋hQQRPR@PPVh.G P詬<$1$蓬-QQVh. PlPpPPq@ 덃 h4/WWVhh/PPVh/jPPVh/YXVP)F988 V'PPVh,0aUWVSEP@x@9`9`C~ۃ P CCjtjj覯ƅxPtjlPzPfDžx xjnEPVخx7 V蘪\PPjPl= Cdt&e1[^_]8ou tQ뫐&UWVSU=hD`%LXbDždhPdPREP辪\@0`9: 9l`?  z Gz \? : CC$:C\? X? C CC(r Fr } AG G$G0GDG8PRhhRPë\9 t=VhjQ萫@:`\GD_@SG<KD{CCǃ|C4C0C<C8ChCl{@CPPzCTCXІC\@CHCLCtCpǃǃ{xǃPzǃǃІǃ@ǃC|ǃǃǃǃǃRjDjP莫 hjPx : : : : fǃfǃq Fq S0BX`B4B,B0BB B$BB(^C8PBLT : spBDBHBTrPS`B4BBB 6A @A S43BXrLB B$BTBP`s0B,B0FFF8BB(^B4B BBBBB8BDBHBTSdG4t F B\4D@;X= ~X= TDL`DA(C0DA,DPC4LD PPj\Ph= G$u WeG0`G0@;}>X5: : IFCX5: : Xe1[^_]PPj:Wl= `A룃 R(U RU QU& QTK0t: P JP t: p N8p I CBC`? P JP \P迣e1[^_]à hd0붃 hd0à hP$l h#鍴&'U1WVS\M 5 A1DF u1MtM1DF A15A1DF uGLƒ%붐LG~u-18u`]-ubU:EUǀ|B4@<QQPRe[^_]ASJ18uE8EǀUB4ǂǂ|@<QQPROE8E8Ejj jR輣UjEj jP衣UEjj jP膣UEEǀ|@48@<8VVPR^jj jP!UUWVS ]u |tt e1[^_]ËS0PBzXPj WItPPWSt7ueuau]V8 : t)ʅ~J t |u= @PPh@,C0@LPǃ|1F4e[^_]Ðt&C48@8ѐFS0ǃ|fǃ@ t&C0p4߉p4ǃ|1e[^_]UWVS EU@@B0EUZ0J4$E9MAHJEH4EX0CL83E uE1EEpt6CL8v̀C4f%1ƉptEC4u'CuCC,C4u u CL8ЉU% = (%`=@%` = `@E1ЩptECL8EUJ4vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@%` = `@1ptEUZ0CL8E9EQP U%%B8B P݄> C~Rhjh> ̚ hjh> 踚1ɉʉ> > A~ʉ> > A~ݹIIƒ> Au I Iƒ> AuPjhh IiE @? jj@h7SE]D? QQShEk&UWVSE]E} SٗPSEW ЃXPEP t;W _‹OW UB _OEUE ue[^_]G&e[^_]ÍUWVS }U] uWEPC ЃXPRt8KS‰KK SF K EuE }e[^_]%e[^_]Í'U1ɉWVS }]u 9s;:te[^_]Í&PEWPEP蕘1Ʌu׍S9s'1C6tvB9s16u9rMG)Ή9~ыE)뒍vU1ɉVS1E] 9s t 1@9r[^]Åt\t"u1@"t,t@Թ@̾@čv'UWVS M}UAtjEU9fY%q 489C9s 14uMEA)9AVS4U)޸r e[^_]ËщUf1ҊQ%DfAf%EttUMfU %ҍ48u"9s?:E @E U 9s8:u});E ~ M <:t1MU1D|0fDf%Eue1[^_]PQEPW觖uU X9@%4C914ut&'USE]PEPE PPSGZYPSJ]Ðt&UWVS ËJ,֋}AXA A$AA(PPA,A0AtN(̀E…%u(C$puM ȉC$uU ЉC$e[^_]ÐEtPGP7VQI뼍t&US]M C44u!C44u ̀> t&[]Ít&'UWVSSSUE1ҊA<w.%@7C~);Eu{9uu ZY[^_]ÃCغ U1҉VSH@p(XD9s.<*t(%5DFu 9s 9/tA9r19tʉ[^]Ít&A9s,1Ft3A9s1Fu+t-t.t9tA<:t1҉[^]À+tȀ-tÀ.u9tA j#h R|ƒ "BhfDž\T\_XC 7p   {1ۋ RfpC9~At|BGXt߃ CPh> j#h R訾p 9Đt&}BpDž\TDžXP49%tE)ʋ4PJMbDC))ʋDʉX`DždtpC@tDždt&f)ffh ËlPP|V ~)PV$u7#TP1t TA$PlQpQ : QH- j#h R赺p 9f}B&]f:tF;ur~;}s!1F4tG;}s 14u]uU)ЋS9uPRCPEP轉uҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWRCUM]vE U1DUDUEfDf%Ee[^_]à hxF룃 Rw5C'UWVS]u} UCM$|=B915tЋ^0))؉F4N)ȉF [^_]Ðt&B914tꀸ6Ћ^()B)ػ F,9s|14u\)F0낐B910uꀸ6Ћ^)B)ػ F$9s,14ur)F(g6tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F06tB9o 딻덐&UWVSE]UM}$=B910uꀸ5u )K0)ȉC4{)C [^_]B914tꀸ6u )s()BC,9ʸ14ugu )C0jB911uꀸ6u )s)BC$9ʸs314u[u )C(U6tjB9zu tM t1[^_]øٸҸˀ6tLB9r붍vK(u ))ȉC,} )C4C05tu )K)ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$=:1؋M)CXG9sɊ1Ѐ63C9r몊1Ѐ1tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB  C9_1Ѐ5H uC9 ECUX$)ÍCGGG)ЃXG G9s WBW9r1Ѐ5uC9rr_ uC9Z uKC9E1Ѐ6uWMA PQ: %PO)R3MY$EXEEW$PEVSRPWYÅ8 EfG f% Љ_ {C9f؋M)ȃXG1Ѐ5 uC9P =C971Ѐ6OEDX9KUDX G@GDX9,UDX G@GDX9r5 C9; C191Ѐ1tUXU9_G5V "C 9G; 6C901Ѐ1tUXU9t MjjSq$VQ迹 ËEpU)ЋUX_Gfzt tM fA fAfAG @؋U)ЃXGWEЍPXW:M EY$jjSPQEUGà rGC9 C9x1UWVS u}UE UVEG])ЃXC=^v^FXQPR~FxW~): C : SUCCECESEE Ue[^_]^~VG$)ЃX럍t&'UWVSLE}EE dE1UMUIDM1ɋ]9EUM@0EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿$IC9]s]]UZt@MEȋUM\XDN9r&Ef ޿(IC9]s捶UEЋMU\XDT9r Ef޿3IJC9]sEME]E@E܅]MC0CEf1CT\XUfBfƁMfǁ~PjSh8I}!U1D\fDf%ƅuMYUGIr}&U܋U܅M܋QB9uEypу9u΋U]K4fǃ@fǃ: 1: C@1@DA<"PPQSwe[^_]ËEEt&ME` VY SQh` |]EǃXEZUPB0xLW苬MA0@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8: t)Ѕ~ e1[^_]á: )Ћ : MbLJE))ʋM>ʉtWWjSLZYPFLPCF4F8dhC$puPC$R C$e1[^_]ÍvUWVSL}GW < DBUԋU 1ۋB]ċ,E؉MEPPwVjhOI ]܃ }M؋ERjhaIPy] uE[]9GE01ЈU5uqv ҉URѢM̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ5tMԋ]M9sNwE5#Ɖu3E1҉E;UċE#|;EsEUW=E)ÃtX ty E)ƃZMSjhIQ*v>E0'PEjh=JPuuUωPEj hIPutˍ&PEj hIPuًUQjhIRu3듋u)MSjhIQduxUB<"<, Ш^Ev'UVS]u fft>fHtUǃtPPjSZYPFPPEC$ptu C$%e[^]ÀPC$ٍvPCdPVS讽xe[^]UWVSEEM E܋P0ыUf@%ETTXUM܋+-E܋MPfDf%E<] f%41GD0EEUjh= j SBP;E u?MAw4$>M܋]ECTXtUMEM%1e[^_]Ë]C9CuыEًP I0S[4AC AM|A BtBǁ@6EEUB[]܋EK uM jjVSQ3M܋Uƒ qY UQ$ƉY Q$q]IfWf% ЉfE܉]fH Eh= @ PSh` uM $h` VSQ貪Uƒ fUU܋ZJ z$ljZJ z$]Kƒ Шzl UWVS ]}u_O1tLS0E EX EƋC8ƊEEjh= j POQB tUEe[^_]Ít&Gw$0>UB9BuҋMW Y4QI0C AAM|A Bt ǁ@E뉋MATXҋUBيEh= G PEPh` $Eh` VPE Pߨ{S$‰{S${0U K XDK S(jjPE XMQjPCPƃS f‹% ЉOƒ Шu  1Yt&UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWh|uыM PSQW&UWVS }E EuUWL9}B@tGO,BH?  B @B O,4PVEPQTmG,0H? >B @B PVEPSm3Y^SGPP肊ơH? P JP O: M苁1Ʌt EN@@u^ C^ Nt]UZdtSRRFPPiu4CMA@G%~U싂$? ue[^_]fH?  J IJ hF;GEFE Ee[^_]ت RU싂$?Cu M쉟G$G$e ߸ Rw&'UWV1Mu S19s t1A9r[^_]Åt<\t)<"u1A⍴&<"t<,<; ШuA»A뺿A벍&USP] M::ubJ1B6u1؀5u+BAB9s 16tA16u jjQR]S_]15<B9s 1B6tĐt&A16u jjQR]S]Ít&'UWVSlEUEE싂Muf@%I(DVȉEfBf%Eti}EԉE܍M܉Uf%ȉE1BU؃jhIRDEԋEPu(}u}VfDf%Eue[^_]ËM܋u؃EEM9]C;]s'}1G6tvC;]s 16u]̉;]s;v=€, Ш;1FȀ6;urȉuuĉuȀ;$M;u9uE@;E}MAXu싖uxUċ\)ډU9|f9މu[D? u B @B }ɉUB`;E}PVSQ"hM0uE)؋vu; kEE}Dt\fUċH)ډ9~Ѝ4)ʉuMU9Hu(D9މ׉uPEPEPEPEU؉E9EtKE] u؍EWVPS4MÃfUE؉EԋB؉BB ؉B B$؉B$MMw;u؉u&}Eu]ЋM EVSPQuƋUuԋu‹}؋MljUV$‹^f}؋N V$EU؃9Љ^N EE9މ׉vEMUċ@dUEA U9UEt|M)щM M MtfuVtF ;Eu9uȉ׉uԋE@UB@MA%|UM $?M ɉuU싂x $?@u}ċN9}%E}Љ}t&PEЋ} PEPW>U9r9UruƉűMȋU‰MȋM}u؉UĉMԋUMƉ}u؋y q$fQƉQy q$Euvu}ȋE̋U))} MԋU܋E jjQRPju}à NufWf% Љu}EfO f2uȉu9}?~GEĉ}9r;u_>=VFU؉E9s-1F6tEȋM@E9Ms}16uE؋}PWgZUYEE91A6Eċ}HE9}U1B6u E@jjPEPE P>UԋMUԋUuM؋MƉ}fyQ$uq ƒ yq Q$EEE19ut$ EjjVPE PΜƋEȃ EȍF;ErnEċUEċEr EEJ$E؋EEԋEr f8BJ$B RS hF豟{ uȋM jjVPQ4Uƒ Uku}$?Gt- u}G$G$Ey\ э&UWVSEEM UZtf@%كETTXUMEMPfDfǁ}uU܃ f%01BDEEUjh= j VJQ3 uMAtd~/t@tM ]}I1e[^_]ÅuۋEEUMh= A PVh` %$h` SVu VbMUÉMMf Q`qdƉQ`Qh‰qdQhO }] jjWVS]M S`{dshƋE܉S`{dMshK]fPf% ЉEUfH f]Cƒ Ш2t&UWVS ]untUJ1҃tYStE Es| xXEUjh= j WBP2 uUBt@~/tUUe[^_]ËEօuҋEh= UB PWh` dM $h` VWQ衘S`KdS`Sh‰KdShKtU ʍDXSljjPE WXj PC\PƅKPP} Plj} E XP9KC|> f‹% кEHƒ 1ҨpUWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWŃƍUWVS\EUEE싂Muf@%IlDVȉEfBf%E}EԉE܍M܉UfE%ȉE1BU؃j hIRDEԋE܃ EEP::uMFuDuFXpE;EX;]s+@%6t&C;]s 16u]Љ;]sBv=€; ШHEt ,81FȀ6;uruĉuȉűE9Es}U؉U;u(9uE@;E}GXU싒uMȋ\)ىM9|m9މubD? u B @B }ɉUB`;E}PVSQ+[M싁0&uE)؋vu; }DtKfUȋH)ډ9~Ћ})ʉU4Lu9U~U}H9}ĉ};EEEMuQfDf%EJ}G,tJRRPGPPwÅV}1ҋ : Gt ‹C S@C e[^_];u؉u 9މ׉EM҉t uFu}G$E@EM؀8:9M% uԋ]܋M jjVSQ$u}à NufWf% Љu}EUfG`ډG`Gd؉UfO GdGh؉Gh}싇UMr:J/uF "B @PBPEPEPE PcËE؋}ԉEċE߉E؋E}ԋ}Php`ڋHdPhUىp`HdMf @ ~u싆uŰMȋE)щUL)9щMdMPQEXZ5D9މljOEH,,H?  B HB B @B UɉJ,u]WVSQWMuA,0E؋uj hIPVu}EE EE@` Z ESJUQRPE PËE؋MEċE؋UE؋E؋ydqhEfA`ދ A`ydqh4f;u>=~E؉}9s-1F6tE̋U@E9UsM16u}̋EPW}Z9EĉEY|1B6hEȋMHE9MU}1G6u?19ut$ EjjVPE PˏƋẼ E̍F;EEȋuMEȋEf9EċENhE؋EEԋF`NhF`FdFdPEPEPE PuԋMƋUuԋu}؉UNj^`VhfNd‰}؋}^`NdVh R hFG űM jjVPQ͎Uƒ U R1P? 2GB @B H? F z Gz b}GRLPG,PQTGL PSL?  x B @B NMRWWNQTF XZVuFPP6q R: hF hFEj@P蘒H?  h0G軐 h0G˃ Rh hdG葐 EhFjXS;UYBVT6 R hFH UhFjZSYMA뵸'UWVSEp^Dt ƒ%tte[^_]ÍPEPE j;P|PDžtхu]E E&Ð]9vKE89 Шt苖HE@EE9EsfF%fEu|=uQRCDRPISu]f}u]EL)9~Ѕ'VPS]S } PEPj?WOE U))QRj?WOt E;E UE;t&'UWVSM }]Q0BPf@ %PBLf@ %PEPAPVhIh` R]Ɖ)) 9~@QP` WPyƃƆ`  FuE ` Ee[^_]M'UWVS,EU}@0R4EUMA4a_\A]9A$sGVPSQEs]Ћw]Ћsx!E UHQSRP@x$P M]ЋA4A4ȋsXCE߉PPs,VS(ЃXP訁===MEH$pH$RMQAZ@ ة!A$_GtM1fCETfCf%LXME܅E܍]ԋ]Uf%؉E1BMj hIQDSE't?UR$ŨPjhQJSOE̋]E̋ẺC$U܋_UfDf%E܅]1ۅ~9t&~)PGPEPEP{xAC9ˋMA9ƋrRPEPEPXUt,0<@M]A4@@LJ]VVjSHZYPExPWi~UR$Upu MPỦQ$Euű]űẺC$e1[^_]=,q=-?]UB@J06 MEjjPSQ艆W`_dÉW`_dOhU]‰OhUOfS]f % ЉfO Ef MEjhQJPSQUOd‹_`UUfWhOd‹M_`Wh I$M=nUtDH\`D]SuDuXu BzPBt ]t"C$u[Ct?88][$]̃uVEP@Z@ ة!t>~6EЃx$i@M|_0XẼE̋EỦP$d'Gfxt WtMЋ]f@ f@f@UAK,‹C$)ЍPC)9r*C,EЋULJB4B4])s0։s0PPEPEPEP]SBtDH\`QItQPhGUXItMRAVhGjP胈 ]PPEPS BuGPQhJh` KUÃB$ ES_h` SPEP >MA@t ~tG\rUЋEZ؃XEƋJ VuPVh J?O1]fATfAfӉ]ÁfM%U4VQRh'JO1DD0EfDfÁ뱋E@4AfP]ЋPGPEsXP螾>UMЋYx#] CPQRSCx$P}U M@]U@t,0M]AC4LJ<@PPjQ^_PsPVxE@$Epu @UẺB$E]̋M]̋]̉Y$sUЋJx&M uAPRVQAx$P] U@M@]t,0UMBA4LJ<@QQjR _]ZPsPV*wE@$Ep0EЋ@x$U BPEPEPRBx$P M]U@@t,0M]AC4LJ<@VVjQN_ZPsPVrvE@$Ep`PO EЋXx!U uJQPVRBx$P M@]t,0UMBA4LJ<@QQjR蛰_ZP]UЋJx&M APERPQAx$P] UM@AB4<@Y$]pu ]̉Y$EE E̋EỦP$My,RP` hPE ωEjh.JS]PSī TMA(^y]U: )ȋ : )Mb)ʍڋUщRAJ@!ȩt"]PjCL@ PCP@ PEPUOh ǂR]ǃǃ]33 GjhEJPEPEP胪 ][$]tv'UWVSM EU`AU9A$sESPRQ}*EPx!U u zWPVRB|P M ȋY4A8Y4]SЋS$XCڭ`EXlMg]K4]/E`X\{8s8] t&u:?9 `MjPQSW uЅ%tƋ}`: : džQQjW螬_ZPE pLV_r}w$pu Pw$u Ep$1e[^_]Ë}G$G$Mq$urY;]tj@;v : 9#rFr;vEp$p$` MYQCJ ȩ! `1u {0[fCDžlTfCf%tXtpphthf%<1Bj hIWSD8tzt6Mq$PjhQJS%@NEp$`plYfDf%pM]1~9`^t&EGP\PE SPåU9ՋMdt`u^@@9B}uD9/ `jPEPEPCP‹C xuŅ1҈…tEE` C=-=/  5V<GG=^u uQPRV~={ NWK =ZEPQCPRL=CwƉwUK G W`u W: C]: PPWFLP}w$*EËxHH9uuD?9| `jPEPEPGP0‹G xuŅ1҈…t_ UZ@;v : 9AzGz;vEP0p4F BBU|B ࿉Ct @Ct Mǁ@]s$s$Ex,eU@z;v : 9rFr;vUыr4R0F BB|A ࿉Gt @Gt udž@}w$w$;]guj@;v : 9JAJ;vUB$B$sP}_6CP9F `jPEPS~W‹F xuM1ҋY륋EX}RPE PWwZ}t E@x$U BPEPE PRB|Pw `] uAǁC4WWjV&ZYP{LWjuFdhr}w$UZ\ tjjVS] Sr`th‹K$tK$[lfWf % ЉffN USSQRbcu F4 jhQJWS] S3r`h}tV$ƒ fV$w$tju P|7GEP$P$C t E@$juDuuFXt`UB,uD}CWr tff$f  C Bj}w$uEGW@z !t0Ex4 UE ZJ0Ȁx_0 ]s$euu E @(^x]]`: : S0BXJ(B B$B B,B0Bt} U : G4G4B1ҋ|t  ‹M ҉Q8u:  ] C8^$!, } UOBR < " )эq}4uE OȋW0Ѐx_1 9,v ]  P4EG SeDt-CoDokiefD : GUGVK QS$RPK5C wUGf OUO`褡d`p@H(΋PD֋d)Ct19}d<?z@9|OS=Z CMRPQ4COOGUЋdQVRPy4GG(U|/C=Y/G@GM @E RRPEPEXD}f$x WU\WtM,!;O]Kt,!;+u$,PS Ph` r3X1ZFP1FP1FP1P` hWJP5Ë`Sh` P`PE P UP`M: ǂ: SSjQ裞Z] YPCLPMMP] A,PA(yDXPRu^UVPE Z,SJ(ȃXPbMYi t!; tM!;}ǬPVPh` 1X1ZGP1GP1GP1P` hWJP3Ƌ`Vh` P`PE P蔙 8]S[C8/tP];uE }VЋ_ pXESVPheJE1fCTfCf։ǁ`Qf%0ESVPhlJt`V1DtfDfǁufU;J,r(E hpX9M߉]pA$p A$9 `jPEPSV ~u %6@?  mZ CZ `ɉ9u^ ~}E WVSXPQ/`M QSE ЋuXC~,ËF Å, } j hSSW i} w ƍDw jjPE _XSjPW1Å`; YG f% Љr5M Gx] sVWQSC|P蔯 Uu} BG4dhr$pu r$Mq$DždyJkC`P}NXQSWE ЃXP迤&} ϋr)ljHBBEuj.VPj k.}WBWPËQh` - ` VhsJP*/Ë`$h` P`PE P/ xMQY] : K8t )ƅ UBx!M APE RPQA|P `}ǃPPjW聘[^u PNLQB^U}BF4dhr$SVQ_E WUBRSP M jhxJSSQeV ƒ V }Ox!E PRW} WP@|Pլ `]ǁVVjS蕗] ZYPCLPV]}uGC4dhw$p$WS Q]rT)ƉH@BB] @ɉu: Ft u} O8Uϋr)ljH{BB)эq hFg Ru `jhEJP`PE PT Mq$)`U ǀWWh<rLVgrT`]ǁVVjS֕.TB EEP`PWjh{J+] t^} t0MYϋr)ljHtLBB$MERj hJP*tEXUZr붋M K `E}uWS@EPEjhOIcE t#}~MERjhaIP!*te EWS]CPjhJE uZM]UB19ڋ,|9s EU19x|9M Y4Y4]rPE}PEPEP[u]M|~}O8_#FF 1ɋ: tt)NGGfWWиSrvUPPUB(:u# u%tt/PPjB Pt= ËBBPPjJ Qp= BBPPjB Pt= ƍUWVS u^,> FF DC,ډ\K,ST % = 0%=8C tUC,u{Tt%"=F(Pt+F@u%P =: Et UUP)^K$u STS0S0e[^_]Í&CTtPPjF Pp= FFCuC1ɋ: tt K #aC1: tt lj{> Vx2FF F  DF d~ Wx= ^^C0u{,u [T>UPP  : A @A t.B @B$B0BDB8 tF: B@tHB4B<tJ t;By RQ @ 1à QffUWVS  = t 1ҍe[^_]PjjhJMP? tH? L? Et=L_d;E~Et P 9}Ƌu⋿uË}GS}jMFQhJ跷H? >RjVhJ薷L?  @  PjjhJ &UWVS E#: UuDtfEPuEPuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]át:tt2CuJPPhJh`  Ph` jCS PSUSRu: PE4: U_UE PEPm%Ív'US] tH? P JP KtL? H IH P? P JP []ÍvUSP v PP1'u C t SF9tlC$t- CP(SDH  t: X KX  I ]눐UWVSEUBhJdZ|@E ǁ uE9]}`UUf1Ett A#;EtK uEU䋏)ى<@E9}UBd뮋E[^_]Ít&t01҉ƅ;E Шtϋ u낉낍&UPd@l@h@x@tǀtDBt2 u.t*t.Alu Au@AlAxu]ËAh@AhAtt&U‹Hht@tB|]ÍtǂB|]ÐBxB|Bl] UVS]Ss;StMu3uSS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉCSfUWVS}GdLJLJ @LJEÐu]䉷EEt11ҋCCtnEȉEuЋE9E}EuSSjMQaLJF}e[^_]e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwlNGxwl9tBtt ut቗l kuffSSe[^_]Ë;䍇GGtGhHGh P.ǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPSe[^_])QQPW讳jUWVS u^ddždž dž@dž$&CCu߉(FtFx^ddždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPWt&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFxFl@FFluP؅tt>9ut6.&;aiFtFh@FhO(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]f uè%E봋EE…%EE…%MMUMB()؉B(AtAx;B= P覭 UZ(B$؋Z )1dELGGe[^_]f9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P般 VqE싗Y[X)ЉVS语vUVSuue[^]Í& SXZV )1SP7e[^]Í'UVS]SKs9tKu4t uu=fSSe[^] uu;u܃tBVx)‹FlHVxFl9u8ftBtt utቖVt)‹FhHVtFh PǃL'UVS]CKs9~uCe[^]è ut胻t vtZFxЉFxFl@FFluT؅ttB9ut:2;v~FtЉFtFh@FhS )1PPPQ7Cu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xxωxxS )1QQURPީESCCe[^_]Ë9]e[^_]a]e[^_]aE)ptΉptY Psv'UVSu^ddž0dž @džPdžКdžКdž$&CCu߉A^ddždždždžt\fCtG uCt?tHS )1PPPP?ue[^]Í붍&U1WVSEUu R|PEPj?VÃ1MC؉])u)ƋEu(E3vWuVj&SÅCM؋U)ȉ])‹EU9EU<=uM9$މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1q|e[^_]Íe1[^_]Q_ v'UWVSLEEp0@ẺUЋ(@|M1ɅHS Cz< tz>FU1ɃX)UEM EEPEЃPCPjhOI]]܃ }M؋ERjhaIPBF(EX;EEPX1Ѐ5ua SLtlPЃ vPɋE]CE]E ЉEF(X;E+M1Ѐ5t1Ѐ5tU1B5u 1ɍe[^_]ËMMMMċF);EsEċ],}PEPj&WÅtCu؋M)])MċE9EvUMȀ< =uE9$uMȋE)ȍ HEčZt9B01҈€1t`UCЋUЋU)MĉEt<&űM̋E1q| Q>XEM1ɀ4ut&UWVS,1]sEԋV|<E1tL EEPPEԋPREP8P+[E܃ tEu 1e[^_]ÉËME@u=AЉ)Ku1v|e[^_]VEYhLE"fU̅tЉ)IKt<.uڋE̅uEv'UWVS<E@$Ut SSjP^MYCp%EǀC UtM1A$A$}t_UM9UMBQ4ut3At-EX,t PU9B$s MQKe[^_]ËK|=Uǂ~===ES ,==u͋EKhEɋRt@uƅC,"K4F @u@1ҩt t@u‰볋EǀMfff EǀUSSQR\= MQ{MyE1W|AUǂx;G|| LJ1EE*;uu]9_|%!9]ڋC4F,tà V9F$sfuS|Ƭ1tSEǀ11~#v1Ѓ9v1s|ыM‹E;@dh S9C 9]E EEt SXK|0t09~,(&?|EЋUЋU)ЉENZG/űE@EԋE94뽋MMKhuSlEEEF$u F(F$F بt t&@ut@F 9w5ЅtmDžuoEaFVFF(EVF$F 뢋Ft t&@utǂǂu1DžtF 1ҋF(ËF 1҉F(9rs)ʍC PÛF @F G,t)G4tE}艇 W9G sދE;}… ШuZ}ʼn떉F(11҉F(9r)ڍAREt}EM؅uE܋UڋMP WPSUu EqxU1W|t*x;G|| LJ1EE*;uuȉ]9_|%!9ڋC4F,tà V9F$s밋E1񋃐USl@SY8 RM]ȅt M̉Es]t ME[WxXBW_X]tR9}t5U^)ȉPPPSDME苀Eu9}tEU苒UuUVS]s$uSfBpALQPҋATAXAtEC@u 2f(fff*fff1s$e[^]ÐB tMBB B$B(ÍvC@u ,QRt2yc(,04뗁 YLfff*ff# Ss$댃 Ss$S Ss$UVSuuiF$tj1tW9tOF%t SC,C4S<~ 9S4} V> e[^]à VÅtH;x%=taN$F<@N$LPt~btcpPPSVR1`?ɀxPPPڃ S 9C r䋞48FDH\t&UWVSLE@$u PpUB0XPPjjj4ƃC %9t PhjV @ jh0jjV @}WB0B@EC%EE==E EC\E؋C`E܋CdEChEEĉEEEċ=L8$\8 … ШuAQ Bf\A@Q ;AAU]ȅD:$LMIMȋMA E1Ut,QfDQ%EB;AEHA EUMD: T9 D9$ffEڋEPEPEPVBEPj]èSV@} G0@PD D O4LzO0D@DL \DF;X= ~X= PPjVh= EUH0AP=z$@z$P$BP$;P(X}W VЃO0WMQAZ@!ةPPVA0@L@ PƱ}WB%11==9vWPSV@Åm VKRSS}GQhLGRhXLjPS `e[^_]ÐEPYP1ҋ : t j‰S1ҍe[^_]ÉP(=9}Ǩ#vPPhLP4$ pe[^_]Í& jh(j jV t& jh0j jVp W_sTrKjB bn=L8$\8 … ШuAQ Bf\A@Q ;[A D$V @ @PPjjVE P=2EE̋MẺMEcK PEPhK=W=L8$\8 … ШuAf\AY C@Y ;A D$V@XEZPUWBVhLjP`zSlEUH&AA}ԍC\WP]SV^=EЋMЅD=L8$\8 … ШuAQ Bf\A@Q ;0A D$VZ}PUPBWhL!$M^SARhLjP dC| @PSjjV} - hDM4$P=L8$\8 … ШuAf\AY C@Y ;A D$VH0PPhK=W'it m =X= WUBVh#AEKApA`P}PGVh![QGRhMmPPUBWhMXMAVhNA 5X= VMASh$ X= Q}GRh$&UWVS ]9fS$%HugKAtaS$ S`uC0@Px0u@0@4C48e[^_]ËKC0@PP0J$(481҅tC0@Pp0$@0@p4tU\L : `L9JAJP;XvXt$(C48 V4u FF,t V9F$ PRCs01ɋ: ~Ptt[FPO@0p4z})ljHt"BLB랋EBݍUMA|t0: 9},]Ë0: )Ћ,]Ðt&UWVS EUtK uUBp% Bp1e[^_]K t*u.UBp% Bp뿍t&UBp% Bp1Eu0UBp% BpEp>iXUD8jj jPUjj jDPU0E: 1lu1Beu1Bnu1BtKaUD8(jj jPUjj jtVU@4g1Cr1Ci1CK UB8U Bp% Bp$R3XE@PVU $E@PNU (UB8K UB 8+U,ǂ,0K.sPPj)V=Å9 ШU Bp8% BpWRU)<ZYPV Uǂ@8UB8KEǀ@Eǀ,EDPhTNEPE PE|WhN܃ P'U,EShNQhOPhDOPh|OPhOPh(PUWVS }u]G Vt@ (tPPF PPtuԍe1[^_]ftChu te[^_]ËCl썶UWVS u}]F Gt@ (tPPG PPqtuԍe1[^_]ftSdt Buue[^_]ÍB,tJ uU1gu1Biu1Bdu1Beuhup9uE LQ@dUU:tYU1uu1Biu1Bdu1B*jj jMDPhU`U:u ht@te1[^_]Í.%Fjj jE@P…t=8)8Уtjj jMDPjjjE|WhE tV@PEjPMAPuVEtqpWhRUREP3e[^_]ShRRhR؋MLQh@SVhxSPhS붋U\ShTQh@TPhpTPhT돍t&'U E hUPEPÍUWVSEEME` U@4Ew $v1ۍe[^_]ËEMfǁe[^_]ÅZ t|u WE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9l]fǃ uuhVV} …RVuPRUE ShUh^RM1QMQ{]ufdž }E FbhhX9 M xRtP Ehh8 ] pPlPEhh8 u PP1҉EhhW7 RP1҉Ehh6 RP1҉Ehh6 RPbEhhhV5 Pa1҉Ehh4 RP"Éhh4 WPvZ1YRP}WuVMQUR}W}uVMQSPhDYh^WV0hhV5 E hRdPhh4 U `P\P~hh4 M XPTPY} PW t PJtPQVSPEhpZh^P uWWV1ۋuV&}E UxdfǂD]3uR t+9|t#U]lj' }uE܅u}܋E܋P ۃ]Eƒ} ШcZU?x}E  tUq} S P}tPjE QRlPtP1U zdPM : ˋ0)P(PAlPAhPI|ʋ׉ƍTPU "P} PSLQHRDV@S<Q8V4S`Q\VXQTSxQtWpVlSQM苀PPPPPPWhH[h^Qİihh6 M 1ҋRP]EhhV5 QE Pr_Z1ҍ}RP0|hh4 ] RPhh4 u ËRP uV|QSPh[h^WT hh: E xRtPxhhX9 U pPlPxthh8 M PPOphh8 ] VQ&1҉lhh6 RP1҉hhh6 RP1҉hhV5 u RPx^ZQtRpVlQhRSPhp\h^W0hh6 E @V<SgdhhV5 U 8Q4P>hh4 M `P\Phh4 ] XPTP\ClPKhQK|‰XXTÉP "PQQjM : 0)P=P] PPLQHRU苃DPdPWV\Ph]h^RM yd4P] P] (Vuh$^h^V ]VVS]S1ۃu}fLJahh: hPdPEhhX9 `P\VEhhh8 _,SEhh8 G(RPTEhhW7 G$RP51҉Ehh6 XRPELhh6 QPn^Z1RPEhhhV5 _^$ISSh7#u7#REOQhqh^PN PP(Iu7#R$Iu7#RGPEhqh^P_(I]P]OQMhrh^QhFVtx9t txttx[^]lp끍&'UWVS ] uC,K(C@A  up t^: )Ћ : MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QS01uC4CC01^'UWVS ]} t C$@C HC uQCDHG._0uG0: Ge1[^_]ÅCt48듃࿉C$B$HB$C HC pw0Tt$(C48QQjSUCtAV4ut0Ft*F,t V9F$s Vw WWG,G( t VVWSЃe1[^_]ËC@C%QQjSCtAV4ut0Ft*F,t Vg9F$s Ps$s$+G0W4G@fUWVS } uG,_(EF@unC(^{]Ft  tZFV@r!tEQjW RUBL@ PY*C4C(XC4{Wv,dž$ E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$: )Ћ : Mb<))ʍe[^_]Ðt&C,@u hR CSS$SC0 C0 3] ue[^_]Cg: )Ћ : MbC<))ʍF48 SS$SC,{0uC0 B Va\L=: `L9rYCYP;X XF@CCF$=p{{] ue[^_]?C,@u u F@: )ȋ :  )ѺMbC<)ʍSS$SC0$(VS05C0@S4tX\L=: `LE91A@AP;XvXt$(F48QQjVgFtAW4ut0Gt*G,t W09G$s W艫 SS$SC,: )Ћ : Mb<))ʍOY)ƉHt@ALApAE+EHtALAY‹EAv'UMQ$u!ApuAdhQ$]ÃtwQ$Q$ރtytt Q$ȁQ$뽍t&'UWVSEp@@0' ^0N4$E FHM m VpecN4 ^0CL8 CP8 ;E uU1UEptACL8v̀C4  %1ljptE X C4u u CL8 uC0t  jЉU% = H E%=%`=@D %` = `@ SP:u"t%=%VpBwc^pfJFpQQPVVpu.tϋ@tF%tPPFpPVFVpt^0E1ЩptECL8CP8E N4t&EY uE1؉EEptAALڃ8v΀y4 R%1ÉptE A4u. u&AL8vA9A,sA, uA0=! u;A0t4 t+9p~VFz@ E% = %`=@%` = `@SE1ЩptE^0CL8CP8U9Es AP8 : F@t F$AP8^0CP8 N4F8FXN4z^0:)C0C,@_WWSV:^0t ALPPN4A APPPVpB ^pS$$F<@t,0^0C4,F4@4F$pu@F$ F$t&V$p V$VX^0C4@fЀ@ CLPP^0 CPPP^0V$0V$`F$pC4N$ N$VyX^0 a YF$@t ࿉F$Z$KZ$QQjVsFtAS4ut0Ct*{,t S<9C$s Q蕞^0S VF$ F$nF8Z ^8SVP$VT$ۧ^0C41F4@4#F$pu F$ F$ F8PTFp$I^0¯uC : t )ȅ/uC : t )ȅuC8 : t )ȅN4¯uA=: t )/uA=: t ) A8=: )t~p ~8 N4^0CPHFIF$tFJ: H: : )Ћ : Mb))ʍډVL[t+F$ u%F@tF0PH@D t V VEP t! Pg%U9u MA$t2 ȃP7%MHQDEt: Mx Ox 51N5vt CLPP^0C CPPPmt0V$V$t)QF$F$t4F$@F$t@#0PPSVF$0ʃ 0GtWWCPf@ %PF0@Lf@ %PFSQhszh` tPh` j p~<@PPfF|%PfFD%PFPWhzh` tPh` jo~tPPfF|%PfFD%PFPPhzh` /tPh` jOovUS E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]fȋ@fG뱐UUM Ѓ  ]ÍUU E  1]UU E  1]USUE у  %t []Ít&'USU E  t []U E ]ÍUWVSE]1C]U<DAeu1Gqu1Gft1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$P~E @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@fU E P RPEP脋%Ðt&UEP]fUEPQP@ ]ÍUWVS u }PPWCPuZt9ue1[^_]Íe[^_]UWVSj(EPYtu=tSu)E_t:QUsREPCPo\u CU<tCu΋?ue1[^_]Íe[^_]à EP[}r&USRË@tS u CP] Sw]]à P҃C P]]؍t&UWVS ǍX@09uG __uGHIHe[^_]à P ]GHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjj\EtU؉PJEAJMA AAAWWj(SXtV@EQQj)PXRRNjE)ǍGPj\ÅPWEPS [E܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASfU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt f@u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐UWVS EEEjjj KÃ}ظt4 EE1j Wh ,jSG @t SFe[^_]F8%ƃ֐UUM Ѓ  ]ÍUU E  1]UU E  1]USUE у  %t []Ít&'USU E  t []U E ]ÍUWVS,EX= EE9E   = U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Emu=C  1ۋ= PESPWCY^PES1~U;u%t1t& |u FU;u%uӍe[^_]ËEH  E؃t|t؉ڃ  t | l DZ FST Ju : E f1)ЅM )CM  SQ&'UVStuP jF t\PPSjE t5PPSjE t e[^]à  PE  PE1F8Ѝe[^]Í&US ]PEX PEY REC8]U]ÍU  |)A ; ǀ; B4B8B,RB$QB(QB NBMBMB MBNBNBNBPN]ÐUSQ̀Ãv zAۉZ[]É'U MʃɋU B]!Í&'UWVSE E9E 5 Uu U1ۋuǃuɋ9tR=  tɃ  ̀Ãv@ۉ5 uf]EC]9E` [^_]Ít&'UV5 SӋu%  @  ؉[^]ÐUWVSSE] ƉEC< 1uE  ى Z[^_]Ít&'UWVSPE] ƉEC< 1t!E' ߉8MSSWQ*E9}E7u |t&u]F u]9} E DEMɋuEMɋtU | t ]z EPT u]F u]9}lve[^_]Ëut UR jE: )ExC]fEZUVS tuу<@ PP@Pj? QQSju? tlRRtPjW? t=PPtPj9? t e[^]à  P1?  P ?  P?  P; 1F8Ѝe[^]ÍJKvUSS]S  Q>Z P>X P>X P> x P: C8]    Ít&UPPt@P1҅x P%:Ð&UPP x P9t@  Í&'U   )A ; ǀ; B4B8,B,@YB$pWB(XB UB0pYBRB0TB0TB TBTBTB@U]ÐUSQ̀Ãv 9ۉZ[]É'UW= VSË4u+  Q Љ  C [^_]ÍUW= VSËt3N H 9t  V Љ[^_]U EM ]%ƒ ЃÍ&'U1VSSS]5 M tt#1^Z[^]Ð  A  5 M 11‹ Љ^Z[^]ÍUVSQQ1ҋ]5 M t1u1m5 M 11‹ Љ^Z[^]Í'USj]SjSy]Ít&US]R []ÐUWVS,EE E EUfE1HE MEС uЊ؃EE܅t H xsMЋ1 ؃d3E Q EME|]M ( EȋUܣ( ]}H  9v$ @MM$   uu C 1( ]9vUЋ9U}UЋX= 9U~U ( 0  , UЉ̀E؃v5]؋UEPPEPW҆EM؃9M\E3vU1 u]F uM؉]9M ]ԡ,  DEЍȃdttttD1= uЊ` D < ШV1D 4 V = U1 $ D< Ш1D  }WTu]F uM؃]9M  E= 1ҋE1Ш tq tu u}Ƀ]1Ҋ%4 t4 uЋ0 58 4 ̀Ãv 3ۉEI]MЋ |L EPT  ]1Ҋ ЉV|-L EPuf  ]1Ҋ Љ  u1Ҋ Љ  u1Ҋ ЉE5 : Ef1)ȅE)ȍx v  $ @$ e[^_]ã$ E Ee[^_]vUS]t@0 t9|n  @RRPj4, tuPPtPj4 tEPPtPj4 tЋ]Ðt&뎃  Q4 , Ro4 0 Pn00 C81҉Ћ]Ã*t&US ]P4X P4X , Q40 x P00 C8]  , UPPt@1҅x P/Ð&UPP0 x P}/t@K0 Í&'U  0 )A ; ǀ; B4B8B,cB$0bB(@cB \B0cB0[Bp[Bp[B [B[B`\B\]ÐU=iEhjj=3‰tFEPh L hjR/ u 1"t&56.ÐU5.UEEPh L hj5i/ÍvU L ÉUj uhj5X/ÉUj uhj54/ÉUE=t =t!v55U0WV}XW-…uEPu.j0t&jEPR.Eut1e^_ÐU)tu tj -1ÐUm5s0ÐUEM BJh1ÐUSUM ]HXh1]ÐUWVSE} @ÂʉȻւtzt80t1@80t,@80t'@utttu߃@@)ȍp} tUE xtL؉ڃtzt80t1@80t,@80t'@utttu߃@@)؃1ƅt7t9rU BPSQhEP/GPQUR\/ED8e[^_]UEPЉ]U S]Eƒtt t@tjEPEPEPRE P+‰ECtjjReC1 E]]ÐUWVSu }UMEE@ |tE@|t1>t: wUU- P+EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ-9sUډ@C9r18}t MQ,F w$ p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$؎~1ۊY!#E9t]υt=p1A1ҊQ 9At1t1p%뎉[^_]ÍvUWVS1]1O~PP$ E PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1p%`FW1C1ҊS ƃ>FC4M!1̓w3$P1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊpL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ pT$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$pS!1C!̓w$p1BR Ѕ~1(jjj1pPÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸DNju =Dt3%9uVPEP# uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$EU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0RT}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCS$T`MMT~`U(RjjTQtWTVP`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Q` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPPE`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$EPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSPQ u @CRQ VD;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPW t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM111ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$dE%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEܡMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $TjE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$H@vP@t<)u担87DžRt#H@%u㋅8) PB<v?t { 5B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WЉƃ؅uDžM ERCP~NF fF(ffVffNfF}ܡtSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VЋU+M M}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$̙]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB P C MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh U ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PЉEupEEMP EPRQwUM$ ABLErLPjURMQEPURCPV u'EMA`Up9R]Ex`UH EPRQ1C1ҊS à ;AoEUB`Up9&RM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ$[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE ƙDž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžܡE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Default settings : maxconn = %d, maxpollevents = %d Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Could not open configuration file %s : %s Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Cannot set gid %d. [%s.main()] Some options which require full privileges might not work well. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789:+Gd s@  @@#, 6splice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsindependant-streamsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' Invalid server name: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootdescriptionpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledhealthenabledbind-processevenappsessionrequest-learnprefixquery-stringcaptureretriesblockunlessredirectlocationpath-parametersuse_backend(unknown)force-persistoptionhttplogtcplogheadercaphdrrewriteindirectinsertnocachedefault_backendredisprealmhttp-checkmonitorfaildisable-on-404send-statescopeenablehide-versionshow-nodeshow-descpostonlyclear-cookiecodedomaindrop-query%s; domain=%sappend-slashbacklogfullconngracebalanceserversourceusesrccliexpreqrepredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackclienthttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForHELO localhost HTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 EHLOHELOreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionclientipintefacehdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d]: '%s' expects a string argument. parsing [%s:%d]: '%s' requires valid node name - non-empty string with digits(0-9), letters(A-Z, a-z), dot(.), hyphen(-) or underscode(_). parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : Unknown host in '%s' parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : Socket path '%s' too long (max %d) parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' [options*]. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : unknown mode '%s' parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : error detected while parsing a 'force-persist' rule. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable', 'hide-version', 'show-node', 'show-desc'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: '%s %s' invalid node name - should be a stringwith digits(0-9), letters(A-Z, a-z), hyphen(-) or underscode(_). parsing [%s:%d]: out of memory. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d]: '%s' requires a parameter or 'desc' to be set in the global section. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d]: '%s' has to be > 0. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. Maybe you want 'maxconn' instead ?parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. Maybe you want 'fullconn' instead ?parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d]: domain '%s' contains no embedded dots nor does not start with a dot. RFC forbids it, this configuration may not work properly. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : '%s' expects 'code', 'prefix', 'location', 'set-cookie', 'clear-cookie', 'drop-query' or 'append-slash' (was '%s'). parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'disabled' ,'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d]: line too long, truncating at word %d, position %ld: <%s>. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracking: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracking as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled again; name=%s/%s; node=%s; weight=%d/%d; scur=%d/%d; qcur=%dCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPDOWN %d/%dUP %d/%dNOLB %d/%dNOLBno check; throttle=%d%%HTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)undocumented 'timeout appsession' may not do what you think and will be removed in next versiontimeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. config : 'option httplog' not usable with %s '%s' (needs 'mode http'). Falling back to 'option tcplog'. Proxy %s stopped (FE: %lld conns, BE: %lld conns). %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. `,6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket (%s). Aborting. Invalid empty name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket (%s). Aborting. error when trying to preserve previous UNIX socket (%s). Aborting. cannot change UNIX socket ownership (%s). Aborting. socket(): not enough free sockets for UNIX listener (%s). Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener (%s). Aborting. cannot listen to socket for UNIX listener (%s). Aborting. cannot switch final and temporary sockets for UNIX listener (%s). Aborting. cannot bind socket for UNIX listener (%s). Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE<HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. Iy=p:0iiiiiZ`)$D%$$#$#G$''\&&\&&&HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough memory process_cli():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). Not enough Memory process_srv():asession:calloc(). Not enough Memory process_srv():asession->serverid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valshdr_ippathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublicmax-age=0s-maxage=0no-storeno-cache="set-cookieSet-CookieSet-Cookie2%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/srvrepsrvhdrCache-control: privateConnection: close: %d.%d.%d.%dclireqclihdr: %s /Expect100-continueContent-Lengthappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratefe_connbe_connavg_queuelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓no checkMAINTDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,MAINT,emptyOPENFULLSTOP activeY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,

%s text/plaintext/html on unlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')'stats socket' path would require truncationa positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max,
%s%s
%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,DOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy%s%s version 1.3.26, released 2011/08/05

HAProxy%s

Statistics Report for pid %d%s%s%s%s

> General process information

QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle
Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s
Backend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%s
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%lld%lld%s

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits: memmax = %s%s; ulimit-n = %d
maxsock = %d; maxconn = %d; maxpipes = %d
current conns = %d; current pipes = %d/%d
Running tasks: %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.26 Release_date: 2011/08/05 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d node: %s description: %s rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: sp,}` '=`U#req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_endf{k{7#w{}{7#{{7#{H7#{H{7#{H{7#{H{{7#{H{7#{H{7#{H{7#{H{7#{[H|7# |3HyJ7#|/H)|7#+|8|P|7#S|$wP|7#_|h|7#7#ccccccc!=====#54455a87798P8parsing acl '%s' : matching '%s' for pattern '%s' is likely a mistake and probably not what you want. Maybe you need to remove the extraneous space before '('. If you are really sure this is not an error, please insert '--' between the match and the pattern to make this warning message disappear. Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splice4CFIL      ‚{m_@$݁ʁmatch failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6djjjjjjjjjjj:;<=>?@[\]^_` >82,& xdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error kFkFkFkFkFkFkFkFkFkllllllllllllllllll7kl7kllllll7kllllllllllllllllllllll7kllllllll7kllknnnnnnnnnnnnnnnCnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnananannnnnnnnoJoJoJoJooooooooooooJoJoJoJoJo`o`ooooooooooiooooooooooooooooooiooooooooooooooJooooo4o4o4o4oJonnJoooJonoooooooo?q?q?q?q?q?q?q?q?q?q?qCqCqCqCqCq?q?q?qCqCq?q?qCqCqCqCq?qCqCq?q?qCqCqCqCq?qCqCq?q?qCqCqCqCq?qCqCqCqCqCqCqCqCqqqCqCqCqCqfqfqfqfqCqCq?q?qCqCq(q(quЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍuЍЍЍbu||ЍЍ vЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍ|ЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍFv̌ЍuЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍЍ|uzy^yyyyyȉȉȉȉȉȉȉȉȉȉȉȉ݈݈݈݈݈݈݈݈݈݈Ԅȉȉȉȉȉȉȉȉȉȉȉȉȉȉȉȉȉȉڈ}}}}zXXXXfqqfqrf|Wɝ""""""""""̜|||||||||||||||K||||||||||||||||||||||||||||||||||||||||||||̞|||Ԟ|||||ܞ||||iz³1Twy6.555555߹޽޽޽޽޽޽888888SSIvh8885ܪ5ܪOQqٯqB7%6GXiy$\,!!ѡʡ}tqng ` ]U L D 90'ڠРȠ !"# u$r o l b%Z&XU I'FC=(2)&* +,  -./ݟП0ɟ123456789:~;{<yvspZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;*4+`zR| (x (Hl P`w*BRY0d$  h( ` ԏ8o\oo *:JZjzʓړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjz p'xx$).48<BHOV]dkry@PP#301@p82 #p82#31@#31.%@+%@6%@A%@L%`unix_streamnlz@0 L>D???Hpnn oHoo@-Ho@p@-(H3p1/H@2q@-3H@2qp.;H@2q.CH@2q@/KH@2q`1SH@2q1[H2q-cHp8Pq2jH3q1oJ@2s@-yH2s-H@2sp.H@2s.H@2s@/H@2s`1H@2s1H3s1H30u1Hp8v2sH@2Ps@-xH2Ps-H@2Psp.H@2Ps.H@2Ps@/H@2Ps`1H@2Ps1H3@t1H3u1Hp8v2H@2 w@-H2 w-H@2 wp.H@2 w.H@2 w@/H@2 w`1H@2 w18@@ABHCDDK3 1%K31/K31? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&-ic9-$-c$CeDD$ c$JecIDK$"c$RecQDS$"d$pfdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$@fDDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$fDDD!D(D7$;d$fDD $d$gdd DD DDDD+D/d@d@d@/$/e$4gdd #eDDDDDDD*D1d@d@.e@d@1$19e deglibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)P|690:PsIйOy@;c@` v 0 K4ݣMP) B&оF]$p"{ 5w8e@8 b-t?  }v ` ի$ %l@*1,O.&B4MF(VG^[`HcMlM5Rj`Zq 0|6+display_version+display_build_opts+usage ,sig_soft_stop3,sig_pauseZ,sig_listen,sig_dump_state,dump,init/deinitm2run_poll_loop2main4global4progname4pid5relative_pid#5trash55zeroG5oneY5nolingerp5stopping5hostname|6UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)9%a2base64base64tab8:HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_authBstats_set_uristats_set_realmstats_set_flagZstats_set_nodestats_set_desc"stats_set_refreshdstats_add_auth,stats_add_scope_O3}%ultoa_r%strlcpy2&ulltoh_r&limit_r&str2sun1'ishexX'invalid_char'invalid_domainchar'str2sa7)str2sa_range*str2net,url2ipw-str2uic-url2sa.encode_string&/str2ui/strl2ui&0strl2uic0strl2ic31strl2irc1strl2llrc1parse_time_err2my_strndup3itoa_str3hextab$ init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace0 buffer_replace2 buffer_insert_line2 chunk_printfW buffer_dump pool2_buffer-L'Alert'Warning5(qfprintfz(get_log_level(get_log_facility&)send_logX+tcp_sess_log-log_facilities8-log_levelsZ-monthname|-sess_term_cond-sess_fin_statec+$__task_queueF%__task_wakeup%wake_expired_tasks'process_runnable_tasks)init_task*nb_tasks +run_queue+run_queue_cur.+nb_tasks_cur@+niced_tasksR+pool2_taskd+last_timerN _tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnro Z get_pipe kill_pipe put_pipe pool2_pipe8 pipes_liveJ pipes_used\ pipes_freeR E'$exp_replace%check_replace_string&chain_regex&pmatchK4oU/warnifnotcap0warnif_rule_after_block`0warnif_rule_after_reqxxx0warnif_rule_after_reqadd1warnif_rule_after_redirecth1warnif_rule_after_use_backend1warnif_misplaced_block2warnif_misplaced_reqxxxl2warnif_misplaced_reqadd2cfg_parse_global:init_default_instance:cfg_parse_listenRgreadcfgfile jcheck_config_validitylcfg_register_keywordsmcfg_unregister_keywordsmcfg_maxpconnncfg_maxconnnsslv3_client_hello_pkt0ݣp%$srv_downtime$srv_getinter/M4-process_chky2start_checks)($srv_dynamic_maxconn %init_pendconn %pendconn_freeX%pendconn_get_next_sess~&process_srv_queue'pendconn_add'pool2_pendconn0B&7+get_frt_addrU,event_acceptF]3g(proxy_cap_str(proxy_mode_str,findproxy_mode-findproxy.findserver.proxy_cfg_ensure_no_http4/start_proxies/soft_stop]0pause_proxy0stop_proxy0maintain_proxies*2pause_proxies]2listen_proxiesa3proxys3next_pxid3listeners$8'uxst_add_listener*uxst_event_accepte-unix_sock_parse_requestA0uxst_req_analyser_statsi1uxst_process_sessionT8unix_sock_usage_msgk8unix_sock_usageyk&/init_proto_http/http_header_add_tail0http_header_add_tail20http_header_match21find_hdr_value_endU1http_find_header2h2http_find_header3error_message4perform_http_redirect5http_return_srv_error5http_sess_logB8capture_headers=9http_parse_stsline$:http_parse_reqline;http_msg_analyzer@=http_capture_bad_message=stats_check_uri_authg?http_process_tarpit@http_process_request_bodyAcheck_response_for_cacheability|Bproduce_contentBapply_filter_to_req_headers"Dapply_filter_to_req_lineEapply_filters_to_requestmEmanage_client_side_appsessionxFfind_cookie_value_endFdel_hdr_valueGmanage_client_side_cookiesIapply_filter_to_resp_headers Kapply_filter_to_sts_lineKapply_filters_to_responseYLmanage_server_side_cookieslOget_srv_from_appsessionPdebug_hdrPprocess_responseoThttp_process_requestIhpool2_capturehpool2_requrihhttp_is_ctlhhttp_is_sephhttp_is_lwshhttp_is_sphtihttp_is_crlf.ihttp_is_tokenFihttp_is_ver_tokeniHTTP_200ihttp_200_chunkiHTTP_301iHTTP_302jHTTP_303jHTTP_401_fmt6jhttp_err_codesnjhttp_err_chunksjhdr_encode_mapjurl_encode_mapjhttp_methods6ksess_cookieNksess_set_cookie 50(splice)stream_sock_shutr))stream_sock_readj+stream_sock_shutw+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv.stream_sock_chk_snd8e,&appsession_task_init'appsession_init@(appsession_refresh<)match_str)destroy)appsession_cleanup~+pool2_appsess+apools+have_appsessionICP&,recalc_server_map-init_server_mapx0fwrr_init_server_groups6fwlc_init_server_treea7get_server_ph7get_server_ph_post 9get_server_hh9assign_serversAassign_server_address,Bassign_server_and_queueoBconnect_serverMEsrv_redispatch_connectFbe_downtimeFbackend_parse_balancew'$stream_int_check_timeouts"%stream_int_report_errorF%stream_int_return%stream_int_retnclose 5B-print_csv_header-stats_dump_proxy.stats_dump_http/stats_dump_rawk0stats_dump_raw_to_buffer0stats_dump_sess_to_buffer1stats_dump_errors_to_buffert? 7,tcpv4_bind_socket).tcp_bind_listener/tcpv4_add_listenerF/tcpv6_add_listenerm/tcp_inspect_request%}vX58'sess_change_serverm'session_free(init_session(session_process_counters(sess_update_st_con_tcp)sess_update_st_cer5*sess_establish*sess_update_stream_int,sess_set_term_flags,process_session3default_srv_error4pool2_session4sessionsիAhdr_idx_add@&.%signal_inits%signal_handler%signal_register%__signal_process_queue&signal_queue_len&signal_state&signal_queue&blocked_sig`1<9+acl_parse_nothing+acl_fetch_nothing+acl_match_nothing$,acl_match_stre,acl_match_reg,acl_match_beg -acl_match_endL-acl_match_sub.acl_match_dir.acl_match_dom.acl_match_int9/acl_match_ip/acl_parse_str/acl_parse_regc0acl_parse_intS2acl_parse_dotted_ver?4acl_parse_ip4acl_register_keywords4acl_unregister_keywords4find_acl_by_nameV5find_acl_kwW6parse_acl_expr87prune_acl7parse_acl8find_acl_default8prune_acl_condF9parse_acl_cond_:acl_exec_condo;cond_find_require<filt_cap<default_acl_listr.&'$create_pool-%pool_gc2%pool_refill_alloc%pool_flush2&pool_destroy2<&dump_poolsI4Mread_freq_ctrifreq_ctr_remainnext_event_delay.(Vfeb_deleteeb_insert_dupc[[;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)c'-check_cttproxy_versionOO__udivdi3`O__umoddi3x6 P0y 07i  "0{ #[2-y &tk 5int 60 >Em ?ER AE3 C Di; GP7ro S UH  09 &-<5 &-@'#!' #' #b ' #  '#'#A'# '#z'# '#$'#(+ '#,M'#00'$#4.'#8O'#<'#@'">#D '#{#FH'$*#Gb'(:#H'1#L'7/#Td'8/#X':#\"'<@#` / ' ' '#  '$# B '#< :  P 3oBTGQqFz #D #E# #F# $[ >   # #  + R # J # t +# ; wgy 6 7#w 8#2>40YgG ro  b# ڰ# }# n ܓ# " # 7 =%kC%t %v# %x#hnh#ph#C"  - C#ref!h#0]4!w !x# !yC# !z0# !{0# '!|0# r!}0# 9:!~0# @!0# -!0#$ u!0#( @ c bc# ss @ H#s#s# bit#u32"0* +y#key,#r H0wq1#rq2# 3#0 4#4 50#8 6#< 7/#@ 8#Dr)  D# # # [# C#: D# #)8)J )K0# * )L0# {)M/#fd)N# @)O0#exp)P0# D6)Q# 6)R# 06)S# 6)T#$ib)UJ #(ob)UJ #, x )V0#0 )W/#4J # )U @"}0#rex"~#wex"#rto"# wto"#cto"#l"0#r"#w"# lr"#$ >"0#( "0#, "0#0 "0#4 H"#8 )"A #< "7#@ "7#A "b#D <"#L "#P "M #T "S #X y 1"tstr"u#len"v#  J  A p "z *C# L*C# *# !*#fe* #be* # *# @*#$ Z *0#( D*#,req*J #0rep*J #4si*"#8 *# %*# *#srv*V# p*V# Q *V# > *"#txn*# *# * # *"# y3*"# # *Â# *Ă# ,*ؔ"# *0#y  G d ] Tn  # ! # k auid ^f#gid _P#  `[# bux a  ! Lfd M# N# h O# $@ P# Q#  R# $ S#  T0#  U#  VC# * W# B X# ' Y# ` Z/# [0#  b # ) c# T Q u m#  n# S o#  p# q# r#  s#$ 6 t#( !7 u#,  v#0  w#4 { x#8 @ y#< h zC#@ e {#H  |C#L    FCfA#bBJ #.(?cbC# {D/# E7#evF7# G # H# I# J$#$ % $ J 9:#get#put# u# # C<_ ``/# Aa##setb##clrc## NBd## Ae##remf5#clog5# 6hR# }:ih#$ OCjz#( _%kh#, Hlh#0 um#4 n#8  5)LL*;hLXzLn a ^/# _%# k`%#ae+ ,# - # .# /#  =P h# O#II=5-8len-90#cr-:0#-;0#b -Cv-D# 9:-E# -F# 2*-G# 4-H# U0,    D ,,l,#m_l,#u,#u_l,# v,#v_l,#,l,#v_l,#c,#c_l,# r,#r_l,#,rq,;st,D, P ,0#col,0#sov,0#eoh,0# sol,#eol,#som,0#  ,ߔ#sl,# ,b#8cap,#@J, t4,0# b,# ,P #req,#rsp,#\uri,# ,# ,# FJ,# @,0#7G  &0# f 0# 0# g V AI JV# K# * L# M# N# O# B P# (R # S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< XC#@ !Y#H $@[#L p\#\ ^@^#l `#| oa# b$# @dV# dV# e# o f# wg# h# i# ;i# )$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hwV# yt# yt# jz0# {q# }t# }t# ~t# ~t# t# .J# 0# t# t# t# Qt# U# (tDR # # O# # h# r# # # B$#,aclC#0 C#8 C#@ C#H >C#P ?%#XsrvV#d e #h ? #l h μ%#p K# Z # Ҕ# # Ԕ# 0# ֔# gה# [# ٔ# R ڔ# # ܔ# ݔ# # G # R# 7# m.'# # /# C# '&#id# +# C# t# 4 # # 0# i0# 0# 0# J# 0# +J# 0# t# t# t# $0# 0# `0# # z#### #8##0#j0#  q# t# t# t# t#  t# t#) t#t#Qt##cap#p#^@##o# #m ##u ##J{#{#### # #g# #B #p !#"###Z##$7(#]%7(#&# '#O(#q)=(# )=(#*#w +#,#-M(#= .#/# 00# 10#F2x$#:2x$#H\H ; + + C# +! #srv+"V# !D* *# *|# *|# /*|# *# *#  *#$ u&*[#( } *[#, *[#0 *t#4 Q*t#<!"*px*Ƕ #sv*V# *ɂ# D*ɂ# @*0# iid*˔# J*˔#sid*˔#8" * "*n#"*iid*є#px*Ҷ #buf*0#sid*0# ptr*Ք#bol*֔#"*!(*̪!!*!"!*8" "  " "" "J"]#acl$*$+C#u$,#2D$-C#  $.#$/0###XD$>$?C#g$@C#pol$A#$B0#.$C##p7!$@4un5d in6#p2u7##x$x , H#t0H#t1H# }: #  # # D#$ #($ |#len0#pos0# sid0#srvV#oe #src#bufS #%be !u9%  !0# .C#l% srvl%# # #V%Xact##bck##,%actH#bckH#& # Q # # # # # 8 # V#map9%# r%#, Vȗ%# T ɷ&# 8ʷ&# \:˷&# /̷&# ͷ&#&V&6'  # 4# :# <# A# +# \# !#'m.( 7(# &)# *# +# ++# 7,# @-# -.)# /)# 0'#$6'7(! $  7(# u # Z #len # \ !# F "#' M( ](P #(;$9 $u:(@56C#E7(#be;](# c#T)x(CDC#EE(#JF# G#%H#I#@J0#K# L#$)   )# # #T))  )# # G#)*.S C.O# .P# h.Q# .R# + .;uid.<#gid.=# .># $.?# ,.@#  .A# !.B# a.C# .D# |.E#$ .F#( <.G#, .H#0 .I#4 +.I#8 J.J#< .J#@ .K#D .K#H .L#L  .L#P m .M##T u .M## .S)# .T # Y.U#% PnU&+{pU'+(+)+C*__cB+ ,(U,u+3, U-sig.Z, U-sig.,  )U/sig., 0RU/sig0p V10sVS.,\?`pU/sig>..}:pU2V2+W0iS3p3'l4tmp3h3d5-3S6- 0__s/W5-`0ret'W5-0curV P3 WV3WS7,..cq(.'.cq(.(/(/7`..(.'.(.(/(/7../5(.'./5(.(/(/'.NT(.'.NT(.(/(/8.n9m8/ -9+9x+9,.r11U0p W0p0 P0h7(S3E7(V0sVV3cVp0lP3S3E(S3/ (V0expS3P0acl]#S3]#V3Jr1S3B r1V0rdrx1S3Cx1V0uap'V0ua'l3C")S0iS5u0:\h50:\h50:\h50:\h50:\h71~1(1'1(1'1(1'1;1P7811;;1Q'2r(2' 2}(12'1}(1((<1"*t<1*t<1*t=1]>\1=2*tǂ< 2 ~*t}<;2 v*tu?m2 իU/sigV0pS@2 ]U3tA2BjBC3\'` U22+ 0errV3}S3'h33\543 0w|`5g380px S0retP3 V53X0ret>P1x3j!P1D[&3DJ &3DL&3D(L33 D(M3D4DD  D q*D.v'4FDwD xD .\ e4E D/QT4F(O D0;D0<D1;0Gnow1<|D1>|DZ %H s*`H5nIpido@ HXptDh.]HS ` H& 4Ione0Hk5( ;H3  5 H53 D5 2#D 3$D4#Dj 5DD Q0DR0D U0D VDW1JlJ[m=(JJJnQH '0y 07i 2-kint7rn#p#) D}#}#h#E# #:<P #N# H H< 0CU ptr}Q h0S 'hPU[%S&NP i(hQ 4ٳU[3Vp 3HS idx50P ~<~7U[;RD;}W idx=0P!>HS&C%C% J@U[Ipp IHW idxK0P!LHSp&R%R%\S['U[ZW i\0V!]HS\g) M00OyF0MUinQ?VoutS/4intr @7 < D ùP0y7i "%2-y&^kint6%>:m?:RA:3CDS7rH %9 -5 -@ s#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. s#8O s#< #@ "3#D #e#FH $#Gb (#H 1#L 7#Td 8#X :s#\" <#`    #  # B s#    3-n-#p-#o BT G Q$[3  _# #   R_# Jz# t#  w    b  #  m   # # # bit s#u32"%* +##key,m# H0wq1x#rq2x# 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,)8J K%# * L%# {M#fdNs# @O%#expP%# D6Q# 6R# 06S# 6T#$ibUg#(obUg#, x V%#0 W#48g# U @}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )#< ,#@ ,#A L#D <#L #P #T #X~~gp m  ] auid^I#gid_3# `># buxa!LfdMs# Ns# hOs# $@P# Q # Rs# $Ss# T%# U # V# *W # BX2# 'Y # `Z# [%# b# )c# TQ um # ns# Sos# ps# q_# rT# ss#$ 6t #( !7u #, v/ #0 w/ #4 {x/ #8 @y/ #< hz#@ e{s#H |#L ss s  / s  V  Cf A #b Bg# .( ?cb C # { D# E,#ev F,# G #  HT#  Is# J #$ 5 j   C< _ ` `# A a #set b #clr c # NB d # A e #rem f #clo g # 6 h # }: i1 #$ OC jC #( _% k1 #, H l1 #0 u m#4  ns#8 s s s      s  1 s ! C  7 n 'PU! S /ӶU!. S >sU = P!? S \Ls ]U K P!M S( *Zs`U!Y S^ jsU i P!k S Lx=U!w Q !\|- @cU  P pU  R"v!\-) sӸU  S#errsV_s#U  S#errsVrs0sU  S#errsV7sùU  S#errsV$[ $J $ q $. vV $ ws )% $Qxй0ly 07inti 2-k7r  #>#}# #>#G}#m.('7(>#&)}#*}#+}# ++}#7,>#@->#-.#/# 0#$< йU  <V uS 7 4O 2  '%%%}Pp '*%*}P@U  ?<uri?}S uASB}V 7C> S Q\ |U  [< [} u]S^}V ls jgZuU  < >P uɝRv<U  u<W uu}P uwSkx}V  "]@̼U  <W +}P uS-}V  dмU  < >P uR&\U  < f} uםW}V e%> >-SB&p Qa 7U  &% %U <}VuWH }V{ S pout'%#0?&%%390y #07o Bi "02-y&tk2B5int60>Pm?PRAP3CDi7roS UH 02I40Y1G <xo bR#q "7 $Po BT G QqFz %D%E#%F#J 7  J G#  A J$$[I_ +#_# o R+#J#t#  w+#G#n ]#" # B d r\ s#L t # u# v#  w #6Tn  +#!#  k 9 -L5 - @# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .#8 O#< #@ "I#D #{#F H$#G b(#H 1#L 7/#T d8/#X :#\ "<#`/ # #B #Y  R  3 b#  E  # # # bit#u32"0y*+#key,E#n#p#y" - y#ref!#H H0wq1P#rq2P# 3#04#450#86^#< 7/#@8#DXXXH]4$w $xL#$yy#$z0#  ${0#'$|0#r$}0#9:$~0#@$0# -$0#$u$#(  )8J K0#* L0#{M/#fdN# @O0#expP0#D6Q#6R#06S# 6T#$ibU< #(obU< #,x V0#0W/#4 < # U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)3 #< B#@B#Ab#D<#L #P ? #TE #Xk 1tstru#lenv#| | <  3 p zy#Ly# X#!#fe#be## @#$Z 0#(D#,req< #0rep< #4si!#8 o# %o##srv^#p^#Q ^#> !#txn# # #!#y3!## Í#č#,؜!#0#k  9 V ] auid^#gid_#`# buxaV  !LfdM# N#hO#$@Po#  Q#R#$S# T0#U#Vy# *W#BX^#'Y#`Z/# [0#b #)c# TQum#n#So#p# q+# r # s#$ 6t#(!7u#,v#0w#4{x#8@y#<hzy#@e{#H|y#L     CfA#bB< #z.(?cbCz#{D/# EB#evFB# Gd#H #I#  J#$   J9:#get#put#u# # p 7$@ 46un 5jin 6$p 2u 7#w) D###[# y#:$d  "a"^/#"_%#k"`%#"a e!+!, #!-#!.#!/#  EP #W#QQwE5(8len(90#cr(:0#(;0#b (Cv(D#9:(E#(F#2*(G#4(H# ]8'           D ' 'l'#m_l'#u'#u_l'# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'Cst'D'P '0#col'0#sov'0#eoh'0# sol'#eol'#som'0# 'ߟ#sl'#  'b#8cap' #@R't4'8#b'# 'B #req'#rsp'#\uri'# '#'#FJ'#@'0#7G &0#f 0#0# 1!^ AIJ^# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<Xy#@!YX#H$@[#Lp\#\^@^#l`#|oa# b#@d^#d^#e#o f#wg#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guP# v#hw^#yt#yt#jz0# {#}t#}t#~t#~t#t#.R# 0#t# t#t#Qt#U#(tDR# ]#O]# # h#r###B##,acly#0y#8y#@y#H>y#P?###Xsrv^#de #h? #lh ##pK#Z #ҟ##ԟ#0#֟#gן#[# ٟ#R ڟ##ܟ#ݟ##G #R#7#m.K%##/#y#'$#id#+#y#t#4 ##0#i0#0#0# R#0#+R# 0#t#t# t#$0#0#`0#]#z]# ]# ]# # # 8# # 0# j0#  #  t#  t#  t#  t#  t#  t# ) t# t# Qt# #cap# p# ^@# # o# # m  # u  # J{# {# # # #  # # g#  # B # p ! # " # ## Z## $W%# ]%W%# &# '# O(# q)]%# )]%# *# w +# ,# -m%# = .# /# 00# 10# F2"# :2"#Hd ; && y#&!| #srv&"^# D ## # /###  #$u&[#(} [#,[#0t#4Qt#< )!pxǾ#sv^#ɍ#Dɍ# @0# iid˟#J˟#sid˟# @! "Τ# !iidџ#pxҾ#buf0#sid0# ptr՟#bol֟#!(̲ )!@! !  !| !!| !J"x ,#t0#t1#}:### D#$ #(##len0#pos0# sid0#srv^#oe#srco#bufE ###beu H# !0#.y# {# srv{## # #^ #Xact "#bck "#, #act#bck# $#Q # ## ##8 # ^#mapH## ā##,VȦ##T $#8$#\:$#/$#$#$^$ E% #4#:# <#  A#+#\#!#m.E%! Q% m% }%B "%<U#n;[Q$# ; $9:;%pos=S"&, OU#dst+R#src+S$9:+Q&-V"&PPgU#nObVW$# O$9:O&V+QS& Rp"&rpU#nq[R$# q $9:q#altqP"+'|+'U#str{S%su}j &~P'(__s/j"X'"U#sR"'x0tU$uQ"'U$uQ"((U#strS%saж%ret(W%cP&#ӟV)outs*g((__s/P(0I B(__u((__cՂ+((,=,(-(,=, ),),$).(Y_%__vIP'%he1)P&(/(n0m/1) -0+0x+ 0,"*Y(U#strW#lowP$P%sa%ret(p1cS2l2V3out(*(*4__s/5*606I6 B4__u*4__c**1sep V+s*(IX,(-(IX, ),),$)-(X\,(-(X\, ),),$).*1__v!IP'1he1)P)7,;4CU8str39$@3, 9O3,:f:d1c6V1s6W2p7S1len8[P*+04__s>/5+>6>06>I6 >B4__u>,4__c>*+,H4__s?/5,?6?06?I6 ?B4__u?,4__c?*c,`1errId-(, );)P,$).~,1heW1)P'+4__vN0]++7a-nP:U9$@mV8dstm,P2 ol2oh1choQ1tmppa-p1tppq-W1cpqd-@0?s(i0(j07./pWU8url9T 9$@(2S1cpV1retR2Q20p'@D4__vI7/V`U9V+Q9  9s8map/9qV'2R!/ 7r/E0'U8s-r/;/Q<=/R>/C0?sڣ(i07/800YU8s8lenP-/13;0S;0Q<=0R>&060?s?len(i0700`U8s8lenP-0df;0S;0Q<=0V=0R@0A00BsBlen4i04j04k0731U8sS8lenQ1iV1jR4k71+U8s*V8len*S8ret*P1i,Q1j-R71f[(U8sZ8lenZ 8retZ1P1i\tVW1j]lt72"0U9 S8ret2P9020V2~0W2x0p2*0l2.0d'p1j0R072d9U8srcW8nP1lenS1retVC1 K33 IC L 3&3 C M 3C[ E3CJ E3C.ve3Cw 3 D"x34  3 E3 3 p ~{@0y+06ri%7i 2-y&vkint3CDk76H H9 -r5 -@#! # #b  #  ##A# #z# #$#(+ #,M#00#4.#8O#<#@"V#D #}#FH$#Gb(#H1#L7#Td8#X:#\"<#`x 6   #  # B # 6  6 3n#p#]4w x}# y# zH# {H# '|H# r}H# 9:~H# @H# -H#$ u#( 6  $[ V   # # 6 )8J KH# * LH# {M#fdN# @OH#expPH# D6Q# 6R# 06S# 6T#$ibUE#(obUE#, x VH#0 W#4E# U @}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 H#4 H#8 )#< O#@ O#A d#D <#L #P #T #Xt1tstru#lenv#Ep t  6] Cf A#b BE#f.( ?cb Cf# { D# EO#ev FO# Gv#  H#  I# J#$ v  |@kU&pFUbuf%ESmsg%r len%Vmax'%2C2 buf EObufOU EP:UbufDES 1DVmaxFi%2pCK0 k@UbjESposj endjstrjr!lWlenm $ UbESpos endWstrrlen!p AUbEVpos strrlen!WW 4.UchkV 9:Sfmtr"#=$retP% U0{Uo pbEW -Stol&[ &J  &. v & w 6' & Q & ;H(  : -y9>0y 07i "02-y&ikint60>Em?ERAE3CD^~7roS UH 0oBTGQqF uz !D !E# !F#+iu9 - /5 - @~# ! #  # b  # # # A# # z# #$ #( + #, M~#0 0#4 .~#8 O~#< #@ ">#D #p#F H$#G b(#H 1#L 7#T d8#X :~#\ "<#`5   ~  ~#  # B ~#G@3Vtm,w /x~# y~# rz~# z{~# >|~# R}~# 6~~# j~# ~# #$ /#([ >    a# #  R a# J # t #w2>40YG  3o  b # x a# # n # " x#7 b#   # # # bit~#u32"0 ?* +#key, # dnd#pd#? "  - ?#ref!d#  H0wq1#rq2# 3~#0 4~#4 50#8 6$#< 7#@ 8~#D ]4w x:# y?# z0# {0# '|0# r}0# 9:~0# @0# -0#$ u#( )8#J #K0# * #L0# {#M#fd#N~# @#O0#exp#P0# D6#Q# 6#R# 06#S# 6#T#$ib#U #(ob#U #, x #V0#0 #W#4 # #U @ }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H ~#8 ) #< 7#@  7#A W#D < #L #P   #T #X 1 1 tstr u#len v~#B B  H  p  z "?# L"?# "# !"#fe"!#be"!# "~# @"~#$ Z "0#( D"#,req" #0rep" #4si"##8 "# %"# "3#srv"-# p"-# Q "-# > "##txn"# "~# "!# "## y3"## # "w# "w# ,"k## "0#1    ] E Tn  a# !E #U k auid ^6#gid _ #  `+# bux aU ! Lfd M~# N~# h O~# $@ P# Q#  R~# $ S~#  T0#  U#  V?# * W# B X$# ' Y# ` Z# [0#  b # ) c#  T Q u m#  n~# S o~#  p~# qa# rV#  s~#$ 6 t#( !7 u#,  v#0  w#4 { x#8 @ y#< h z?#@ e {~#H  |?#L  ~~~~CfA#bB # y.(?cbCy# {D# E7#evF7# G# HV# I~# J#$l  J 9:~#get~#put~# u~# X# ~p7$@4lun5 in63 .p2u7#o'S C'O~# 'P~# h'Q~# 'R~#  ';uid'<~#gid'=~# '>~# $'?~# ,'@~#  'A~# !'B~# a'C~# 'D~# |'E~#$ 'F~#( <'G#, 'H#0 'I#4 +'I#8 J'J~#< 'J~#@ 'K~#D 'K~#H 'L~#L  'L~#P m 'M#T u 'M# 'S.# 'T # Y'U~# @)  D# # ~# P# ?#:* a ^# _%# k`%#aQ e+ ,# -# .~# //#   P d#  #@ e5&8len&90#cr&:0#&;0# b &Cv&D# 9:&Ew# &Fw# 2*&Gw# 4&Hw# & %!!!! ! !!!! ! D %¼c%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq% st%c }D% P %0#col%0#sov%0#eoh%0# sol%#eol%#som%0#  %~#sl%# %W#8cap%}#@ !% t4%# b%e# % #req%#rsp%#\uri%# %# %# FJ%~# @%0# X7G  &0# f 0# 0#g"- A I  J-# K~# * L~#  M~#  N~# O# B P# ( R!#  S~#  T~#$ 5 T~#( $ U0#, 6 U0#0 t V~#4 4 V~#8 ' W~#<  X?#@ ! Y#H $@ [3#L p \3#\ ^@ ^3#l  `~#| o a# b# @ d-#  d-#  e# o f3# w gw#  h~#  i~# ; i~# )$ j~# j~# R j~#  k~#  l~# F m~#id o#  p0# b p0# q0#  r0# u s0# ? t0# V t0# g u# v!# h w-#  yi# yi# j z0# {A#  }i#  }i#  ~i#  ~i#  i# . !# 0#  i# i#  i# Q i# U ~#g!(tD R  # # O # ~# h ~# r ~#  ~#  3# B $#,acl ?#0  ?#8  ?#@  ?#H > ?#P ? $#Xsrv -#d e ~#h ? ~#l h Κ%#p K # Z #  ~#  #  ~#  0#  ~# g ~# [ # ~# R ~#  #  ~#  ~#  # G # R ~# 7 ~# m. '#  # / ~#  ?# ' &#id # + #  ?# t ~# 4 ~#  ~#  0# i 0#  0#  0# !#  0# + !# 0#  i#  i# i# $ 0#  0# ` 0#  # z #  #  #  # ~# 8 #  ~# 0# j 0# A#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p 3# ^@ 3#  ~# o #  !# m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p !#  "#  #~# Z #~#  $&'# ] %&'#  &K#  'K# O (K# q ),'# ),'#  *~# w +#  ,~#  -<'# = .~#  /~#  00# 10# F 2V$# : 2V$#H3 !; $ $ ?# $!B #srv$"-# "D" "~# "L# "L# /"L# "# "#  "#$ u&"P#( } "P#, "P#0 "i#4 Q"i#<""px"Ǎ!#sv"-# "w# D"w# @"0# iid"~# J"~#sid"~## " ""j#k#"iid"~#px"ҍ!#buf"0#sid"0# ptr"~#bol"~##"("́""""##!#B ##B #J V$x ,  #t0 #t1 # }: !#  !#  ~# D ~#$  ~#($  L#len 0#pos 0# sid 0#srv -#oe !#src #buf #$ be !u % ! 0# . ?#J% srv J%# ~# ~#-u%X act ##bck ##,% act Ɛ#bck ǐ#&  ~# Q ~# ~#  ~#  ~#  ~# 8 ~# -#map %#  P%#, V u%# T ɕ&# 8 ʕ&# \: ˕&# / ̕&#  ͕&#&-&'  ~# 4 ~# : ~# < ~# A ~# + ~# \ ~# ! ~#m.'!  '<' L' #'>U$fmt=/%&?'tm@H(')'D)'P*'"+now!'+tm!' A#5(bSU$fmtR/%&T'tmUH('+)'D)'P#t(gU$outft(S$fmtf/ %&h,(v~U$levu/V-w~S.&&z%&z%,&)~5U$fac/V-~S.(&&%&%# +|@KU$p!V/~ /Y./S%-~@-~D-H&- +-j-~~-~P-a~-'+----~W-r~-ZS0*-0+P- ~R-S1*20+V22~P(;+m3L+.K'tm(')')'P+*+*+6+ 4X+~50+6S,E@P>U7s?B S8pnA8feB!V8beC!~9D!2E~W2E~~8errE~~2F~8tmG~:",')'~)'P1<,>I;__vj>.;__vi><[t(pid'Z~<& '_-/?"-8-/?,(-Z-/ ?1J-|-5?6- l-?7- l-+3"@0ny 07i "02-y&ik27int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz "D"E#"F#    b#  p  x### bit#u32"0'*+#key,#LnL#pL#'{" - '#ref!L#]4!w !x#!y'#!z0#  !{0#'!|0#r!}0#9:!~0#@!0# -!0#$u!#( * 02>40Y5G @|o bV#$[> ##  R#J#t#  wWڇ#K#n a#" W# g7 9 -r5 -@ #! # #b #  # #A # #z #  #$ #(+ #,M C#00 I#4. #8O #< #@ ">#D #p#FH $O#Gb (_#H 1#L 7#Td 8#X :#\" <e#` C  C# I#B # r _  u 3 H0wq1#rq2# 3#04#450#86#< 7#@8#Du)8 J K0#* L0#{ M#fd N# @ O0#exp P0#D6 Q#6 R#06 S# 6 T#$ib U; #(ob U; #,x V0#0 W#4 ; #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) 2 #< 7#@ 7#A W#D< #L #P  > #T D #Xj 1 tstr u#len v#{ { ;  2 p  z '#L '# #! #fe #be # # @ #$Z 0#(D #,req ; #0rep ; #4si #8 # % # #srv a#p a#Q a#> #txn # # # #y3 !## Â# Ă#, ؟ # 0#j  8 U ]~ Tn  #!~ # k auid^1#gid_#`&# buxa  !LfdM# N#hO#$@P#  Q #R#$S# T0#U #V'# *W #BX#'Y #`Z# [0#b #)c# TQum #n#So#p# q# r|# s#$ 6t #(!7u #,v#0w#4{x#8@y#<hz'#@e{#H|'#L       7 Cf A #b B; #.( ?cb C#{ D# E7#ev F7# G# H|# I#  J#$    J9:#get#put#u# #t) D###P# '#:!{ a^#_%#k`%#ae+,#-#.#/*# BP L#T#NNtB5%8len%90#cr%:0#%;0#b %Cv%D#9:%E#%F#2*%G#4%H# Z5$    D $$l$#m_l$#u$#u_l$# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$# $rq$@st$D$P $0#col$0#sov$0#eoh$0# sol$#eol$#som$0# $߉#sl$#  $W#8cap$#@U$t4$5#b$# $A #req$ #rsp$ #\uri$# $#$#FJ$#@$0#7G &0#f 0#0# 5 a AIJa# K#* L#M# N# O#B P#(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X'#@!Y#H$@[#Lp\#\^@^#l`#|oa# b#@da#da#e#o f#wg#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v#hwa#yi#yi#jz0# {<#}i#}i#~i#~i#i#.U# 0#i# i#i#Qi#U#(tDR # a#Oa# # h#r###BI"#,acl'#0'#8'#@'#H>'#P?g"#Xsrva#de #h? #lh ##pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉##G #R#7#m.$##/#'#'$#id#+#'#t#4 ##0#i0#0#0# U#0#+U# 0#i#i# i#$0#0#`0#a#za#a#a## #8##0#j0#  <# i# i# i# i#  i# i#) i#i#Qi## cap#p#^@##o##m 7!#u 7!#Jp#p#### # #g# #B #p !#"###Z##$$#]%$#&# '#O(#q)$# )$#*#w +#,#-$#= .#/# 00# 10#F2!#:2!#Hgx; ## '##!{ #srv#"a# D  # G# G# / G# # #  #$u& P#(} P#, P#0 i#4Q i#<,  px #sv a# ɂ#D ɂ# @ 0# iid ˉ#J ˉ#sid ˉ#C " R#  iid щ#px #buf 0#sid 0# ptr Չ#bol ։#  !( ̵! , ! C   {  !{  J7!p7!$@4un5U in6P!p2u7!#!x ,x#t0x#t1x#}:### D#$ #(I"G#len0#pos0# sid0#srva#oe#src#bufD #g"be!u" !0#.'#" srv"# # #a"XactP!#bckP!#,#actx#bckx###Q # ## ##8 # a#map"# "#,V"#T  $#8 $#\: $#/ $# $# $a#$ #4#:# <#  A#+#\#!#m.$! $ $ $A " %<T@U# SS$ %Sh%%$'%S\%4%&'% v'tu(@%])\@%*%0dU+t/S,-5P"&{pU#z V- |W.eb}@%S/%&%&0&P/&&% '$'%*'$='0O'P%['/t&h'%y'$'%'12'P$='0O'P%['/& %%%$'%%4%/&'%%'0'P$'b%'%'&&*_'t1^'t2^&'7@%) 637'67'4 53h'7'4V+4fG0&'C@%)B@%3'T7'4S7'5tU&'yk)j'nowj&'h'tg'fg0"F)BU# .tS.eb@%V-0W-‰p/(h':%y'$':%'1:2'P$='(70O'P%['/(F):@%W)$'%:@04%P/(a)%n)/)z)%)%)$& % '$' %*'$=' 0O'P%['&a)'t(z)>) &)'t1't26t*IPU7*Vj5__s8*909>9 75__ut*5__cw,05__s8Z*909>9 75__uz*5__cw),*:[*g:J *:. v*7: w *; :&Q*:';0#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# @O%# expP%#D6Q4#6R4#06S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U@ }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    -h;Utv1,Qtv2,Shtv1tv2`p`@Utv`S- mshQ$6hUtv15Qtv25R#htv1tv2-Ah`Utv1@Vtv2@W- ?KX*htv1)tv2)(K:`Utv1JVtv2JSl{  H!" '[:tv1Ztv2Z/ J:tv1Itv2I"retK: U:Utv1TWtv2TS   #!"  a: ZUtv1`Stv2`R+G  h$" Pb i``Utvh`V-hRinchPb nt    w`tvv`%-vincv YrhUtvq`S-qVincqQ    - Xhtv`%-inc {`TUtv1zRtv2zPtvz`V     `tv1tv2tv`U L``Utv1Stv2Rtv`QA U mg s   u      K`tv1tv2tv` {o`tvn` hUtv1Qtv2R    htv1tv2k h@Utv1Qtv2Rk '|   htv1tv2&u@UghSh 'A'p'h(()b bt   Euauhtv1tv2x`tvx`6UthSaQ)rv)p͓p)cnthl ' *[4F*J 4*.vT*wh x+ * Qg,%: ,%: ,%: -now: ,: ,:   -! 0y 07i 2-y &^kint3 C DS7rH  09 -a5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Os#<z#@">#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`g   #  # B s#s  l  3[ >   # # + 2>)8 J K0# * L0# { M#fd Ns# @ O0#exp P0# D6 Q# 6 R# 06 S# 6 T#$ib Ue#(ob Ue#, x V0#0  W#46e#  U @ }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H s#8 ) #< 7#@  7#A L#D < #L #P  #T #X||ep k  ]ssCfA#bBe#].(?cbC]# {D# E7#evF7# Gm# H# Is# J#$ m  J 9:s#gets#puts# us# "#sC<_ ``# Aa#setb#clrc# NBd# Ae#remf#clog# 6h# }:i #$ OCj#( _%k #, Hl #0 uma#4 ns#8ss ss s 1+ql& Ufd%sWq3?~QSJ/`.#.s;4:U3ap5sV &8% 8%! xAs@UpBsQbpCV"D vZU#bp\p]sV$ lsUoutk pmsS%2*nsh%nsW%8ospbppl&s!U'[ 'J  ( `= (bs   (} ; (.= (sX= ( s: ( s:  ) 'Qy k -6000y7i  "%2-kint 6% >:m ?:R A:h7r % oBTGQz $  n $# p $# ]4w x# y# z%# {%# '|%# r}%# 9:~%# @%# -%#$ u#(  23 4%YG  o  b#[3 T   # T#d  R # Jo# t#w   # # n # " #, )Tn  # !)#9k ap7 $@4+un5in6 zp2 u79# b#z ### bith#u32"% 1* +# key,#  H0 wq1# rq2# 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _#  `#  bux a ! L fd Mh# Nh# h Oh# $@ Pd# Q#  Rh# $ Sh#  T%#  U#  V# * W# B X# ' Y$# ` Z# [%#  b# ) c#  T Q u m*#  nh# S oh#  ph# q # r#  sh#$ 6 t#( !7 u#,  vJ#0  wJ#4 { xJ#8 @ yJ#< h z#@ e {h#H  |#Lhhh:Jh:S COh# Ph# hQh# Rh#  ; uidh# $?h# ,@h#  Ah# !Bh# aCh# Dh# |Eh#$ Fh#( <G#, H#0 I#4 +I#8 JJh#< Jh#@ Kh#D Kh#H Lh#L  Lh#P m Ma#T u Ma# SP# T# YUh# T   h# <!h# "h# #T #   &T 0Uret'T (p__p5S IFUpHT S VPUpUT R dU !" X#2 *#T #h#h A' 30Ly 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz !D!E#!F#|  a^#_%#k`%#axe jh#]i#Aj?e+,?#-E#.#/v# K 2>40YPG [o bq#$[> ##  R#J#t# - wrڢ#f#n |#" r# 7 9 - 5 - @# ! #  # b  # # # A# # z# #$ #( + #, Md#0 0j#4 .#8 O#< #@ ">#D #p#F H$p#G b(#H 1#L 7#T d8#X :#\ "<#`d d# j#B #-  &  3 b#    # # # bit#u32"0M*+#key,#r n r#p r#M" - M#ref !r# H0wq1$#rq2$# 3#04#450#862#< 7#@8#D,,,]4 w x # yM# z0#  {0#' |0#r }0#9: ~0#@ 0# - 0#$u #(  )8 J K0#* L0#{ M#fd N# @ O0#exp P0#D6 Q#6 R#06 S# 6 T#$ib U #(ob U #,x V0#0 W#4 #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8)  #< 7#@ 7#A W#D< #L #P   #T  #X? 1 tstr u#len v#P P  V  p  z M#L M# ,#! #fe =#be =# # @ #$Z 0#(D #,req  #0rep  #4si E!#8 # % # -#srv #p #Q #> U!#txn 3# # # g!#y3 ~!## w# w#, !# 0#?   * ]S Tn  #!S # c k auid^1#gid_#`&# buxac  !LfdM# N#hO#$@P#  Q#R#$S# T0#U#VM# *W#BX2#'Yp#`Z# [0#b #)c# TQum#n#So#p# q# r# s#$ 6t#(!7u#,v#0w#4{x#8@y#<hzM#@e{#H|M#L      Cf A#b B #.( ?cb C#{ D# E7#ev F7# G# H# I#  J#$    J9:#get#put#u# #p7$@4un5* in6-1p2u7#) D###P# M#:18P r##5$8len$90#cr$:0#$;0#fb $Cv$Df#9:$Ew#$Fw#2*$Gw#4$Hw# #           D #l #l##m_l##u##u_l## v##v_l## j#l##v_l##c##c_l## r##r_l###rq#st#-D#P #0#col#0#sov#0#eoh#0# sol##eol##som#0# #߉#sl#j#  #W#8cap#-#@#t4##b## # #req##rsp##\uri## ####FJ##@#0#7G &0#f 0#0# P! AIJ# K#* L#M# N# O#B P#(R=#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<XM#@!Y,#H$@[-#Lp\-#\^@^-#l`#|oa# b#@d#d#e#o f-#wgw#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu$# vC#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#=(tDR# |#O|# # h#r##-#B"#,aclM#0M#8M#@M#H>M#P?"#Xsrv#de #h? #lh J##pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉#ޕ#G #R#7#m.$##/#M#'K$#id#+#M#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#|#z|# |# |# # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p-# ^@-# # o# =# m # u # Jp# p# # # #  # # g#  # B # p !?# "?# ## Z## $$# ]%$# &# '# O(# q)$# )$# *# w +# ,# -$# = .# /# 00# 10# F2"# :2"#H; "" M#"!P #srv""# 1 D  # G# G# / G# # #  #$u& P#(} P#, P#0 i#4Q i#<  px =#sv # w#D w# @ 0# iid ˉ#J ˉ#sid ˉ# " x# ! iid щ#px =#buf 0#sid 0# ptr Չ#bol ։#E! ( 1  Ϩ  ׿ U! Ig!P [!~!P m!J"x ,#t0#t1#}:C#C## D#$ #("G#len0#pos0# sid0#srv#oe=#src#buf #"be=u " !0#.M# " srv"# # # %#Xact‹!#bckË!#, J#actƞ#bckǞ# 9$#Q # ## ##8 # #map"# ##,V%##T E$#8E$#\:E$#/E$#E$#E$9$ $ #4#:# <#  A#+#\#!#m.$! $ $ $ "%U#dstW#src #strvV$%%p&%P'len#S'num#P(%X/7Q%</7P&%\f)*2()*3% "&cEv-U#strDvS'errFvV"&0fv0U$bd&S$dER$eR$evV*expg?+?O'errjvP?,1K&& >,L&& ~,M& & -&= ,[&,J &,. v', w 7'. ,%Q&'oP80|y 07i  "0{ #[2! %m-y &k 5int 60 =b >Em ?E! @PR AE BE3 C Dt7ro S U l5 qH  09 *-s5 *-@+#!+ #+ #b + #  +#+#A+# +#z+# +#$+#(+ +#,M+`#00+f#4.+#8O+#<+#@+">#D +##FH+$l#Gb+(|#H+1P#L+7f#Td+8f#X+:#\"+<#`  7 f +` + +`#  +f# B +#)s | "  3oBTGQqF$z $D $E$# $F/#2>40YG .o  b#$[[ >m  9# m# }   R9# J# t#  w  9# # n # "  # 7 rr \s# Lt# u# v# w#D% %3 %4# X%5# %6# %7# O %8# %9# !%:#,', !'-# " '.# !'/# '0# Q:!X)% !!)&# )'># !))# )-# G).# )/# t)0# !)1# d)2>#( -)4#, M)8:#0 H!);E#4 !)?$#8 !)@[#< )A$#@ ")B[#D )C$#H P)D[#L ")F[#P Z)G[#Tt bt#  Q Y### bit#u32 "0 *  +#key ,#- n -#p -#\"  - #ref !-# H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7f#@  8#D\ ]4"w "x# "y# "z0# "{0# '"|0# r"}0# 9:"~0# @"0# -"0#$ u" #(   j )8-J -K0# * -L0# {-Mf#fd-N# @-O0#exp-P0# D6-Q| # 6-R| # 06-S| # 6-T| #$ib-U #(ob-U #, x -V0#0 -Wf#4v v  j  # -U @#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 #0#4 H##8 )# #< #7#@ #7#A #m#D <#v #L #v #P # #T # #X  1#tstr#u#len#v#     p #z .# L.# .# !.^#fe.J!#be.J!# .# @.#$ Z .0#( D.#,req. #0rep. #4si.R##8 .}# %.}# .#srv.# p.# Q .# > .b##txn.@# .# .!# .t## y3.‹## # .Í# .č# ,.(## .0#   ]Tn  9# !#  kQ auid^#gid_# `#d buxak!LfdM# N# hO# $@P}# QX# R# $S# T0# U^# V# *Wt# BX# 'Yz# `Zf# [0# bQ# )c#X TQ um# n# So# p# q9# r.# s#$ 6tt#( !7ut#, v#0 w#4 {x#8 @y#< hz#@ e{#H |#Lkdtd  XCfAt#bB #B.(?cbCB# {Df# E7#evF7# Gr# H.# I# J#$ R  J 9:#get#put# u# #R )  D# # # [# #:G a ^f# _%# k`%#ae+ ,# -# .# /# R GP -# #(518len190#cr1:0#1;0#yb 1Cv1Dy# 9:1E# 1F# 2*1G# 41H# 0    D 0&0l0#m_l0#u0#u_l0# v0#v_l0#}0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st0&@D0 P 00#col00#sov00#eoh00# sol0#eol0#som00#  0ߟ#sl0}# 0m#8cap0#@0 t40# b0(# 0 #req0#rsp0#\uri0# 0# 0# FJ0# @00#7G  &0# f 0# 0# $  AI J# K# * L# M# N# O# B P# (RJ!# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X#@ !Y#H $@[#L p\#\ ^@^#l `#| oa# b# @d# d# e# o f# wg# h# i# ;i# )$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# vP!# hw# y# y# jz0# {# }# }# ~# ~# # .# 0# # # # Q# U#$J!(tDR ^# # O# # h# r# # # B%#,acl#0 #8 #@ #H >#P ?%#Xsrv#d e #h ? #l h V&#p K# Z # ҟ# # ԟ# 0# ֟# gן# [# ٟ# R ڟ# # ܟ# ݟ# ި# G # R# 7# m.i(# # /# # 'W'#id# +# # t# 4 # # 0# i0# 0# 0# # 0# +# 0# # # # $0# 0# `0# # z#### #8##0#j0#  # # # # #  # #) ##Q##cap#p#^@##o#J!#m ~$#u ~$#J##### # #g# #B #p !#"###Z##$(#]%(#&# '#O(#q)(# )(#*#w +#,#-(#= .#/# 00# 10#F2%#:2%#HY!; / / # /! #srv/"# >"D. .# .# .# /.# .# .#  .#$ u&.[#( } .[#, .[#0 .#4 Q.#<".px.J!#sv.# .ɍ# D.ɍ# @.0# iid.˟# J.˟#sid.˟#" . ".3#(#.iid.џ#px.J!#buf.0#sid.0# ptr.՟#bol.֟#R#.!(.>"!.ϵ"!." b# V!t# h## v z#GJ"#acl(*(+#u(,#2D(-#  (.#(/0##V$XD(>(?#g(@#pol(A#(B0#.(C#~$p7!$@4Dun5 in6$p2u7V$#%x , Y#t0Y#t1Y# }:P!# P!# # D#$ #(% #len0#pos0# sid0#srv#oeJ!#src}#buf #%beJ!!u%  !0# .#& srv&# # #1&Xact—$#bck×$#,V&actY#bckY#E' # Q # # # # # 8 # #map%#  &#, V1&# T Q'# 8Q'# \:Q'# /Q'# Q'#Q'E''  # 4# :# <# A# +# \# !#i(m.( 7(# &)# *# +# ++# 7,# @-# -.*# /*+# 0i(#$'(! $ !(# u!# Z!#len! # \!!# F!"#o( (  ( #);$9J!$u:S)@56#E7S)#be;(# #): >?#E@S)#*x(CD#EES)#JF# G#%H#I#@J0#K# L#$P* &$ &%#kw&&# &-y*#y*J!J!P** &5 &6#kw&7*# ** *   *# # #**+  *+# # G#*q+4S C4O# 4P# h4Q# 4R# , 4;uid4<#gid4=# 4># $4?# ,4@#  4A# !4B# a4C# 4D# |4E#$ 4F#( <4G#, 4H#0 4I#4 +4I#8 J4J#< 4J#@ 4K#D 4K#H 4L#L  4L#P m 4M~$#T u 4M~$# 4S0+# 4Td# Y4U#4-!U uV#valW0#capX0# 'Y0# %. ^U&str~'4^V(l^P(cP)~)`S)%~)#S(endW*> <+.(ss}~,.-D-__sf.4../ /0//*//6//B/.h../ /0//*//6//B/.../ /0//*//6//B/,.(__v>P15;(__v>P+.-__sf2(heO/P3/n4m3O/ -4+4x+4,5/ 6U6(J!V7capQ66.7arg68msg S0///903:(2J!5`0X  @qU6(J!P6 6.7arg50 -U6(,J!P6, 6.,7arg,51 :U6(9J!P69 6.97arg95h1"G1U6(FJ!P6F 6.F7argF51T@qU6(SJ!P6S 6.S7argS52_U6(^J!6^W6.^V7arg^S5l2H"hhU6(gJ!6gW6.gV7arggS52ppU6(oJ!6oW6.oV7argoS5p:w U661! 6?7inv;~: U+:p?__sf0:/:@:{9:(8J!5fiU661! 6?7inv;bJ!(;!S8errP8rc}8val 0~;!~\i=&n%=n%,E>q~=&%=%,k>=&%=%,>=&%=%1=;P+> ;@J!R0./ /0//*//6//B/,G?=&%=%1=;P,m?=&%=%+?H8iV8lenS8dS,?p}=&%=%,?=&%=%,@=&%=%,5@)6=&%=%++A`;}8set0}+t@8uP,@=&%=%1=;P,A=&%=%1=;P1=&%=%,uA]=&%=%1]=;P,AS`=&%=%,Ahu=&l%=l%+B;mS. Bf/f0//*//6//B/,2B%=&%=%,XB{=&%=%,~B=&%=%1=&%=%,B6C=&%;%Q,BKX=& %= %,C`m=&%=%+C8polQ;ES)Q,C=& %= %1= ; P1=&"%="%,C=&6%=6%+D8pol7};E8S)V;J9fS;:S;J;};<};!=}; >};!?};@@0}1%8=&J%=J%.D./ /0//*//6//B/,D !=&%=%,E!!=&%=%,E!#8polS;ES)V=Jf,E!"E"=&%=%1!"E"=;P,EN"i"=&%=%288acl#P;uR,F##=&%=%,F#%8polQ;ES)S=Jf,F5$S$=&%=%15$S$=;P,F\$n$=&%=%2P8acl1#P;u2R,F%%=&@%=@%,G%%=&%=%+Gh=,PG%%=&%=%,vG &8&=&%=%,GX&e&=&%=%1m&z&=&%=%,G&&=&%=%.H.R'd'/ /0/R'd'/*//6//B/,?H3(@(=&%=%,eHH(X(=&%=%+H?hdr(,H{((=&%=%1{((;R;P0.!)$)/ /0/!)$)/*//6//B/,I))=&%=%,CI))=&%=%+I?hdr(,I)!*=&%=%1)!*;R;P0.**/ /0/**/*//6//B/+J;}13,B,=&%=%,7Ji-x-=&%=%,]J--=&"%="%,J. .=&%%=%%,JE.X.=&V%=V%,J..=&b%=b%,J/#/=&%=%,K+/8/=&%=%,AK>=&> %=> %,P>?8sk? :Q,Q??=&V %=V %,@Q@@=&a %=a %+Q;b }; c P; d W;R!e };!f }8skg :V,Q@A=&A %=A %1@A=A ;A P+R;B ~$~;C S,:RA+A=&E %=E %1hAC;P V;P W+vR8sku :R28skk :R,RCC=& %= %,RCC=& %= %,RCC=& %= %,#SCD=& %= %+;S ; #S.oS.7ECE/ /0/7ECE/*//6//B/,SEE8__v >P,S+FIF=& %= %1+FIF= ; P+T8 ;@ P0.gFxF/ /0/gFxF/*//6//B/,9TSGWG8__v >P+yTX 8l' ^P2p ;#* P1GG?__v- >,TGG?__v, >,THH=& %= %,THH=& %= %,UHH=& %= %.9U.II/ /0/II/*//6//B/,_UII=& %= %,UII=& %= %,UIJ=& %= %,UJ#J=&+ %=+ %,U+J>J=&< %=< %,VFJYJ=&F %=F %,CVaJtJ=&J %=J %,iV~KK=&N %=N %,VKK=&Z %=Z %,VKK=&^ %=^ %,VKK=&b %=b %,WKK=&f %=f %,'WLL=&x %=x %.[W.JLfL/ /0/JLfL/*//6//B/+sW 8err P+W 8sk= :R,W M3M=& %= %+W 8errh P,WMM=& %= %,XMN=& %= %+X ; ~; ~8sk :R+X 8i Q0fNNA gV2( Bg,X OO=& %= %1BONO=& %= %.X.OO/ /0/OO/*//6//B/+YH 8err, P+-Y` 8err P.aY.P Q/ /0/P Q/*//6//B/.Y.SS/ /0/SS/*//6//B/.Y.UTWT/ /0/UTWT/*//6//B/.Y.TT/ /0/TT/*//6//B/,GZU V=&%=%1U V=;P,mZV(V=&%=%,ZVV=&%=%,ZVV=& %= %,ZVV=&+%=+%,[VV=&6%=6%,+[VW=&O%=O%,Q[ WW=&%=%+[x ;}+[ ='%;P1WW=&%=%+\ ;P}+[ ='Y%;YP1XX=&_%=_%,7\YY=&%=%,]\ZZ=&j%=j%,\b\\='?%;?P+\ ;,  S+\ ;, V,\^^='%;P,]__=&B%=B%,)]__=&B%=B%+A] ;, CV,i]Y`{`='J%;JP,]aa=&+ %=+ %+]0 ;, #S,]ob|b=&E %=E %+]P ;F #S, ^_clc=&_ %=_ %+#^p ;` #S,I^Od\d=&y %=y %+a^ ;z #S,^?eLe=& %= %+^ ; #S,^/fEn=-ret?3Lg9!f4!e46"eLg,5iC p2U6;?!io8f im;1! m;k m; m+Ki 8argS8invm8endW;?im;.V,hh`=&%=%1`=;P,hō֍=&%=%,h=&%=%,h#8=&%;%S,i<I=&%=%,(iMZ=&%=%1^n=&%=%+ei ;9 0m,i$5=&%=%12;XC7Q;<C7P,i=*D1=*E ih j @Fl@gU;p p;bJ!l;!W;hI,Lmm I,MmI.vmIw mJ I2QmI  K(OJ!KPLLL I3;0Mnow3<I 4Xq+Ih4]I4^  sn I 5n cnI,5I5I 6Q0I6R0I 6U0I 6VI6Wn n ~Lp!;o n oo  ,)]3o o Hoo )yYo@ 8o)$)(!@)c!*Pl%b!XB0t"y 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0o BT G QqFez DE#F#k 2L40 YpG {o  b #$[L ##  =R#J#t=# M w  # ۆ#n ܜ#" # E 9 -@5 - @># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 O>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#`  # #B >#M  F  3   b #  9    #  #  # bit >#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H 0wq 1D#rq 2D# 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#9:~0#@0# -0#$u#(  )8J K0#* L0#{M#fdN># @O0#expP0#D6Q#6R#06S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U@}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P 3 #T9 #X_ 1tstru#lenv>#p p 0 v ' p z m#L m# L#! #fe #be # ># @ >#$Z 0#(D #,req 0 #0rep 0 #4si #8 # % # M#srv V#p V#Q V#> #txn # ># # #y3 ## Å# ą#, ؔ # 0#_  - J ]s Tn  #!s # k auid^&#gid_#`# buxa  !LfdM># N>#hO>#$@P#  Q #R>#$S># T0#U #Vm# *W #BXR#'Y #`Z# [0#b #)c# TQum #n>#So>#p># q# r# s>#$ 6t #(!7u #,v#0w#4{x#8@y#<hzm#@e{>#H|m#L   >> > >  ,CfA #bB0 #.(?cbC#{D# EE#evFE# G#H#I>#  J#$    J9:>#get>#put>#u># #i) D##>#^# m#:X a^#_%#k`%#aze+,#-#.>#/e#   7P #I#CCi75#8len#90#cr#:0##;0#b #Cv#D#9:#E##F#2*#G#4#H# O*"    D ""l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"5st"D"P "0#col"0#sov"0#eoh"0# sol"#eol"#som"0# ">#sl"#  "e#8cap"#@J"t4"*#b"# "6 #req"#rsp"#\uri"# "#"#FJ">#@"0#7G &0#f 0#0# p V AIJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xm#@!YL#H$@[M#Lp\M#\^@^M#l`>#|oa# b#@dV#dV#e#o fM#wg#h>#i>#;i>#)$j># j>#Rj>#k>#l>#Fm>#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#M#B>"#,aclm#0m#8m#@m#H>m#P?\"#XsrvV#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#m.$##/>#m#'$#id#+#m#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pM# ^@M# ># o# # m ,!# u ,!# J~# ~# ># ># >#  ># ># g>#  ># B ># p !# "# #># Z#># $$# ]%$# &t# 't# O(t# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H\; !! m#!!p #srv!"V# D  ># <# <# / <# 7# 7#  7#$u& ^#(} ^#, ^#0 w#4Q w#<!  px Ƕ#sv V# Ʌ#D Ʌ# @ 0# iid >#J >#sid >#8 " Θ#  iid >#px Ҷ#buf 0#sid 0# ptr >#bol >#  !( ̪! ! ! 8   p   p  J,!p7!$@4un5J in6ME!p2u7!#!x ,#t0#t1#}:##># D>#$ >#(>"<#len0#pos0# sid0#srvV#oe#src#buf9 #\"be!u" !0#.m#" srv"# ># >#V"XactE!#bckE!#,#actƾ#bckǾ##>#Q ># >#># >#>#8 ># V#map"# ĺ"#,V"#T ##8##\:##/#####V#~$ >#4>#:># <>#  A>#+>#\>#!>#m.~$! $ $ $6 "$g">U#sVQ"%">BU#sVR$[%$J %$.v1%,$w> U%% $$QD%&now%<<4E#q]P0E$y "07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez %D%E#%F#9 *-p5 *- @+~# !+ # + # b + # +# +# A+# +# z+# +#$ +#( + +#, M+R#0 0+X#4 .+~#8 O+~#< +#@ +">#D +#p#F H+$^#G b+(n#H +1#L +7#T d+8#X +:~#\ "+<t#`   +R ++R# +X#B +~#p n   3[ >   # #    R #J #t #  wFy 6  7~# w 8~#2>40YFG Qo bg#ڏ#\#n r#" # 7  b#  e  # # # bit~#u32"0*+#key,e#n#p#" - #ref!#h H0wq1p#rq2p# 3~#04~#450#86~#< 7#@8~#Dxxxh]4#w #x##y##z0#  #{0#'#|0#r#}0#9:#~0#@#0# -#0#$u##( - )8'J 'K0#* 'L0#{'M#fd'N~# @'O0#exp'P0#D6'Q #6'R #06'S # 6'T #$ib'U\ #(ob'U\ #,x 'V0#0'W#4-\ # 'U@$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#,$0#0 $0#4H$~#8)$S #< $7#@$7#A$W#D<$#L $#P $_ #T$e #X 1$tstr$u#len$v~#  \  S p $z&#L&# &x#!& #fe&#be&#&~# @&~#$Z &0#(D&#,req&\ #0rep&\ #4si&'#8 &# %&#&#srv&v"#p&v"#Q &v"#> &'#txn&# &~#&%#&'#y3&'## &w#&w#,&؎'#&0#  Y v ] Tn  #! # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#$@ P#  Q # R~#$ S~#  T0# U # V# * W#B X~#' Y #` Z# [0# b #) c# T Qu m# n~#S o~# p~# q# r#  s~#$ 6 t#(!7 u#, v1#0 w1#4{ x1#8@ y1#<h z#@e {~#H |#L  ~~ ~ ! 1~ !XCfA#bB\ #.(?cbC#{D# E7#evF7# G#H#I~#  J<#$ 7 < J9:~#get~#put~#u~# j#!C<_``#Aa;#setb;#clrc;# NBd;#Ae;#remfM#clogM#6hj# }:i#$OCj#(_%k#,Hl#0um#4n~#86~6~ ~!M6Add~BS~dpdp7$@4un5v in6p2u7#.SC.O~#.P~#h.Q~# .R~#  .;uid.<~#gid.=~#.>~#$.?~# ,.@~# .A~#!.B~#a.C~#.D~# |.E~#$ .F~#(<.G#,.H#0.I#4+.I#8J.J~#<.J~#@.K~#D.K~#H.L~#L .L~#Pm .M#Tu .M#.S# .T #Y.U~#5)8len)90#cr):0#);0#(b )Cv)D(#9:)Ew#)Fw#2*)Gw#4)Hw# s(           D (.(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#,(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#I(rq(~st(D(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (~#sl(,#  (W#8cap(#@(t4(s#b(# (b #req(I#rsp(I#\uri(# (#(#FJ(~#@(0#) D##~#P# #:* !a!^#!_%#k!`%#!aze + ,z# -# .~# /# 5 *P ##J3(tD # r#O r# ~# h ~#r ~# ~# #B {##,acl #0 #8 #@ #H> #P? ##Xsrv v"#de ~#h? ~#lh A$#pK #Z # ~# # ~# 0# ~#g ~#[ # ~#R ~# # ~# ~# ދ#G #R ~#7 ~#m. %# #/ ~# #' B%#id #+ # #t ~#4 ~# ~# 0#i 0# 0# 0# 3# 0#+ 3# 0# i# i# i#$ 0# 0#` 0# r#z r#  r#  r#  # ~# 8 #  ~# 0# j 0# 1#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p # ^@ #  ~# o #  # m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p !z#  "z#  #~# Z #~#  $%# ] %%#  &#  '# O (# q )%# )%#  *~# w +#  ,~#  -%# = .~#  /~#  00# 10# F 2"# : 2"#Hj7G &0#f 0#0# yF!;  #! #srv"v"# v" A"Jv"# K~#* L~#M~# N~# O#B P#(R#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Yx#H$@[#Lp\#\^@^#l`~#|oa# b<#@dv"#dv"#e#o f#wgw#h~#i~#;i~#)$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gup# v|"#hwv"#yi#yi#jz0# {1#}i#}i#~i#~i#i#.3# 0#i# i#i#Qi#U~#"x ,  #t0 #t1 #}: |"# |"# ~# D ~#$  ~#({#  <#len 0#pos 0# sid 0#srv v"#oe #src #buf e ## be u # ! 0#. ## srv ## ~# ~#v"$X act ‚"#bck Â"#,A$ act #bck #0%  ~#Q ~# ~# ~#  ~# ~#8 ~# v"#map ##  ##,V $#T <%#8 <%#\: <%#/ <%# <%#<%v"0%%  ~#4 ~#: ~# < ~#  A ~#+ ~#\ ~#! ~#m.%! % % %b &D& &~#&<# &<# /&<#&#&#  &#$u&&P#(} &P#,&P#0&i#4Q&i#<'&px&#sv&v"#&w#D&w# @&0# iid&~#J&~#sid&~#2' &"&#'&iid&~#px&#buf&0#sid&0# ptr&~#bol&~#'&(&̤&&'&2' '- y' '' '"D(<#2PU#be1S$0(D(kq%U(&D(%U('a(3((2)($>~LU#s=v"P*pc?'R+"?'V+#?'W+a#@~p,+C S&(-(S%)' )hx.tgx.fg0))#[~PݠU#sZv"V+a#\~W, /b 0pc'$p))p-)P&(-(S%)')"#;'.px;)) "*$vU#suv"V*srvwv"S*msgxb h+a#y~d,8+#|~`+"}~S"i*"U#sv"V*srvv"S*msgb h+a#~W"*i#<U#sv"S*srvv"S*msgb h+a#~W1+# @mU2s v"S3srv"v"S3msg#b h4a#$~W5,5$~p U2fd~W6#6#ʧ63#6"a3txV3sv"S$+(ʧ%(%)7+P3ret~P4w Q4~8)9X#~8&:__v0$6,,n%,-,,x;,P;,P;,;,7e,3sa8:__v>&-W_%-%-&)-W_-:-P%E-<,"I~=sHv"># H9#J~9/$K~9?L~9"M, - ')-^$W~.nowV~('V~'Q-}#L~.nowK~('K~5- #~@U2fd~6#Aɬ3len~R3txh3sv"d&(%(%)?1"Px@U2tOx4#Q~3sRv"W3saSX3fdT~V3rvU~V6{$Y$`.1-1P-1R$|.1ٮ%1%1$.1e-1Q-2$.1%1-1P$.)--:-P%E-$.)-~-:-S-E-P$/1;W%1-1P$6/)-We-:-P%E-$T/1ɲݲ%1-1V7/9R$(~$/)-ݲ-:-S%E-$/)--:-P%E-& 2&%2%(2@/:__v>704m$323ret~4@~8L4#~3srcH$c092c%J28i;U2@0ʹѴ3__v>P&1L-1Q-2704m$32S3ret~P4@~&D(-U(P$1a2$'%n2$!1)--:-P-E-P@q1ҷ9R$~$X1)-ҷ-:-S%E-& 2%2%(2$1D(-U(P$118L%1%1&)-L[-:-P%E-'1yk~(j~.nowj~A 2J/(`.<(#.~'32M#u~.t1t~.t2t~'a2#~(`<0ret~Ay2"T.fdS~B_3#~U3pxp3sv"S:tx4X$~l4&$~h4t$~d$+3_3|Cp3,Cp373(;z3V&3%3$K3)--:-W-E-P&3#?%3'3"x0txD0__p'37x.txA3>( xE[*3eEJ *3E qBE.v3XEw~ 4F E,Q4E-;0Gnow-<<E-=<E .XE.^e Gone.`6E.a4 H( OE Q0ER0E U0E VEW4p('gɾ 0$y 07inti  "02-y &wk 60 >Sm ?SR AS3 C7 Dl7ro S7 U7H  0oBTGQqFez DE#F#  n # p #e" - e# ref !#R]4w xR#ye#z0#  {0#'|0#r}0#9:~0#@0# -0#$uX#( h n 2L40YsG ~o b#$[ L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 %-C5 %- @&># !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&#0 0&#4 .&>#8 O&>#< &#@ &"L#D &#~#F H&$#G b&(#H &1#L &7#T d&8#X &:>#\ "&<#`& &&# &#B &>#J  C  3 b#  6  # # # bit>#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8"J "K0#* "L0#{"M# fd"N># @"O0# exp"P0#D6"Q#6"R#06"S# 6"T#$ ib"U0 #( ob"U0 #,x "V0#0"W#40 # "U@}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P 3 #T9 #X_ 1t stru# lenv>#p p 0 v ' p z!e#L!e# !#!! # fe!# be!#!># @!>#$Z !0#(D!#, req!0 #0 rep!0 #4 si! #8 ! # %! #!P# srv!V#p!V#Q !V#> ! # txn!# !>#!#! #y3! ## !Å#!ą#,!ؔ #!0#_  - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#$@P #  Q #R>#$S># T0#U #Ve# *W #BX#'Y #`Z# [0#b #)c# TQum #n>#So>#p># q# r# s>#$ 6t #(!7u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    J9:># get># put>#u># #i) D##>#^# e#: a^#_%#k`%#aze+,#-#.>#/h#   7P #I#CCi75$8len$90#cr$:0#$;0#b $C v$D#9:$E#$F#2*$G#4$H# O*#    D ## l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#5st#D#P #0# col#0# sov#0# eoh#0# sol## eol## som#0# #># sl##  #e#8 cap##@J#t4#*#b## #6 # req## rsp##\ uri## ####FJ#>#@#0#7G &0#f 0#0# s V AIJV# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H$@[P#Lp\P#\^@^P#l`>#|oa# b#@dV#dV#e#o fP#wg#h>#i>#;i>#)$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B>"#, acle#0e#8e#@e#H>e#P?\"#X srvV#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#m.$##/>#e#'$# id#+#e#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pP# ^@P# ># o# # m ,!# u ,!# J~# ~# ># ># >#  ># ># g>#  ># B ># p !# "# #># Z#># $$# ]%$# &t# 't# O(t# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H\;   e# !p # srv "V# D! !>#!<# !<# /!<#!7#!7#  !7#$u&!^#(} !^#,!^#0!w#4Q!w#<! ! px!Ƕ# sv!V#!Ʌ#D!Ʌ# @!0# iid!>#J!># sid!>#8 !"!ΐ# ! iid!># px!Ҷ# buf!0# sid!0# ptr!># bol!># !!(!̪!!! !!8   p   p  J,!p7!$@4un5J in6PE!p2 u7!#!x ,# t0# t1#}:##># D>#$ >#(>"<# len0# pos0# sid0# srvV# oe# src # buf9 #\"be!u" !0#.e#"  srv"# ># >#V"X actE!# bckE!#,# actƻ# bckǻ##>#Q ># >#># >#>#8 ># V# map"# ĺ"#,V"#T ##8##\:##/#####V#~$ >#4>#:># <>#  A>#+>#\>#!>#m.~$! $ $ $6 "$$'0 U#s&$S$max(0V%f&/$60% '$>U(X%$mU#p Q%&\" &$bp pU#srvaVV#pxaW$psc Q)ppc *dp S*4(eVP+% &,&+%$&,5&-K&¼.\&p.g&l/$&$1 0s1$/@&"#; 0px;@&F& \/s&>0tv1s&0tv2s&y& <(&$CU#sBVV$pDp*$E>W%*Mp P-&ý.&S,'/'h0tg0fg0"T'$ ɾU1p S)p 2@$__pQ3[%a'3J %a'3.v',3w> '4 3'Q'5now<<65 t= 3 Q03R03 U03 Vt3W(A7)\mо0j%y #07i "02-y&ikint60>Em?ERAE3CD^7roS UH 0oBTGQqFez %D%E#%F#9 +-p5 +- @,~# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,j#0 0,p#4 .,~#8 O,~#< ,#@ ,">#D ,#p#F H,$v#G b,(#H ,1#L ,7#T d,8#X ,:~#\ ",<#`    ,  ,j ,,j# ,p#B ,~#3p,3$[> ## "R#J#t"#2w^y6 7~# w8~#2>40Y^G io b#ڧ#t#n ܊#" #7 b#--}  # -# -# bit~#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5]4$w $x#$y#$z0#  ${0#'$|0#r$}0#9:$~0#@$0# -$0#$u$5#(E )8&J &K0#* &L0#{&M#fd&N~# @&O0#exp&P0#D6&Q%#6&R%#06&S%# 6&T%#$ib&Ut #(ob&Ut #,x &V0#0&W#4  Et # &U@ }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H ~#8) k #< 7#@ 7#A W#D< #L #P  w #T } #X+ 1 tstr u#len v~#  t  k p  z #L # #! #fe P"#be P"# ~# @ ~#$Z 0#(D #,req t #0rep t #4si X$#8 # % # #srv #p #Q #> h$#txn }# ~# "# z$#y3 ‘$## w# w#, .$# 0#  q  ] Tn  # ! # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#$@P#  Q#R~#$S~# T0#U#V# *W#BX#'Y##`Z# [0#b #)c# TQum)#n~#So~#p~# q# r# s~#$ 6t#(!7u#,vI#0wI#4{xI#8@yI#<hz#@e{~#H|#L  ~ ~ ~9I~ 9pCfA#bBt #.(?cbC#{D# E7#evF7# G#H#I~#  JT#$OT J9:~#get~#put~#u~# #9C<_``#AaS#setbS#clrcS# NBdS#AeS#remfe#cloge#6h# }:i#$OCj#(_%k#,Hl#0um#4n~#8N~ N ~ ~9 e NY | | ~Zk~ |  |p7$@4un5 in6p2u7#2-SC-O~#-P~#h-Q~# -R~#  -;uid-<~#gid-=~#->~#$-?~# ,-@~# -A~#!-B~#a-C~#-D~# |-E~#$ -F~#(<-G#,-H#0-I#4+-I#8J-J~#<-J~#@-K~#D-K~#H-L~#L -L~#Pm -M#Tu -M#-S# -T #Y-U~#) D##~#P# #:G "a"^#"_%#k"`%#"ae!+!,#!-#!.~#!/# R GP ##   7G &0#f 0#0#_5)8len)90#cr):0#);0#b )Cv)D#9:)Ew#)Fw#2*)Gw#4)Hw#  (           D (¶](l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(]wD(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (~#sl(#  (W#8cap(w#@(t4(#b(_# (z #req(#rsp(#\uri(# (#(#FJ(~#@(0#*^! AIJ# K~#* L~#M~# N~# O#B P#(RP"#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Y#H$@[#Lp\#\^@^#l`~#|oa# bT#@d#d#e#o f#wgw#h~#i~#;i~#)$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vV"#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#*P"(tDR# #O# ~# h~#r~#~##B%#,acl#0#8#@#H>#P?%#Xsrv#de ~#h? ~#lh V&#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#ި#G #R~#7~#m.'##/~##'W'#id#+##t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# p# ^@# ~# o# P"# m # u # Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !# "# #~# Z#~# $'# ]%'# &# '# O(# q)'# )'# *~# w +# ,~# -'# = .~# /~# 00# 10# F2%# :2%#H"; '' #'! #srv'"# D#D  ~# <# <# / <# # #  #$u& P#(} P#, P#0 i#4Q i#<# px P"#sv # w#D w# @ 0# iid ~#J ~#sid ~## " #.$ iid ~#px P"#buf 0#sid 0# ptr ~#bol ~#X$ ( D# ϻ# #h$E\" z$ n$ $ $%x ,#t0#t1#}:V"#V"#~# D~#$ ~#(%<#len0#pos0# sid0#srv#oeP"#src#buf} #%beP"u% !0#.#& srv&# ~# ~#1&Xact—$#bck×$#,V&act#bck#E'~#Q ~# ~#~# ~#~#8 ~# #map%#  &#,V1&#T Q'#8Q'#\:Q'#/Q'#Q'# Q' E'' ~#4~#:~# <~#  A~#+~#\~#!~#m.'! '' (z f(%*dow*~#h1*~#m1*~#h2*~ #m2*~#(*min*i#max*i#%*~#w%*~#(*$@*ϊ#O*Њ#)*i*~`*f(%*ѭ(%*(/)*ptr*str*reg*/)G)%,**Ʊ#val*(#ptr*)#%*# len*~#$@*~#() *p*i*~ll*id*)a*)J)5*[%0*i*~#ptr*#len*~#@*~# ctx*)#*%*kw*# **# %*O+# yC*j+# *0# &* ~#*~  * #5)**~ P"  ~ * I+*I+C* *!#kw*"+#arg*%+# @&*&~# %*'#)*j+~ I+ *U++H&* *#kw*+#+5*!"+*%#str*$5*$,%0о0U%s/ S&Z1p',پܾ(),)3,V)=,W*I,&.~+fd.~+sa.I,,d%.O,-Y1*A~0U%fdA~.lB}.pCP"W/sD .txnEY1}/tF.cfdG~}&&H~}0s&0D%0e&p0%p0}&P0%-0& 0&1K/`&$@Q~&U%R}1r-.__poV2-_1-33p143p145z1}2-1y(12-107(12-1HR(12.1)1R(11..6pnL2~6snL2}1u.6len^~P726pnn2}78__vu>1.06__p{R2.2kn(#22./2(<21.H6__pR2.2DG(#22/H2(U22/`2(q2(z2'22(2'1)1S(19~/6pnd)~78__vk>1/p6__pQ9/8__s1/6__p$Q9/ 8__s'1/6__p-Q2"02Ap)2P7MS329@06msgz }9^0%6msgz }9y0%U.maxK~P90w8__vW>108__vV>106pn<)~6sn<)~908__vG>48__vF>212p(29.1:\2E12(2'2Gf(2}*1"/t;/__p*17+t<1T&F+feEP"*1x1+tvx1<<2%1+ctr02+inc002-pxP">l4 R>l7>dir~?2D*?_%I+Q=4& ~0U>px P">l4  P>l7 >dir ~?2D *?_% I+R93CN8__v>7cn8__v>=y4&%~ U>pxP">l4 S>l7>dir~?2D*?_%I+V=54%,~U>px*P">l4* S>l7*>dir*~?2D+*?_%+I+V95+68__v3>7fq8__v1>=5&=~U>px;P">l4; P>l7;>dir;~?2D<*?_%<I+P@&SUA[+5eAJ +5A qZA.v5pAw~A x~A -\~6BA.Q6A;0Cnow<<A=<A -X2A-^} Cone-`NA-a~6 2A $Aj /A, /A Q0AR0A U0A VAW6D%Dp+X3*-zvb0 (y 07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez  D E# F# [ > p##  Rp#J#t#  w 2>40YG Mo b'#p##n 2#" # 7 9 !-@5 !- @"~# !" # " # b " # "# "# A"# "# z"# "#$ "#( + "#, M"#0 0"#4 ."~#8 O"~#< "#@ "">#D "#p#F H"$#G b"(#H "1#L "7#T d"8#X ":~#\ ""<#` " ""# "#B "~#M  F  3 b#  9  # # # bit~#u32"0m*+#key,9# n #p #m" - m#ref !#< H 0wq 1D#rq 2D# 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#9:~0#@0# -0#$u#(  )8#J #K0#* #L0#{#M#fd#N~# @#O0#exp#P0#D6#Q#6#R#06#S# 6#T#$ib#U0 #(ob#U0 #,x #V0#0#W#40 # #U@}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P 3 #T9 #X_ 1tstru#lenv~#p p 0 v ' p z$m#L$m# $L#!$ #fe$ #be$ #$~# @$~#$Z $0#(D$#,req$0 #0rep$0 #4si$"#8 $# %$#$M#srv$#p$#Q $#> $$"#txn$# $~#$O #$6"#y3$M"## $w#$w#,$!#$0#_  - J ]s Tn  p#!s # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#$@P#  Q #R~#$S~# T0#U #Vm# *W #BXR#'Y #`Z# [0#b #)c# TQum #n~#So~#p~# qp# re# s~#$ 6t #(!7u #,v#0w#4{x#8@y#<hzm#@e{~#H|m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#He#I~#  J#$   { J9:~#get~#put~#u~# #C<_``#Aa#setb#clrc# NBd#Ae#remf!#clog!#6h># }:iT#$OCjf#(_%kT#,HlT#0um#4n~#8 ~ ~ ~! 88~'T~8Df8Z) D##~#P# m#:lX a^#_%#k`%#aSe+,S#-Y#.~#/# _ P ##5'8len'90#cr':0#';0#5b 'Cv'D5#9:'Ew#'Fw#2*'Gw#4'Hw# &    D &;&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#9&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#V&rq&st&D&P &0#col&0#sov&0#eoh&0# sol&#eol&#som&0# &~#sl&9#  &W#8cap&#@&t4&#b&# &6 #req&V#rsp&V#\uri&# &#&#FJ&~#@&0#7G &0#f 0#0#   AIJ# K~#* L~#M~# N~# O#B P#(R #S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H$@[M#Lp\M#\^@^M#l`~#|oa# b#@d#d#e#o fM#wgw#h~#i~#;i~#)$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v #hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~# (tDR # 2#O2# ~# h~#r~#~#M#B##,aclm#0m#8m#@m#H>m#P?##Xsrv#de ~#h? ~#lh Z$#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#d#G #R~#7~#m.%##/~#m#'[%#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#2#z2# 2# 2# # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# pM# ^@M# ~# o#  # m "# u "# Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !S# "S# #~# Z#~# $%# ]%%# &# '# O(# q)%# )%# *~# w +# ,~# -%# = .~# /~# 00# 10# F2## :2##HO ; %% m#%!p #srv%"# !D$ $~#$<# $<# /$<#$#$#  $#$u&$P#(} $P#,$P#0$i#4Q$i#<w!$px$ #sv$Ȭ#$w#D$w# @$0# iid$~#J$~#sid$~#! $"$Θ#!$iid$~#px$ #buf$0#sid$0# ptr$~#bol$~#"$!($!!$w!!$׎! $"  6"p *"M"p <"J"p7!$@4{un5J in6M"p2u7Z"##x ,#t0#t1#}: # #~# D~#$ ~#(#<#len0#pos0# sid0#srv#oe #src#buf9 ##be !u# !0#.m# $ srv $# ~# ~#5$Xact›"#bckÛ"#,Z$actƾ#bckǾ#I%~#Q ~# ~#~# ~#~#8 ~# #map## $#,V5$#T U%#8U%#\:U%#/U%#U%#U%I%% ~#4~#:~# <~#  A~#+~#\~#!~#m.%! % % &6 B& +$+%~#kw+&# +-k&#k&~~  ~B&& +5+6m#kw+7&# & & &(SC(O~#(P~#h(Q~# (R~# g( (;uid(<~#gid(=~#(>~#$(?~# ,(@~# (A~#!(B~#a(C~#(D~# |(E~#$ (F~#(<(G#,(H#0(I#4+(I#8J(J~#<(J~#@(K~#D(K~#H(L~#L (L~#Pm (M"#Tu (M"#(S&# (T #Y(U~#"(1'2U#cap1~R"('B:U$B~R%C+'Y~@UU$?W$W~ $(W $'X #errX$ X~&'Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V())&c%)c%*)})&g%)g%*))&g%)g%+*C+,T+*&*t)&l%)l%*J*)&p%)p%*n*)&t%)t%**)&t%)t%**")&y%)y%**&2)&y%)y%**)&~%)~%*"+)&%)%-)&%)%.`+3/(2 %,'~`U$?S$~ $( $' #err$ ~&~l0cap~'resp)u'tv,W0td,'val0V(B,0)&%)%*f,)&%)%+,,,,1,P,,2C+@F,T+03,'3P414x142~"-' U$u$~ #cap~W&b S&@ p*^- )&%)%+u-C+0?,T+2C+?B,T+5.( U6u7cap~V8b S8@ W-9&%9%5x.'(U7px(x.W6u( 82(*S8@*V-0E9&0%90%~. 54/a'H~,U6bG S+.C+,T++.C+ ,,T++.C+P\,T++ /C+,T++ /C+,T+2C+,T+5/?'t~0U6M's~8bu V8!v S8&w~W:errw~~8'x~~:msgy/~+/C+GS,T+2C+,T+ / c;50 {U:p S250NT1F0P1Q0P.]0}#L~__v>-=G>__v>?z'PbU@[!2@J !2@ q@.v#3,@w~@ (\~ T3A @)QC3B((  B)~@*;0Cnow*<<@ (X&Bh'~= @(b~8'q&80~rp0{*y 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz "D"E#"F#9 (-{5 (- @)# !) # ) # b ) # )# )# A)# )# z)# )#$ )#( + )#, M)]#0 0)c#4 .)#8 O)#< )#@ )">#D )#p#F H)$i#G b)(y#H )1#L )7#T d)8#X ):#\ ")<#`  )] ))]# )c#B )#&{ y   3 $[ >   # #   R #J #t # % wNTn  #!N# ^ k2>40Y^G io b#ښ#t#n ܊#" # 7  b# -- }  # -# -# bit#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D5]4!w !x#!y#!z0#  !{0#'!|0#r!}0#9:!~0#@!0# -!0#$u!5#( E )8#J #K0#* #L0#{#M#fd#N# @#O0#exp#P0#D6#Q%#6#R%#06#S%# 6#T%#$ib#Ut #(ob#Ut #,x #V0#0#W#4Et # #U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)k #< 7#@7#AW#D<#L #P w #T} #X+ 1tstru#lenv#  t  k p z#L# #! #fe"#be"## @#$Z 0#(D#,reqt #0rept #4si$#8 # %##srv#p#Q #> /$#txnD# #Z"#A$#y3X$## w#w#,##0#  q ] auid^1#gid_#`&# buxa  !LfdM# N#hO#$@P#  Q #R#$S# T0#U #V# *W #BX#'Y #`Z# [0#b #)c# TQum #n#So#p# q# r# s#$ 6t #(!7u #,v#0w#4{x#8@y#<hz#@e{#H|#L       7CfA #bBt #.(?cbC#{D# E7#evF7# G#H#I#  J#$   J9:#get#put#u# #C<_``#Aa#setb#clrc# NBd#Ae#remf,#clog,#6hI# }:i_#$OCjq#(_%k_#,Hl_#0um#4n#8 , CC!2_COqCep7$@4un5%in6p2u7w#*SC*O#*P#h*Q# *R# w *;uid*<#gid*=#*>#$*?# ,*@# *A#!*B#a*C#*D# |*E#$ *F#(<*G#,*H#0*I#4+*I#8J*J#<*J#@*K#D*K#H*L#L *L#Pm *M#Tu *M#*S# *T #Y*U#) D###P# #:w a^#_%#k`%#a^e+,^#-d#.#/# j P ##7G &0#f 0#0#&5&8len&90#cr&:0#&;0#wb &Cv&Dw#9:&Ew#&Fw#2*&Gw#4&Hw# %           D %}$%l%#m_l%#u%#u_l%# v%#v_l%#{%l%#v_l%#c%#c_l%# r%#r_l%#%rq%st%$>D%P %0#col%0#sov%0#eoh%0# sol%#eol%#som%0# %߉#sl%{#  %W#8cap%>#@%t4%#b%&# %z #req%#rsp%#\uri%# %#%#FJ%#@%0# ^! AIJ# K#* L#M# N# O#B P#(R"#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H$@[#Lp\#\^@^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v"#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#"(tDR # #O# # h#r###BW%#,acl#0#8#@#H>#P?u%#Xsrv#de #h? #lh &#pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉#o#G #R#7#m.'##/##''#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# ^@# # o# "# m # u # Jp# p# # # #  # # g#  # B # p !^# "^# ## Z## $'# ]%'# &# '# O(# q)'# )'# *# w +# ,# -'# = .# /# 00# 10# F2$# :2$#HZ"; $$ #$! #srv$"#  #D #G# G# /G###  #$u&P#(} P#,P#0i#4Qi#<#px"#svȷ#w#Dw# @0# iidˉ#Jˉ#sidˉ## "##iidщ#px"#buf0#sid0# ptrՉ#bol։#$( #ς#י# /$E #"A$ 5$X$ G$$x ,#t0#t1#}:"#"## D#$ #(W%G#len0#pos0# sid0#srv#oe"#src#buf} #u%be"u% !0#.#% srv%# # #%Xact^$#bck^$#,&act#bck# '#Q # ## ##8 # #map%# %#,V%#T '#8'#\:'#/'#'#' '' #4#:# <#  A#+#\#!#m.'! ' ' 'z J"'N)5pU#!4 Q$)/)L$U# K R%!M S&errN')&x())`*!)+(-).,>)V,I),T),_))x-j)_-u)-)-)P-)W.).)S.)<.)')()/-)D*0! 1fd2))k3E2j4uidj14gidj3j&5&)l)5v)m)5$@n%6retp5 p7C)7*7`*7( )8)"T4fdS$f*`)^08U# ] P%!_ S'f*d(x*'*,*~)-*~-*V-*P/**$0!# 8*(3E25$@%5 ݉6ret݉9,*s@U:fds&lt ~1su 1tv&cfdw~%&x~;s&:;D%7;e&5t;(3[<,%$@~%U%~<+&__pS++, *,)*,)8-,W++,_f(-<+`&__sP<,x&__sP<*,&__pR+A,-y|(-\82,"6t?6__p2-74t8*-%/4buf.t 2N-h4tg4fg08e-4tǐ9/)D U:sC #.CQ%?E/&argFW@->&_%>_%@.>&`%>`%+)./(/,/P(/+L./!(/,/P(/@r.8E>&m%>m%@.MZ>&s%>s%@.bw>&w%>w%+./(/' 0(0((0(40+&//#(/' 0#(0((0(40+Z///>(/' 0/>(0((0(40+}//ik(/,/P(/'/(/' 0(0((0(40 / 8/)4s 4bt 3*k A 05i0hAA0 -0+0x+>0,91(U:s S:reqt V%.W1p+013F, 1R,+1Q+071,D1P@0&__sW+0P1(]1'71(D1271yk3j4nowj8P1(4buft 8i1)4buft 9d5)`U:t&s p%'*l%W*0h%.*0W;)vf;)yr;C(<2>@0'd5(q5@G2%@0R'd5(q5+^2}5(5+25F(5(5+25,5R,5V'50,5R,5V+25Sf(5,5S+25x(5(5+35(5,5V)-5R+23}5(5+]35(5,5V)-5R@w3>@0+35(5+371 (D1+3717C(D1+35NX(5+36(6'6(06+'4:6(K6'U6(b6+f4t6(6'6(6'U6,b6P+}4N-B([-+46(6+41, 1P,+1Q+41, 1P,+1Q+412, 1P,+1Q'62(6+&51?V, 1P,+1V+F51[r, 1P,+1V'1~, 1P,+1V8}5&4buft 857*u4buftt 25M#u4t1t4t2t85d(c4bufbt 3rAb059(d086S(4buft 26"4t2:6 ~4t}2U6 v4tu8n6]3\n6264t264t86s(M4bLt B)`rUC1'K66 >C'L66 ~C'M6C[(7pCJ (7C q!C.vK77CwC xC *\ 7D C+Qx7C,;0Enow,Em?ERAE3CD^7roS UH 0oBTGQqF{z )D)E#)F#J37 3J3G# { A3J9 /-V5 /- @0# !0 # 0 # b 0 # 0# 0# A0# 0# z0# 0#$ 0#( + 0#, M0#0 00#4 .0#8 O0#< 0#@ 0">#D 0#p#F H0$#G b0(#H 01#L 07$#T d08$#X 0:#\ "0<#`7b \$y$0 00# 0#B 0#    3tm,w/x# y#rz#z{# >|#R}#6~#j## #$\#($[> ##  !R#J#t!# 1 wVnV#pV#1" - 1#ref!V#]4(w (xm#(y1#(z0#  ({0#'(|0#r(}0#9:(~0#@(0# -(0#$u(#( . Q bQ# aa .  6# a# a# bit#u32"0*+g#key,#` H0wq1#rq2# 3#04#450#86v#< 7$#@8#Dppp`)  D # # # P#  1#: | D # #2>40Y G Po b*#ڦ##n 5#" # 7 s )8 J K0#* L0#{ M$#fd N# @ O0#exp P0#D6 Q #6 R #06 S # 6 T #$ib U #(ob U #,x V0#0 W$#4  s  #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D<  #L  #P  #T #X  1 tstr u#len v#     p  z 1#L 1# p#! g#fe $#be $# # @ #$Z 0#(D #,req #0rep #4si &#8 # % # P#srv #p #Q #> &#txn # # C$# *&#y3 A&## Â# Ă#, %# 0#   ] Tn# # ##! # ' k Z auid^<#gid_&#`1#m buxa' t!LfdM# N#hO#$@P#  Qa#R#$S# T0#Ug#V1# *W}#BXv#'Y#`Z$# [0#bZ #)c#a TQum#n#So#p# q# r# s#$ 6t}#(!7u}#,v#0w#4{x#8@y#<hz1#@e{#H|1#Ltm }m  a CfA}#bB #K.(?cbCK#{D$# E7#evF7# G[#H#I#  J#$ [  J9:#get#put#u# #a   !!#!#!#3 !!3#!#G!#m.(!'7!(#&!)#!*#!+# +!+#7!,#@!-#-!.#!/3# !0#$99! ''9#u'#Z'#len' # \'!#F'"#gp"7$@"4un"5 in"6Pp"2u"7?# 1SC1O#1P#h1Q# 1R# ? 1;uid1<#gid1=#1>#$1?# ,1@# 1A#!1B#a1C#1D# |1E#$ 1F#(<1G#,1H#01I#4+1I#8J1J#<1J#@1K#D1K#H1L#L 1L#Pm 1Mg#Tu 1Mg#1S# 1Tm #Y1U# r %a%^$#%_%#k%`%#%a?x%e %j%h}#]%i}#A%je$+$,#$-#$.#$/\#   r7P V#I#CC77G &0#f 0#0#5,8len,90#cr,:0#,;0#b ,Cv,D#9:,E#,F#2*,G#4,H#  a+!!!! ! !!!! ! D + +l+#m_l+#u+#u_l+# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#7+rq+lst+D+P +0#col+0#sov+0#eoh+0# sol+#eol+#som+0# +ߔ#sl+#  +W#8cap+#@+t4+a#b+# + #req+7#rsp+7#\uri+# +#+#FJ+#@+0#?/+ .+\#idx+#val+# 7+ #  " AIJ# K#* L#M# N# O#B P#(R$#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X1#@!Yp#H$@[P#Lp\P#\^@^P#l`#|oa# b#@d#d#e#o fP#wg#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v$#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.O# 0#i# i#i#Qi#U#$(tDRg# 5#O5# # h#r##P#B@'#,acl1#01#81#@1#H>1#P?^'#Xsrv#de #h? #lh (#pK#Z #Ҕ##Ԕ#0#֔#gה#[# ٔ#R ڔ##ܔ#ݔ##G #R#7#m.##/#1#')#id#+#1#t#4 ##0#i0#0#0# O#0#+O# 0#i#i# i#$0#0#`0#5#z5# 5# 5# # # 8# # 0# j0#  G#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# pP# ^@P# # o# $# m g# u g# Jp# p# # # #  # # g#  # B # p !# "# ## Z## $9# ]%9# &# '# O(# q))# ))# *# w +# ,# -)# = .# /# 00# 10# F2&# :2&#H6C$; ** 1#*! #srv*"# $D  # R# R# / R# # #  #$u& P#(} P#, P#0 i#4Q i#< k% px $#sv Ƞ# ɂ#D ɂ# @ 0# iid ˔#J ˔#sid ˔# % " \# % iid є#px $#buf 0#sid 0# ptr Ք#bol ֔#& ( $ k% ׂ% &  $*& &A&  0&&x ,6#t06#t16#}:$#$## D#$ #(@'R#len0#pos0# sid0#srv#oe$#src#buf #^'be$u ' !0#.1# ' srv'# # # 'XactG&#bckG&#, (act6#bck6# (#Q # ## ##8 # #map'# ļ'#,V'#T )#8)#\:)#/)#)#)( ) #4#:# <#  A#+#\#!# ) ) #);$9$$u:)@5 61# E7U*#be;)# U*XD7 -?1# g-@1#pol-A# -B0# .-C#)*: > ?1# E@U*#+x(C D1# EEU*# JF# G# %H# I# @J0# K# L#$z+%-dow-#h1-#m1-#h2- #m2-# +-min-i#max-i#%-˔#w%-̔# +-$@-5#O-5#,-i-Ȕ`-z+%-+%-+C,-ptr-$str-reg-C,r,%,--1#val-+#ptr-,#%-s# len-ڔ#$@-۔#(, -p-$i-ll-id-,a-,J ,$ I-[%0-i-#ptr-#len-#@-# ctx-,#-%-kw-\# --# %-c.# yC-~.# -0# &- #-g-I,--$ $-]..].C- -!1#kw-".#arg-%.# @&-&# %-'1#,-~.].-i..H&- -1#kw-.# .I-"#.-%%str-$I-/+t4a#len# !/# !/b  /&/1ƀU'iǔQ'tmpQ'msgɔS(z/)__s$*)__s$+04rDU,bp ,msgp0W-bq0p- q\S.rAsP/lens081qAy07+0.-PU,b R,msg0S-b0V- \,lenW.rAP0X1qA0+1?4]U,hdr\,end\V-u\,lenW2val\R+U1W/\`U,s\P,e\S.-V.'.Q+(20EU-u\,len ,sol\W,idx0R,ctx(22eol\V2sov\S.F1p343v.42.2C^5?26K2`g5\27K2N1<8;07h221800+20 P{U-u \S,sol \ ,idx 0,ctx (29q3*,U,t S,si V,err-* -FJ,msgq3W4D3|3:3Q4[335363:3Qw3 ;3.+^53U,s ,si  2txn4V2rdr h.E2Q2lenS6^55k54I5u5':5Q5565\u55;u5/(5m3U,s V,si S.x P>7 / U,s V2pn2fe$~2be$~1$2txn4W.~.~2err~2uriP2hR.~2tm~.i-7 .?~2hdrS477IO:7~:7P4:77 57574e7 8= s 585)8*= s ?58(7  /__vJ>*  /__vI> 7@7"Anow!7Atm!7 G78@+=93j U,somh,idxh0 ,capi-! i92eolkp2solkl2colkV2sovkW.F1lh2hm9S2lennd49.2! # 5?24(9K2G N 5\20p2__p$Q+:.\hU,msg0V-/\W- 0S,ptr\R,end\Q-*,-O,: 3-3 + 3 434I3}1y32153-*3\+0+;/-\p9U,msg*0S-/*\ - +0P,ptr+\R,end+\Q-*,,W-O,,: 3.2=3 +3*0Hp3D-Q-35^3/i3W2r3k2S33`3..k><E0@PU,buf ,msg0W,idx0. 0R2ptrS2endV3 +`3W-03-i3*X3+3y435F333.!30347:3+3+Q35e3W03,4v32{)3"2-3.3`14<<"5<:=w :=R4<<5<:=w :=R4<=sv5)=*?5=;=J+F8E0=H.PU,es=S,s p,buf W,msg0V-t0$l&+>a.T DU,tS -S$P2txnU4d.m.V`.C"W\10X.F1XV2hYSDF>2__s[$W4]>.25?2Ds>/len4>>5>4> ?:?Q4>#?50?4>nt5>6]Az:nAR:yAP6A:AP5A7A^$W|Bj/v"U,t P,rtr Q2txn4p2p1l2p2V.0V..S.0h.F1W4YB.2  5?20X.=0P2valP>BG/ "#U,s  S,rep V4BB""5B*" #2ret P;B,xF*R (*U,tR  W,bufR \p,lenR V2txnS 4l.2T CV1h0U DE2__pb $QDF2__pl $S4AF]A})):nAR:yAP6A)):AP5A02srv S*))1& %1 %+Fv+ *I+U,s Q,e \V.- W.'. S+G. P+,U,buf -- S- Q.5 R>I$/  ,I4U,t  ,req  2txn 4l.Y, h.F1 d.* `.n+ \."0 X.t1 T.- p.5 P.", S.w, L.4 V.- H.1 D. @4IH.20,3,5?2DqH.=0 2val PDH0.+V0H2__p$QDHh.+/P.0/.R30DH.OS01qA^0D)I.qP01qAw0DSI2srv.+(I11.P0 1qA'0(I263.P0@1qA 00h.3W.1P01qA0+ K2,kP46U,tj P,rtrj  ,expj.OCls.0mV..mS.0ml.F1nW.*nh.,nd2txno4`.=0p\2lenqP.qP4J.2l4r45?2DJ1qA001qA0+K/6O8U,t ,rtr  ,exp.OCs.0W..V.;+l2txn4S2lenP.P(K771qA06<775<:=P:=R+YLz2#P88U,t" W,rtr"  ,exp"S2txn$4V02ret'P>lO%5M8cCU,tL ,resL  2txnN4l..Oh.F1Pd.*P`.PS.n+Q\."0QX.t1QT.5Rp.",RS.w,RP.4RV.-RL.1RH.RD4M.2885?2D N.=0[@2val\PDM0.+ V0H2__p $Q0h.+[P.0[.R3\DWN.2CS6]A"<D<:nAQ:yAP6A:<B<:AP5ADmN1qA+0DN1qAS0DN2__pn$QDN1qAE0DN8.3W.1P0P1qA0DOx.1P01qA600.0%WD>O2__p$VDVO2__p$Q02__p$Q>PR4pCDU,t -X3\ ,len.1P.1W.2S.=.p.0o.0P. S>P+EEU,dir\,t Q-V+\W,end\S2lenV2maxP002bR+Tf, ESU,t  2txn 4W2req p2rep l3*3 E32t SP35a H31% HDRP.F10 S/msg1 0.52 $V0p11 $DQ.0, S.., d.0, `.F1- \.*- X.- P2val- P.=0. T6.2(G+G5?24R ?HH5?6#?HH50?D-R1qAG 0DCR1qAR 04kR={KK:)=P*KK?5=4RTKK5)T:4TRDRE?TPDR2len~ S(SMBN2eol; V2sol; h4R.2MM5?26K2MM5\24S ?NN5?45S#?NN50?4LS ?OO5?4cS#?OO50?4zS ?PP5?4S#?PP50?4S#?>QHQ50?4S ?QQ5?4S>DRNR5>4SKTRR5XT5cT6 8RR585)8*RRE58P;KTd(c__5>4W]A__:nAQ:yAP4WA ``:AP5A4WA!`.`:AP5ADW2len PVD-X.E2\~.-V0 2qsPDRX82lenS2pnVVDwXP2lenV2pnVW(Xee2eolS2solV4X.2-e8e5?26K2NeUe5\2DXh.EU*V02retPDY2__p$Q(+Ytff.3SDrY.P..S6<Lgzg5<:=P:=R4Y5zhh55DY2lenS2pnZ4Y?Ci^i5@: @P4Y5 k,k554Y>8k;k5>46Z]ANkok:nAR:yAP6Adkmk:AP5A4MZ5zkk55DgZ2ctx 4~Z5ll55*(man.5 i2ctx6 6>mm5>[**;Z& O=`5PrrU,px$P,l4 R,l7$P,sol -2D-W-_%].S/txn42idx0Q2ctx(2V=+a,sEsU,px $V,l4  S,l7 $Q,dir -2D-R-_%].P/txn4=a,"PssU,px $V,l4  S,l7 $Q,dir -2D!-R-_%!].P/txn#4=Kb24ssU,px2$P,l42 R,l72$P,sol2 -2D3-W-_%3]./txn542idx60V2ctx7X2cnt8S=b/Js5tU,pxH$V,l4H S,l7H$Q,dirH-2DI-R-_%I].P/txnK4=?c1]@ttU,px[$V,l4[ S,l7[$Q,dir[-2D\-R-_%\].P/txn^4=c.pt)uU,pxn$P,l4n R,l7n$P,soln -2Do-W-_%o].V/txnq42idxr0Q2ctxs(2S=OdO50uuuU,px$V,l4 S,l7$Q,dir-2D-R-_%].P/txn4=d-uuU,px$V,l4 S,l7$Q,dir-2D-R-_%].P/txn4=e0uvU,px$P,l4 p,l7$P,sol -2D-S-_%].V/txn42idx0Q2ctx(2W02__s$S#e$0$>$ 7/__ue/__cwre=:f-vvU,px$V,l4 S,l7$Q,dir-2D-R-_%].P/txn4=f,vwU,px$V,l4 S,l7$Q,dir-2D-R-_%].P/txn4=Mg;2 wwU,px$,l4  ,l7$P,dir-2D--_%].S/txn42ptrP2endVG,iwwUH1.Kmgsg >H.Lgg H.MgH[/gHJ /gH4 H H.vgHwH 1\ hI HQhH;0Jnow  j L@5j> Lp5j>  j\4  K-j7 jNj /Nk / k\ Nk 6kb K-Ik0 &kK*ak0 /.%.Ľ0c8>w0v6yint 77i "72-y&pk67>Lm?LRAL3CDe7roS UH 7-oBTGQqFpz #D#E##F#9 '-{5 '- @(%# !( # ( # b ( # (# (# A(# (# z(# (#$ (#( + (#, M(]#0 0(c#4 .(%#8 O(%#< (#@ ("E#D (#w#F H($i#G b((y#H (1#L (7#T d(8#X (:%#\ "(<#`  (] ((]# (c#B (%#&{ y   3% %$[E ##   R#J#t # 0 w{Wڥ#ۺ#n #" #TnW  #! #2E47YG o b# >    b # .. ~    #  .#  .# bit %#u32 "7 * +4#key ,~# n #p #" - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 57#8 6#< 7#@ 8%#D6]4"w "x#"y#"z7#  "{7#'"|7#r"}7#9:"~7#@"7# -"7#$u"6#( F )8J K7#* L7#{M#fdN%# @O7#expP7#D6Q&#6R&#06S&# 6T&#$ibUu #(obUu #,x V7#0W#4  Fu # U@}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#,7#0 7#4H%#8)l #< >#@>#A^#D< #L  #P  #T #X, 1tstru#lenv%#  u  l p z #L # #! #fe #be # %# @ %#$Z 7#(D #,req u #0rep u #4si &#8 # % # 6#srv #p #Q #> '&#txn # %# R$# 9&#y3 P&## ~# ~#, %# 7#  & %#<&!%# &"%#&# # r ] k auid^1#gid_#`&#$ buxa + !LfdM%# N%#hO%#$@P#  Q#R%#$S%# T7#U#V# *W4#BX#'Y#`Z# [7#b #)c# TQum:#n%#So%#p%# q# r# s%#$ 6t4#(!7u4#,vZ#0wZ#4{xZ#8@yZ#<hz#@e{%#H|#L+ $ 4%%$ J Z%JCfA4#bBu #.(?cbC#{D# E>#evF># G0#H#I%#  J_#$ ` _ J9:%#get%#put%#u%# # DC<_``#AaY#setbY#clrcY# NBdY#AeY#remfk#clogk#6h# }:i#$OCj#(_%k#,Hl#0um#4n%#8Y%%Dk_%eq%5%8len%97#cr%:7#%;7#Fb %Cv%DF#9:%E~#%F~#2*%G~#4%H~# $    D $L$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#J$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#g$rq$st$ D$P $7#col$7#sov$7#eoh$7# sol$#eol$#som$7# $%#sl$J#  $^#8cap$ #@$t4$#b$# ${ #req$g#rsp$g#\uri$# $#$#FJ$%#@$7#) D##%#W# #:H !a!^#!_,#k!`,#!ae + ,# -# .%# /# S HP ##JQ(tD# #O# %# h%#r%#%#6#B!#,acl#0#8#@#H>#P?!#Xsrv #de %#h? %#lh Π"#pK#Z #%##%#7#%#g%#[# %#R %##%#%#ީ#G #R%#7%#m. $##/%##'##id#+##t%#4 %#%#7#i7#7#7# Q#7#+Q# 7#p#p# p#$7#7#`7##z# # # # %# 8# %# 7# j7#  <#  p#  p#  p#  p#  p#  p# ) p# p# Qp# %#cap%# p6# ^@6# %# o# # m # u # Jw# w# %# %# %#  %# %# g%#  %# B %# p !# "# #%# Z#%# $,$# ]%,$# &# '# O(# q)2$# )2$# *%# w +# ,%# -B$# = .%# /%# 07# 17# F2\!# :2\!#H7G &7#f 7#7#p7$@4un5{in66p2u7#  ;  #! #srv" #  A"J # K%#* L%#M%# N%# O#B P#(R#S%# T%#$5 T%#($U7#,6U7#0tV%#44 V%#8'W%#<X#@!Y#H$@[6#Lp\6#\^@^6#l`%#|oa# b_#@d #d #e#o f6#wg~#h%#i%#;i%#)$j%# j%#Rj%#k%#l%#Fm%#ido#p7#b p7#q7#r7#us7#?t7#Vt7#gu# v #hw #yp#yp#jz7# {<#}p#}p#~p#~p#p#.Q# 7#p# p#p#Qp#U%#\!x ,#t0#t1#}: # #%# D%#$ %#(!G#len7#pos7# sid7#srv #oe#src#buf #!beu" !7#.#P" srvP"# %# %# {"Xact #bck #,"act#bck##%#Q %# %#%# %#%#8 %#  #map"# V"#,V{"#T ɛ##8ʛ##\:˛##/̛##͛### #$ %#4%#:%# <%#  A%#+%#\%#!%#!m.$!! &$ B$ R${ %D  %# G# G# / G# # #  #$u& W#(} W#, W#0 p#4Q p#<z% px #sv # ~#D ~# @ 7# iid %#J %#sid %#% " #% iid %#px #buf 7#sid 7# ptr %#bol %#& ( % z% ב% '&F 9& -&P&  ?&&,SC,O%#,P%#h,Q%# ,R%# ( ,;uid,<%#gid,=%#,>%#$,?%# ,,@%# ,A%#!,B%#a,C%#,D%# |,E%#$ ,F%#(<,G#,,H#0,I#4+,I#8J,J%#<,J%#@,K%#D,K%#H,L%#L ,L%#Pm ,M#Tu ,M#,SV&# ,T$ #Y,U%#"(h6L%wwU#07L%S#o6L(Q#6L%R#6L(V$lenL,W#@LWP%*LS&)6%xAzU'si p'bu S(6%l(%h)ret%Q)max%d*))862PzzU'si1 S"*5%zU$fd%+si p+bu S+ret%Q+max%W%%l%'7%h%6%d,",Y6,#|-){{)fwd9%R.*(6%V/#**8}_}0*V1*/d**}0~1*1*203*V3*Q4*4+3+V5+10++R06+P5B+'/0S+P1^+6*h7tg7fg76+6h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6B+^$W%7nowV%:'V%6j+}#L%7nowK%:'K%*+63U'si S;,7x%@1U'fdw%)siy W)bzu S({%p,",#,J6/@,+ɂ0++R06+P5B+؂0S+P1^+/W,,1,/u,*,K0*S1*/,+Ń0++V06+R5B+ك݃0S+R1^+5*0*S1*6,6D%:C%*-6M@͆U'siL W)ibNu V)obOu S)fdP%p/n-+0++R06+P5B+ 0S+P1^+/-+&?0++R06+P5B+5=0S+P1^+5+r0++R06+P5B+0S+P1^+*.$6І:U'si R)ibu P*>/6@U'si V)obu S(%P,#R/u.,1,/.+$C0++W06+R5B+8@0S+R1^+/.*Rq0*S1*//+ˆ0++R06+P5B+0S+P1^+5+0++R06+P5B+0S+P1^+<['K/pEm ?ER AE3 C D^7ro S UH  09 -5 -@ ~#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. ~#8O ~#< #@ ">#D #p#FH $ #Gb (#H 1#L 7#Td 8#X :~#\" <#`     #  # B ~#   / 3qFcz D E# F#oBTGQ n #p #"  - #ref !#x]4w x# y# z0# {0# '|0# r}0# 9:~0# @0# -0#$ ux#(   b#    ### bit~#u32"0?* +#key, # H0wq1#rq2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D?))  D# # ~# P# #:] D]# ]#P # #)2>40YG o  b# $[ >*   # *# : q R # J # t q#  w # ۺ# n # " # 7 )8!J !K0# * !L0# {!M#fd!N~# @!O0#exp!P0# D6!Q# 6!R# 06!S# 6!T#$ib!U #(ob!U #, x !V0#0 !W#4 # !U @}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H~#8 ) #< 7#@ 7#A W#D <#L #P  #T  #X4 1tstru#lenv~#E E  K  p z "# L"# "# !"#fe" #be" # "~# @"~#$ Z "0#( D"#,req" #0rep" #4si""#8 ":# %":# "#srv"# p"# Q "# > ""#txn"# "~# ")!# "## y3"'## # "w# "w# ,""# "0#4    ]H Tn  # !H # X k auid ^y#gid _c#  `n# bux aX  ! Lfd M~# N~# h O~# $@ P:# Q#  R~# $ S~#  T0#  U#  V# * W# B X# ' Y# ` Z# [0#  b # ) c# T Q u m#  n~# S o~#  p~# q# r#  s~#$ 6 t#( !7 u#,  v#0  w#4 { x#8 @ y#< h z#@ e {~#H  |#L  ~~~  ~CfA#bB #|.(?cbC|# {D# E7#evF7# G# H# I~# J#$   J 9:~#get~#put~# u~# #p7$@4un5 in6,p2u7#m(S C(O~# (P~# h(Q~# (R~#  (;uid(<~#gid(=~# (>~# $(?~# ,(@~#  (A~# !(B~# a(C~# (D~# |(E~#$ (F~#( <(G#, (H#0 (I#4 +(I#8 J(J~#< (J~#@ (K~#D (K~#H (L~#L  (L~#P m (M#T u (M# (S,# (T # Y(U~# a ^# _%# k`%#ane+ ,n# -t# .~# /# )z 5%8len%90#cr%:0#%;0#b %Cv%D# 9:%Ew# %Fw# 2*%Gw# 4%Hw#  Z$!!!! ! !!!! ! D $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#0$rq$est$D$ P $0#col$0#sov$0#eoh$0# sol$#eol$#som$0#  $~#sl$# $W#8cap$#@z$ t4$Z# b$# $ #req$0#rsp$0#\uri$# $# $# FJ$~# @$0#7G  &0# f 0# 0# " AI J# K~# * L~# M~# N~# O# B P# (R # S~# T~#$ 5 T~#( $U0#, 6U0#0 tV~#4 4 V~#8 'W~#< X#@ !Y#H $@[#L p\#\ ^@^#l `~#| oa# b# @d# d# e# o f# wgw# h~# i~# ;i~# )$j~# j~# Rj~# k~# l~# Fm~#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hw# yi# yi# jz0# {/# }i# }i# ~i# ~i# i# .z# 0# i# i# i# Qi# U~# (tDR # # O# ~# h~# r~# ~# # B-$#,acl#0 #8 #@ #H >#P ?K$#Xsrv#d e ~#h ? ~#l h $#p K# Z # ~# # ~# 0# ~# g~# [# ~# R ~# # ~# ~# c# G # R~# 7~# m.s&# # /~# # '%#id# +# # t~# 4 ~# ~# 0# i0# 0# 0# z# 0# +z# 0# i# i# i# $0# 0# `0# # z#### ~#8#~#0#j0#  /# i# i# i# i#  i# i#) i#i#Qi#~#cap~#p#^@#~#o# #m #u #Jp#p#~#~#~# ~# ~#g~# ~#B ~#p !n#"n##~#Z#~#$&#]%&#&]# ']#O(]#q)&# )&#*~#w +#,~#-&#= .~#/~# 00# 10#F2##:2##H)!; # # # #!E #srv#"# !D" "~# ":# ":# /":# "# "#  "#$ u&"P#( } "P#, "P#0 "i#4 Q"i#<Q""px" #sv"Ȇ# "w# D"w# @"0# iid"~# J"~#sid"~#h" " ""ζ#""iid"~#px" #buf"0#sid"0# ptr"~#bol"~#""("!"Q""h" "  #E #'#E #J#x , #t0#t1# }: #  # ~# D~#$ ~#(-$ :#len0#pos0# sid0#srv#oe #src:#buf #K$be up$  !0# .#$ srv$# ~# ~#$Xact4##bck4##,$actƐ#bckǐ#% ~# Q ~# ~# ~# ~# ~# 8 ~# #mapp$# ĩ$#, V$# T %# 8%# \:%# /%# %#%%m&  ~# 4~# :~# <~# A~# +~# \~# !~#m.m&! y& & & #I'7W~nU$Y7X~ %'I'&Z''P&Z'('h)d'R*q'։݉+'%5'' ,'P+'*')E+'-q'".t/.__p-'70t-'}#L~0nowK~1'K~2'>1 #@(7#~pU$Y7$~ 37%~4s&S4p' W5m$7/~V$w7/~p#)7gU6tf4ph p$e7i)l$j7jS$*jW4ik~h%(),%)P+0)%('IX,'P+'7(y.lent~'3\}c-<)yk~1j~0nowj~#)tF~U8r7P87P37375 3&%3%9) mU87S9*F7p=U4p S%~**+*%B**ō+***ō+***+**+ō++*+̍+0+**̍؍,*P*:+,G+Q-*"0t-* ~0t}-* v0tu2*]1\*-+0t-:+0t2Q+0t:[^+:J ^+:L^+;4]P? ;4H? ;  ~T? :.v+:w~ +< :&Q+:';0=now'<:: (Xm:(^ >(O : Q0:R0: U0: V]:W*$7 ?P>8@0U;y !07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz $D$E#$F#9 +-{5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 O,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7 6 B  , ,,# ,#B ,#I{B3$[> ## 8R#J#t8#Hwty6 7# w8#2>40YtG o b#ڽ#ۊ#n ܠ#" #73 b3#CC  # C# C# bit#u32"0*+I#key,#n#p#" - #ref!# H0wq1#rq2# 3#04#450#86#< 7#@8#D K]4"w "x*#"y#"z0#  "{0#'"|0#r"}0#9:"~0#@"0# -"0#$u"K#([ ))8&J &K0#* &L0#{&M#fd&N# @&O0#exp&P0#D6&Q;#6&R;#06&S;# 6&T;#$ib&U #(ob&U #,x &V0#0&W#4 5 5[) # &U@#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#,#0#0 #0#4H##8)# #< #7#@#7#A#W#D<#5#L #5#P # #T# #XA 1#tstr#u#len#v#    p #z%#L%# %#!%#fe%"#be%"#%# @%#$Z %0#(D%#,req% #0rep% #4si%$#8 %# %%#%#srv%P#p%P#Q %P#> %$#txn%# %#%"#%$#y3%$## %w#%w#,%؎$#%0#    ] Tn  #! # k auid^1#gid_#`&## buxa * !LfdM# N#hO#$@P#  Q#R#$S# T0#U#V# *W3#BX#'Y9#`Z# [0#b #)c# TQum?#n#So#p# q# r# s#$ 6t3#(!7u3#,v_#0w_#4{x_#8@y_#<hz#@e{#H|#L* # 3 #O_ OCfA3#bB #.(?cbC#{D# E7#evF7# G#H#I#  Jj#$ej J9:#get#put#u# {#OC<_``#Aai#setbi#clrci# NBdi#Aei#remf{#clog{#6h# }:i#$OCj#(_%k#,Hl#0um#4n#8d d O { do   p   p7$@4un5 in6p2u7#H0SC0O#0P#h0Q# 0R#  0;uid0<#gid0=#0>#$0?# ,0@# 0A#!0B#a0C#0D# |0E#$ 0F#(<0G#,0H#00I#4+0I#8J0J#<0J#@0K#D0K#H0L#L 0L#Pm 0M#Tu 0M#0S# 0T# #Y0U#) D###P# #:] a ^# _%#k `%# a*e+,#-#.#/# h ]P ##  67G &0#f 0#0#u5)8len)90#cr):0#);0#b )Cv)D#9:)Ew#)Fw#2*)Gw#4)Hw# 6(           D (s(l(#m_l(#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(sD(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (߉#sl(#  (W#8cap(#@1(t4(#b(u# ( #req(#rsp(#\uri(# (#(#FJ(#@(0#{?/( .(#idx(#val(# 7( # t!P A I JP# K#* L# M#  N# O#B P#( R"# S#  T#$5 T#($ U0#,6 U0#0t V#44 V#8' W#< X#@! Y#H$@ [#Lp \#\^@ ^#l `#|o a# bj#@ dP# dP# e#o f#w gw# h# i#; i#)$ j# j#R j# k# l#F m#id o# p0#b p0# q0# r0#u s0#? t0#V t0#g u# v"#h wP# yi# yi#j z0# {<# }i# }i# ~i# ~i# i#. # 0# i# i# i#Q i#U #"(tD R # #O # # h #r # # #B %#,acl #0 #8 #@ #H> #P? &#Xsrv P#de #h? #lh ζ&#pK #Z # ҉# # ԉ# 0# ։#g ׉#[ # ى#R ډ# # ܉# ݉# ޾#G #R #7 #m. 6(# #/ # #' '#id #+ # #t #4 # # 0#i 0# 0# 0# # 0#+ # 0# i# i# i#$ 0# 0#` 0# #z #  #  #  # # 8 #  # 0# j 0# <#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  #cap # p # ^@ #  # o #  "# m # u # J p#  p#  #  #  #  # # g #  # B # p !#  "#  ## Z ##  $B(# ] %B(#  &$#  '$# O ($# q )H(# )H(#  *# w +#  ,#  -X(# = .#  /#  00# 10# F 2r%# : 2r%#HV"; '' #'! #srv'"P# #D% %#%G# %G# /%G#%#%#  %#$u&%P#(} %P#,%P#0%i#4Q%i#<$%px%ǰ"#sv%P#%w#D%w# @%0# iid%ˉ#J%ˉ#sid%ˉ#2$ %"%#$%iid%щ#px%Ұ"#buf%0#sid%0# ptr%Չ#bol%։#$%(%̤#%$%2$$[" $ $ $ 5$r%x ,  #t0 #t1 #}: "# "# # D #$  #(%  G#len 0#pos 0# sid 0#srv P#oe "#src #buf #& be "u 3& ! 0#. #f& srv f&# # #P&X act $#bck $#,& act #bck #'  #Q # # #  # #8 # P#map 3&#  l&#,V ȑ&#T ɱ'#8 ʱ'#\: ˱'#/ ̱'# ͱ'# ' P'0(  #4 #: # < #  A #+ #\ #! #m.0(! <(X( h( (%*dow*#h1*#m1*#h2* #m2*# )*min*i#max*i#%*ˉ#w%*̉#2)*$@*Ϡ#O*Р#e)*i*ȉ`*(%* )%*h()*ptr*str*reg*׏)])%,**#val*2)#ptr*e)#%*0# len*ډ#$@*ۉ#(-* *p*i*ll*id*-*a*4*JD**[%0*i*#ptr*#len*#@*# ctx*)#*%*kw*# *+# %*+# yC*+# *0# &* #+ $ + 9)*K+ "  K+ +Q++C* *!#kw*" ,#arg*% ,# @&*&# %*'#D*"++ + +++H&* *#kw*+# ,*!" ,*%#str*$*$,<@IU%px"&op&totS'l&curPQ'k9PW(,&maxƉh)*v̉+,=MP܏U%pxL"Q&srvNPR,,- ---.#-8;/ :/'8:+F-8i1U%pxh"R+-9{@U%srvzPS&p|"V0:,,Y]- ---+->:.U%srvPS&p"V0:,,ِ- ---$n.P80U%p"W&srvPS'<V&actp&bckl1c2w`1t3t4q/:5U5srv4PS2p6"W2grp7q/P6:b6<9_s7.,Ò˒- ---7.,˒- ---(/8x OPR71/,=O- ---7]/w/ÓՓ-/,/ÓՓ9/P,/Փ-/$:/c<F;sEP08fU5p"V2srvPS?9<70,- ---,S0P9a0W-m041:pU5sPQ3p"2grpq/R7L11-1)@1P7c11Ԗ-1,1ؖ-1)@1P:18;sP3grpq/:18u;stP:1;{;szP3grp|q/42"9o2U5srvnPS2pp"V2grpqq/W6:76<97Z2,37- ---7v2,Pc- ---)8x PP43z;@ʚU5srvPW?8?72p"p2grpq/l73,lw- ---73,w- ---7H3w/KZ-/,/KZ9/PAp3X89Q?K873w/i-/,/i9/P73w/-/,/9/V,S09a0S-m04F49hК3U5sgPV724F4-T4,/9/S,_4,-m4:_4:U;sTP:x4c;^;s]P4m5W:v@'U5srvuPS2pw"V6:6<9s74,[_- ---74,_s- ---(508x PR7-5,ݛ- ---7Y5F4-T4,/9/P,m5'-{5:5;O;sNP43680KU5srvPS2p"V6:S6<9,75,OS- ---76,k- ---(6H8x PP,_4,-m446;PU5srvPS?8?72p"p76,|- ---76,- ---76_4OR-m4,F4-T4,/-/>a7< 9U5p"V2srvPS?9<7M7,П- ---,_4-m4B7O9qP@U5pxp"5uripVC7p8[rPp2psS8 1tl8:uhB8;P,U5s P8[PT2txn8P2req V2msg9S2px"L8:0H8)-PW2lenPD8 1@2ctx1X2pS)`8101֢3c)x2hex0R18*PB9=8P0FU5s S8[PW3txn82msg9T2px"V8:0P2lenPS2ctx 1X2p!Q1F8;?LB<><sPdU5sr 8;uPp2errvV6HDout77:<>9-M>9V>P(O:2lenW7/;v>ƦD->9>W(:@>P@>\@>V7:>->,>->,?9#?P-/?)@>S,5G->,>5G->,?5G9#?P-/?7<'Au-5A) @AAPAS=ѪEA7?=>9>P,>->,?9#?P-/?,1ͪ-17o=NA٪.-\A-hA,w/.=-/,/.=9/P7=?v9?W9?P) @?S@?L@?V@?H7!>>L_->,>L_->,?L_9#?P-/?,S0(9a0S-m0.`>9FGsF`>GpFk>f> q> VH>.;?P;p>"=X<>P3srv@P?r;@P?A/I3sTP.>7// 6"H ?6 ?= 5"IHAA3__v4>13__v4>1ԯ3__v1>ABԯ߯3__v1>1߯3__v1>BoB :i@˱U5sh V2pj$P2errkSBD.8бU5s 3fd2errP(sC 8m$DT2retP8@L18#1H2src2X7.CD&f9DQ9DS7YCDͳ9DQ1ͳ@D@12__vG>P7CDpu-D(C!8m$fDW2retgS8@gS(CH!2msg7CD 9EQ9EP7D%E#96EP-AE76DD P9DQ9DS7VDD9DQ9DS7vDDӸ9DQ9DS,D(9DQ9DS/-M>-V>7EDOR9ER9EP7F%Ejn96EP-AE,oF-|FEm?ERAE3CD^7roS UH 0oBTGQqFez "D"E#"F#9 %-p5 %- @&~# !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&R#0 0&X#4 .&~#8 O&~#< &#@ &">#D &#p#F H&$^#G b&(n#H &1#L &7#T d&8#X &:~#\ "&<t#`   &R &&R# &X#B &~#p n   3 $[ >   # #    R #J #t #  w2>40YG %ao b;#ڏ#0#n F#" # 7    b #  9    #  #  # bit ~#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H0wq1D#rq2D# 3~#04~#450#86R#< 7#@8~#DLLL<]4!w !x#!ym#!z0#  !{0#'!|0#r!}0#9:!~0#@!0# -!0#$u!#(  )8J K0#* L0#{M#fdN~# @O0#expP0#D6Q#6R#06S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U@}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P 3 #T9 #X_ 1tstru#lenv~#p p 0 v ' p zm#Lm# L#! #feQ#beQ#~# @~#$Z 0#(D#,req0 #0rep0 #4siw$#8 # %#a#srv5#p5#Q 5#> $#txns# ~#"#$#y3°$## w#w#,M$#0#_  - J ]s Tn  #!s # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#$@ P#  Q # R~#$ S~#  T0# U # Vm# * W #B XR#' Y #` Z# [0# b #) c# T Qu m # n~#S o~# p~# q# r#  s~#$ 6 t #(!7 u #, v#0 w#4{ x#8@ y#<h zm#@e {~#H |m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#H#I~#  J#$    J9:~#get~#put~#u~# )#U5$8len$90#cr$:0#$;0#b $Cv$D#9:$Ew#$Fw#2*$Gw#4$Hw# #    D #¬S#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#SmD#P #0#col#0#sov#0#eoh#0# sol##eol##som#0# #~#sl##  #W#8cap#m#@#t4##b#U# #6 #req##rsp##\uri## ####FJ#~#@#0#d) D##~#P# m#:X a^#_%#k`%#aue+,#-#.~#/#  2P #D#>>d2JW(tD # F#OF# ~# h~#r~#~#a#B: #,aclm#0m#8m#@m#H>m#P?X #Xsrv5#de ~#h? ~#lh !#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~# #G #R~#7~#m."##/~#m#'"#id#+#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#F#zF# F# F# # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# pa# ^@a# ~# o# Q# m # u # Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !# "# #~# Z#~# $"# ]%"# &o# 'o# O(o# q)"# )"# *~# w +# ,~# -"# = .~# /~# 00# 10# F2# :2#H7G &0#f 0#0#p7 $@4un5J in6a)p2u7# 8!o;  m#!p #srv"5# 5 A"J5# K~#* L~#M~# N~# O#B P#(RQ#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H$@[a#Lp\a#\^@^a#l`~#|oa# b#@d5#d5#e#o fa#wgw#h~#i~#;i~#)$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v;#hw5#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#ox ,#t0#t1#}:;#;#~# D~#$ ~#(: <#len0#pos0# sid0#srv5#oeQ#src#buf9 #X beQ u} !0#.m# srv # ~# ~#5 XactA#bckA#,!actƾ#bckǾ#!~#Q ~# ~#~# ~#~#8 ~# 5#map} # Ķ #,V #T !#8!#\:!#/!#!#!5!z" ~#4~#:~# <~#  A~#+~#\~#!~#m.z"! " " "6 c#D ~#<# <# /<###  #$u&P#(} P#,P#0i#4Qi#<#pxQ#sv5#w#Dw# @0# iid~#J~#sid~## "Θ#M$iid~#pxQ#buf0#sid0# ptr~#bol~#w$ (c# # # $ 8$p $$p $"$G=,~-U#si+Q$$% %P%%R&"%yk~'j~(nowj~)F%v=60ZU#si5R)%5=D`U#siCQ#msgC%S*%%k%%R$%%%R% 6 +%J2(buf~0 )&a=UU#siTS#msgT%Q*&& %&P*)&%N,%*@&&NS,&*z&&`u%&Q%&P$&os%&P,'$'uw,'+&.+(buf0 +&S((buf0 &&^$W~(nowV~''V~&'}#L~(nowK~''K~+)'&(buf0 -[%6'e-J %6'-.vV',-w~ z'. -'Qi'-(;0- )Q0-)R0- )U0- )Vo-)W'D5EM0=y 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz !D!E#!F#9 +-{5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,h#0 0,n#4 .,#8 O,#< ,#@ ,">#D ,#p#F H,$t#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7  ,h ,,h# ,n#B ,#1{  *  3 % #3#4#X#5##6# #7# O #8##9#!#:#N", !"-#" ".#!"/#"0N#  $[ >   _# #   R _#J #t #  wtm,w/x# y#rz#z{# >|#R}#6~#j## #$#(2>40YG o b#_#ۦ#n ܼ#" # ,7 O bO# __ ,  4# _# _# bit#u32"0*+e#key,# n #p #7" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D7g]4w x$#y#z0#  {0#'|0#r}0#9:~0#@0# -0#$ug#( w E )8%J %K0#* %L0#{%M#fd%N# @%O0#exp%P0#D6%QW #6%RW #06%SW # 6%TW #$ib%U #(ob%U #,x %V0#0%W#4Q Q wE  # %U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D< Q #L Q #P  #T #X]  1 tstr u#len v#     p  z$#L$# $#!$x#fe$e #be$e #$# @$#$Z $0#(D$#,req$ #0rep$ #4si$m"#8 $# %$#$#srv$#p$#Q $#> $}"#txn$[# $#$ #$"#y3$¦"## $w#$w#,$C"#$0#   & #<&!# &"#&# #  ]( Tn  _#!( # 8 kk auid^1#gid_#`&#~ buxa8 !LfdM# N#hO#$@P#  Qr#R#$S# T0#Ux#V# *W#BX#'Y#`Z# [0#bk #)c#r TQum#n#So#p# q_# rT# s#$ 6t#(!7u#,v#0w#4{x#8@y#<hz#@e{#H|#L~ ~  rCfA#bB #\.(?cbC\#{D# E7#evF7# Gl#HT#I#  J#$ l j J9:#get#put#u# 0#r) D###P# #:b a^#_%#k`%#a/e+,#-#.#/# m bP ##C5)8len)90#cr):0#);0#b )Cv)D#9:)Ew#)Fw#2*)Gw#4)Hw# (    D (šA(l(#m_l(#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(A[D(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (߉#sl(#  (W#8cap(N#@(t4(#b(C# ( #req(#rsp(#\uri(# (#(#FJ(#@(0#07G &0#f 0#0# ?  AIJ# K#* L#M# N# O#B P#(Re #S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H$@[#Lp\#\^@^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vk #hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#?e (tDRx# #O# # h#r###B##,acl#0#8#@#H>#P? $#Xsrv#de #h? #lh γ$#pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉##G #R#7#m.&##/##'%#id#+##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# ^@# # o# e # m "# u "# Jp# p# # # #  # # g#  # B # p !# "# ## Z## $&# ]%&# &)# ')# O()# q)&# )&# *# w +# ,# -&# = .# /# 00# 10# F2o## :2o##H 4 ; '' #'! #srv'"# Y!D$ $#$G# $G# /$G#$#$#  $#$u&$P#(} $P#,$P#0$i#4Q$i#<!$px$e #sv$#$w#D$w# @$0# iid$ˉ#J$ˉ#sid$ˉ#! $"$#C"$iid$щ#px$e #buf$0#sid$0# ptr$Չ#bol$։#m"$!($Y!!$!!$! }"w q " "" Q "J"p7!$@4jun5 in6"p2u7"#o#x ,4#t04#t14#}:k #k ## D#$ #(#G#len0#pos0# sid0#srv#oee #src#buf # $bee !u0$ !0#.#c$ srvc$# # #$Xact"#bck"#,$act4#bck4#%#Q # ## ##8 # #map0$# i$#,VȎ$#T ɮ%#8ʮ%#\:ˮ%#/̮%#ͮ%#%%-& #4#:# <#  A#+#\#!#&m.(7(#&)#*#+# ++#7,#@-#-.'#/(# 0&#$-&"! & & & .' 1$1%#kw1&# 1-W'#W'Ne e .'' 1516#kw17'# '& '  '###'( (##G#'O(-SC-O#-P#h-Q# -R# ) -;uid-<#gid-=#->#$-?# ,-@# -A#!-B#a-C#-D# |-E#$ -F#(<-G#,-H#0-I#4+-I#8J-J#<-J#@-K#D-K#H-L#L -L#Pm -M"#Tu -M"#-S(# -T~ #Y-U##,g><U$?:Nl$=: $=:e $';e %err;$ ;&[*!'&>%'>%&+"(su?,P)@S**s'&`%'`%+s'`)`P**'&d%'d%* +'&h%'h%*/+'&s%'s%&F+H")t,P*+A'&\%'\%+A'\)\P,+,I_-,.-I_---#--/-/x")C"i<-P*+'&%'%*,'&%'%&a,"'$.,-,.----#--/-,,, -,.- ---#--/-,,- 6---#--/-/")'0p(resP  0-n1m0<- -1+1x+N1,2z-=*U%msgz-$9:  3.D>q0U4sp 4pxpe  4urip&R5repr d5svs`5svss\5msgt h&."6#*.56(S7len+8&%8%+86P&.#6"E./P#6/$0P&.h#6"./#6/$0P . 3/=MLU4sL V4repL  4uriL&W7pxNe 5msgO h5upP0S,|//=J-/,//-/./ B-/9/,:buf ;/=U:nTP2k05>PU%s V%rep W%uri&8U4s7 S4rep7  =1=U4s W4rep  5msg ,0/EN-/*18\&M1#5pn8= .1-0>1P*g1y7__v>*1"7__v>/#8\;1\>[:tZ=2>U4s 4rep  ?25msg @&&2#5es3~,=2/%(-/&2$8U>6=~.3-&3-23->3-J3>V3~/8$Ab3~An3Q&2x$5pny35tm.3>3~>3P./-/ 3 o#By3z>PCoutNz-19:NCerrO31.OCptrO7endQ7cR7 3 -D3"Cnow!3Ctm!3 <E>UF1*K33 >F*L33 ~F*M3F[+4pFJ +4F.v74FwF -\ h4G FQW4 4GFҍ4 u4?(Oe F.;0Hnow.GF -XO(Hpid-ZFX-[F-^ F/F/F, 0F Q0FR0FSS0FaT0F U0F V)FW}56']'7H7 0?y !07i  "02-y &ik 27 5int 60 >Em ?ER AE3 C D^7ro S UH  0o BT G QqF> >@ 0z #D#E##F#9 +-/5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 O,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7$#T d,8$#X ,:#\ ",<#`5 7@ :$W c $ , ,,# ,#B ,#jc3$[> ##" YR#J#tY#iwy6 7# w8#Tn  #!#k 2> 40YG o b#Z##n #" Z#j7 b#j  r# # # bit#u32"0!*+#key,#FnF#pF#!u" - !#ref!F# H0wq1#rq2# 3#04#450#86#< 7$#@8#D u]4"w "xK#"y!#"z0#  "{0#'"|0#r"}0#9:"~0#@"0# -"0#$u"#( )8$J $K0#* $L0#{$M$#fd$N# @$O0#exp$P0#D6$Q#6$R#06$S# 6$T#$ib$U #(ob$U #,x $V0#0$W$#4   # $U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8) #< 7#@7#AW#D<#L #P  #T #X 1tstru#lenv# $  $ *  p z!#L!# #!>#fe6#be6## @#$Z 0#(D#,req #0rep #4si>!#8 "# %"##srv#p#Q #> N!#txn,# #y#`!#y3w!## Â#Ă#,!#0#    ]1 auid ^<#gid _&# `1#D bux a K ! Lfd M# N#h O#$@ P"#  Q8# R#$ S#  T0# U># V!# * WT#B X#' YZ#` Z$# [0# b1 #) c#8 T Qu m`# n#S o# p# q# r#  s#$ 6 tT#(!7 uT#, v#0 w#4{ x#8@ y#<h z!#@e {#H |!#LK D T Dp 8pCfAT#bB #".(?cbC"#{D$# E7#evF7# G2#H#I#  J#$2 J9:#get#put#u# #8 ) D###P# !#: - a ^$# _%#k `%# a}e+,}#-#.#/:# 8 -P F##  5'8len'90#cr':0#';0#_b 'Cv'D_#9:'E#'F#2*'G#4'H# &    D &e &l&#m_l&#u&#u_l&# v&#v_l&#c&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st& &D&P &0#col&0#sov&0#eoh&0# sol&#eol&#som&0# &ߔ#sl&c#  &W#8cap&&#@&t4&#b&# & #req&#rsp&#\uri&# &#&#FJ&#@&0#7G &0#f 0#0#  AIJ# K#* L#M# N# O#B P#(R6#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X!#@!Y#H$@[#Lp\#\^@^#l`#|oa# b#@d#d#e#o f#wg#h#i#;i#)$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v<#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#6(tDR># #O# # h#r###B-'#,acl!#0!#8!#@!#H>!#P?K'#Xsrv#de #h? #lh '#pK#Z #Ҕ##Ԕ#0#֔#gה#[# ٔ#R ڔ##ܔ#ݔ#ގ#G #R#7#m.s)##/#!#'(#id#+#!#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  G#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# ^@# # o# 6# m &# u &# Jp# p# # # #  # # g#  # B # p !}# "}# ## Z## $)# ]%)# &# '# O(# q))# ))# *# w +# ,# -)# = .# /# 00# 10# F2&# :2&#Hry; %% !#%!$ #srv%"# * D #h# h# /h###  #$u&P#(} P#,P#0i#4Qi#< px6#sv#ɂ#Dɂ# @0# iid˔#J˔#sid˔# "L#!iidє#px6#buf0#sid0# ptrՔ#bol֔#>!!(* !ϡ !׸ N!B `! $ T! w! $ f!!%)dow)#h1)#m1)#h2) #m2)#"")min)i#max)i#%)˔#w%)̔#G")$@)#O)#z")i)Ȕ!`)!!%)""!%)}!")ptr)$str)reg)פ"- #%,))!#val)G"#ptr)z"#%)Q# len)ڔ#$@)۔#(B# )p)$i)ll)id)B#a)I#JY#$#[%0)i)#ptr)#len)#@)# ctx) ##$%)kw):# )1$# %)$# yC)$# )0# &) #+$ E +$ Z"$`$ 6 $ $ `$ $f$$C) )!!#kw)"5%#arg)%%# @&)&# %)'!#Y#7$$ $ +$$%H&) )!#kw)%#%# "5%)%#str)$#$%acl)* )+!# u),# 2D)-!# ).# )/0#;%%XD)> )?!# g)@!#pol)A# )B0# .)C#&p7!$@4un5in64&p2u7%#&x ,r#t0r#t1r#}:<#<## D#$ #(-'h#len0#pos0# sid0#srv#oe6#src"#buf #K'be6!up' !0#.!#' srv'# # #'Xact4&#bck4&#,'actr#bckr#(#Q # ## ##8 # #mapp'# ĩ'#,V'#T (#8(#\:(#/(#(# ( (m) #4#:# <#  A#+#\#!#m.m)! y)) ) %) 1$1%#kw1&:# 1- *# * & 6 6 )8* 1516!#kw178*#G*) */SC/O#/P#h/Q# /R# , /;uid/<#gid/=#/>#$/?# ,/@# /A#!/B#a/C#/D# |/E#$ /F#(</G#,/H#0/I#4+/I#8J/J#</J#@/K#D/K#H/L#L /L#Pm /M&#Tu /M&#/SG*# /TD #Y/U#=,?($(%!#E(&)#('# f,[@ =? >#? ?R#%,? F! G]!$@ H=,!@ I],? Bop D]#v Jf,#&.#?n U'fdmV(@mS(s?m.(m$m.)@oX))@pW*retqP)9@t4+-Fb,__s~$-~!~0!~>! ~7,__u~.,__c~w-v)Q@,H)V@,.$*__s$R-!0!>! 7,__u#.,__cw[--&.>U(!>V( ( /@w/O?*fdS*errd*msg:`0. 1.2."T3fdS4/`?(4U5 '8R6!)>S7err*V8F/>:@U5!9>Q8m/?HU5!G>Q9r0?g\U:sf$ V:reqf W6Jhr0S6>ip;/x0&=<0R<0Q=/$7retR;0010;(00<0P;?00#%1000;C101000;C< 1P11,>0yk?j3nowj20.+3buf 20)3buf >0^$W3nowV?'V>"1}#L3nowK?'K43?`U5?&5= 5=65'6:err5 7ptr:l7val0p6j@Q+1@&%@%+2@&%@%=93$6h64@d7polQ6E)S@Jr0+2@&%@%+2@&%@%=2%@&%@%.%@/6P+3.@@&%@%-x7acl%P6u:Q;P33CU14;g3314;~33O^14;33}14;33<4P;3314;338J140314> 43:?(264~4>2U:px06:l40$ P:l70$:dir052D1`$5_%1$R45>FU:pxD6:l4D$ P:l7D$:dirD52DE`$5_%E$6Gp6K@GV6y?GR6H/S/ @/?.0%6fQ6:fl6?fh65?fd6?f`A;?UB*L55 B*M5B[+5BJ +5B.v5Bw6CB-Q 6D(O6B.;0Enow.;K )?MK 6'*P6%$T5LQ$ 0CAy $07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez 'D'E#'F#  n # p #e" - e# ref !#R]4&w &xR#&ye#&z0#  &{0#'&|0#r&}0#9:&~0#@&0# -&0#$u&X#( h ! %%#u%#Z%># len% ># \%!>#F%"#h2L40YG o b#$[L[ '#[# k R'#J#t#  w'##n #" # E 0Tn! ! '#!!0# @ k hp 7 $@ 42un 5in 6p 2 u 7@# b#   ### bit>#u32 "08 * +# key ,# H 0 wq 1# rq 2# 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#`#  buxa!L fdM># N>#hO>#$@Pk#  Q #R>#$S># T0#U#Ve# *W%#BX#'Y+#`Z# [0#b#)c#  TQum1#n>#So>#p># q'# r# s>#$ 6t%#(!7u%#,vQ#0wQ#4{xQ#8@yQ#<hze#@e{>#H|e#L%>>> A Q> A,SC,O>#,P>#h,Q># ,R>#  ,; uid,<># gid,=>#,>>#$,?># ,,@># ,A>#!,B>#a,C>#,D># |,E>#$ ,F>#(<,G#,,H#0,I#4+,I#8J,J>#<,J>#@,K>#D,K>#H,L>#L ,L>#Pm ,Mh#Tu ,Mh#,SW# ,T#Y,U># )8(J (K0#* (L0#{(M# fd(N># @(O0# exp(P0#D6(Q #6(R #06(S # 6(T #$ ib(UE #( ob(UE #,x (V0#0(W#4    E # (U@ }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) <#< E#@ E#A e#D< #L #P  #T #X t 1 t str u# len v>#  E  <p  z e#L e# #! # fe # be # ># @ >#$Z 0#(D #, req E #0 rep E #4 si &#8 k# % k# # srv !#p !#Q !#> '# txn # ># 4%# '#y3 2'## Å# ą#, &# 0#t   ) >#<)!># )">#)## B ]5+8len+90#cr+:0#+;0#.b +C v+D.#9:+E#+F#2*+G#4+H# y*    D *4* l*># m_l*># u*># u_l*># v*># v_l*>#2* l*># v_l*># c*># c_l*># r*># r_l*># O*rq*st*D*P *0# col*0# sov*0# eoh*0# sol*# eol*# som*0# *># sl*2#  *e#8 cap*#@*t4*y#b*# *K # req*O# rsp*O#\ uri*# *#*#FJ*>#@*0#) D##>#^# e#:+D##^ #a#^##_%#k#`%##a+e"+",#"-#".>#"/# i^P ##9 -- 5 --@.>#!. #. #b . #  .#.#A.# .#z.# .#$.#(+ .#,M.#00.#4..>#8O.>#<.#@."L#D .#~#FH.$#Gb.(#H.1#L.7#Td.8#X.:>#\".<#`. ..# .#B .>#     3/C fA%# bBE #.(? cbC#{D# EE# evFE# G#H#I>#  J#$  2 J9:># get># put>#u># #J&(tD# #O# ># h>#r>#>##B"#, acle#0e#8e#@e#H>e#P?"#X srv!#de >#h? >#lh Ύ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#޿#G #R>#7>#m.%##/>#e#'$# id#+#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z#### >#8#>#0#j0#  1# w# w# w# w#  w# w#) w#w#Qw#>#cap>#p#^@#>#o# #m h#u h#J~#~#>#>#># ># >#g># >#B >#p !#"##>#Z#>#$#]%#&# '#O(#q)%# )%#*>#w +#,>#-$%#= .>#/># 00# 10#F2J"#:2J"#H7G &0#f 0#0#  ;  e#! # srv"!# ! A"J!# K>#* L>#M># N># O#B P#(R #S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H$@[#Lp\#\^@^#l`>#|oa# b#@d!#d!#e#o f#wg#h>#i>#;i>#)$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v!#hw!#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#J"x ,# t0# t1#}:!#!#># D>#$ >#("<# len0# pos0# sid0# srv!# oe # srck# buf# "be  u # !0#.e#>#  srv>## ># >#!i#X act!# bck!#,# actƉ# bcklj#}$>#Q ># >#># >#>#8 ># !# map ## D##,Vi##T ɉ$#8ʉ$#\:ˉ$#/̉$#͉$#$!}$% >#4>#:># <>#  A>#+>#\>#!>#!m.% $% 4%K %D  ># <# <# / <# 7# 7#  7#$u& ^#(} ^#, ^#0 w#4Q w#<\& px # sv !# Ʌ#D Ʌ# @ 0# iid >#J ># sid >#s& " ΐ#& iid ># px # buf 0# sid 0# ptr ># bol ># & ( %  \& s& ' ' '2'  !'"m'A U# V#!!S$;(@/DU%s. V&txn0;(p&fe1 l'"2A(R'*2A(S('G()X(*a(P+'&h^S,(H%-\l,%(`%-\r.3&hXS/k(9F>0sFk(0pFv(q(|(&1A>PU$(@r U%s V'rAeQR2>)@>  U%s V%si S&reqE P&repE Q3>)  )P))\)4x%5h)P6u)J^7tv1Iu)7tv2Iu)8retK^{)<2 *0A>  U%s S%si W() *5 : **P))*()G(  *X(V*a(P3G(  *X(V*a(P/5*}#L>0nowK>9'K>"*!AC U:sB V:siB W;reqDE p;repEE S(**2 M )*)*3*  )*)*<*-0bufE 99:>"r,@l U:sk V:sik S(6+>)o)P))\)4%5h)P(_+>)*B)P))\)4%5h)P,+%=9w>P3r,/),3,*,Q),(+>))P))\)4%5h)P(+r,F),3,MY*,Q),(,G(*X(W*a(P(G,>)")P))\)4&5h)P(^,,}),3,),<,/(0s'!<,%10ctr0,0inc00<,0&"0ctr!,",@UU:s Q>1)9` $U:t8;s: V='*;>p=W*<0l=.*<0h?)?)?C(',-0&@@031)1,-p&=@0R31 )1(-1cn)2(:.2Q) 2)*2(.2* 2R**2W327* 2R**2W(X.2^q) 2**2S(t.2) 2)*2(.2) 2)*2(.1?K)2(.52b)B2*M2W4&5X2R(.52)B2*M2W4&5X2R(@/d2)r2)|23>)Ph*P)W)\)4&5h)P(W/2)2(n/2)2(/2 )2+/>b@@0(/2)2(/2)2(/G(*X(S*a(P(02)2($02*2P*2Q(D02*2P*2Q(d02 *2P*2Q(02  )2(02 7 *2P*2W(02< S *2P*2W32_ z *2P*2W,0';len1>P(1>)!8!)P))\).!8!5h)P(F12!!) 333!!)%3(p1/3!!)@33J3!!)W3(1i3!!)z333!!)33J3!!*W3P(13!")3."K#8len><1&0bufE <27*u0buftE /52M#u>0t1t>0t2t>9j>0nowj>/3"0t//3 ~0t}/J3 v0tuP;err>S;fin>RBZ %%B ,XB y>B,^BB[-`4BJ -`4B.v4/Bw> 4C B/Q4B;0Dnow<<B $B0#Ej (`? E, )eX? B1>B Q0BR0B U0B VBWc3=1P)%$0]Ayd58len9d#cr:d#;d#7b CvD#9:E#F#2*G#4H# % 3QA3$%U len3 cr3 :W 13 e%V new3Q intk&Q* %0Ay7i "%2-y&^kint6%>:m?:RA:3CDS7roS UH % 9z DE#F#J7 [JG[# k9 AJDoBTGQ[ 3   # #   R #J z#t # " w( 234%Y-G 8to bN#ڗ#C#n Y#" # , 9 -g5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .s#8 Os#< #@ "3#D #e#F H$#G b(#H 1#L 7#T d8#X :s#\ "<#` # #B s#t  m  3 b#  `  # # # bits#u32"%*+#key,`#n#p#: H0wq1k#rq2k# 3s#04s#45%#86P#< 7#@8s#DJJJ:]4w xg#y#z%#  {%#'|%#r}%#9:~%#@%# -%#$u#(  )8J K%#* L%#{M#fdNs# @O%#expP%#D6Q#6R#06S# 6T#$ibU. #(obU. #,x V%#0W#4. # U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) Q #< ,#@ ,#A L#D< #L #P  ] #T c #XE E . K p 4  W t ] Tn  #! # k auid^#gid_v#`# buxa  !LfdMs# Ns#hOs#$@P#  Q #Rs#$Ss# T%#U #V# *W #BXP#'Y #`Z# [%#b #)c# TQum #ns#Sos#ps# q# r# ss#$ 6t #(!7u #,v/ #0w/ #4{x/ #8@y/ #<hz#@e{s#H|#L   ss s  / s  V CfA #bB. # .(?cbC #{D# E,#evF,# G #H#Is#  J #$ 5    C<_``#Aa #setb #clrc # NBd #Ae #remf #clog #6h# }:i1#$OCjC#(_%k1#,Hl1#0um"#4ns#8 s s s    s 1s!C7qp7$@4un5t in6tp2u7I# SCOs#Ps#hQs# Rs# I ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm Mq#Tu Mq#S# T #YUs#A's %D%Ufd& Rdir&sQ&%?% (PA,sP%p%Ufd+ Pdir+sRA2sp%%Ufd1 Pdir1sRTIB8s%%Ufd7 Rdir7sP!ret9sP%% :PAAs%&Ufd@ Pdir@sR!retBsP"' CP#AJ&$&UfdIsP#xAS0&(UpRexpRsR FJTsS!fdUsW!iUsQ Vh AWsd =BXsV AXsS!fdsYs` Z_$'' P$'' P%(&(&&'&(((&&(yks)js*nowjs(+U's*nows*exps Bs()UpV+BZ)+Ak)+B|)+AÍ) kAsS#A))UpSAs))Up#'B**U!pR,[,J ,brs 2 ,}t",.vLV ,ws p- , Q_,;%, X,s, Q%,R%, U%, VV,Wk  k B  4B &1S1,*0ByintCBC#SZS72]B,_B0a !Ղ7i "-y&k6>m?RA3CD roS UH   S _ %qF p oBTGQz #D#E##F*#24YG o b#$@[E #E#US R#J#t#Sw##n #" #S9 -5 -@%#! # #b  #  ##A# #z# #$#(+ #,M#00#4.%#8O%#<#@"#D ##FH$#Gb(#H15#L7K#Td8K#X:%#\"<#` K # #B %#  S S3( b(#88S   #8#8# bit%#u32"*+>#key,# n #p # " - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @]4"w "x#"y#"z#  "{#'"|#r"}#9:"~#@"# -"#$u"@#(PS )8 J K#* L#{ MK#fd N%# @ O#exp P#D6 Q0#6 R0#06 S0# 6 T0#$ib U #(ob U #,x V#0 WK#4 * * P  #  U@ }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0 #4H %#8) v #< #@ #A #D< *#L *#P  #T #X 6 1 tstr u#len v%#    v p  z #L # #! #fe o#be o# %# @ %#$Z #(D #,req  #0rep  #4si w!#8 U# % U# #srv #p #Q #> !#txn e# %# # !#y3 °!## # #, M!# ق#    |  S] Tn  #! # Sk auid^#gid_u#`# buxa  !LfdM%# N%#hO%#$@PU#  Q #R%#$S%# T#U#V# *W(#BX#'Y.#`ZK# [#b #)c#  TQum4#n%#So%#p%# q# r# s%#$ 6t(#(!7u(#,vT#0wT#4{xT#8@yT#<hz#@e{%#H|#L   (% %  %DST%  D{CfA(#bB #.(?cbC#{DK# E#evF# G#H#I%#  J_#$ZS _ J9:%#get%#put%#u%# :#  B %#BM#p7$@4un5 in6p2u7#") D##%#Z# #: f a ^K# _w#k `w# a3e+,#-#.%#/j# q  fP ##   " G5&8len&9#cr&:#&;#b &Cv&D#9:&E#&F#2*&G#4&H# %           D %žE%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%E_D%P %ق#col%ڂ#sov%ڂ#eoh%ۂ# sol%#eol%#som%ނ# %%#sl%#  %#8cap%_#@ %t4%#b%G# % #req%#rsp%#\uri%# %#%#FJ%%#@%#:7G &#f ##I!S AIJ# K%#* L%#M%# N%# O#B P#(Ro#S%# T%#$5 T%#($U#,6U#0tV%#44 V%#8'W%#<X#@!Y#H$@[#Lp\#\^@^#l`%#|oa# b_#@d#d#e#o f#wg#h%#i%#;i%#)$j%# j%#Rj%#k%#l%#Fm%#ido#p#b p#q#r#us#?t#Vt#gu# vu#hw#y#y#jz# {_#}#}#~#~##.# ## ##Q#U%# Io(tDR# #O# %# h%#r%#%##B"#,acl#0#8#@#H>#P?"#Xsrv#de %#h? %#lh |##pK#Z #%##%#Ղ#%#g%#[# %#R %##%#%##G #R%#7%#m.$##/%##'}$#id#+##t%#4 %#%##i### ##+# ### #$##`##z#### %#8#%##j#  _# # # # #  # #) ##Q#%#cap%#p#^@#%#o#o#m #u #J##%#%#%# %# %#g%# %#B %#p !#"##%#Z#%#$%#]%%#&-# '-#O(-#q)%# )%#*%#w +#,%#-%#= .%#/%# 0# 1#F28"#:28"#H   ; $$ #$! #srv$"# c D  %# # # / # # #  #$u& Z#(} Z#, Z#0 #4Q #<  px o#sv # #D # @ ʂ# iid %#J %#sid %# " #M! iid %#px o#buf ӂ#sid Ԃ# ptr %#bol %#w! ( c   !PS { ! ! ! * !J8"x , #t0 #t1 #}:u#u#%# D%#$ %#("#len#pos# sid#srv#oeo#srcU#buf #"beou" !#.#,# srv,## %# %# W#Xact½!#bcký!#,|#act #bck #k$%#Q %# %#%# %#%#8 %# #map"# 2##,VW##T w$#8w$#\:w$#/w$#w$# w$  k$$ %#4%#:%# <%#  A%#+%#\%#!%#m. $!  %%S .% S"s%B **U#]%**$__s"K%**$__s#K&%B(*+U'sig'%S&%BB++U'sigA%P(BAMR"&hB],,U)sig^%R*B^%V*+_&P*UB`l~ e+[*& +J *&+L*&+.vW& {+w%{&,S+'Qj&-%C &eS-B&C &%S-B&? -BlK <uU0B,0eCy 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 09 %-&5 %-@&#!& #& #b & #  &#&#A&# &#z&# &#$&#(+ &#,M&+#00&1#4.&#8O&#<&#@&">#D &#p#FH&$7#Gb&(G#H&1#L&7#Td&8#X&:#\"&<M#` 7    &+ & &+#  &1# B &#&G]3 n #p #]"  - ]#ref !#qFo BT G Qz D E# F#2>40YG Mo  b'#$[>  X# #  RX# J# t#w( X# # n 2# " (#87 [  b [#kk8   @# k# k# bit #u32 "0 *  +q#key ,#j H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7#@  8#Dzz zj]4w x# y]# z0# {0# '|0# r}0# 9:~0# @0# -0#$ u#(/ )8J K0# * L0# {M#fdN# @O0#expP0# D6Q# 6R# 06S# 6T#$ibU^ #(obU^ #, x V0#0 W#4  /^ # U @}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H#8 )U #< 7#@ 7#A W#D < #L  #P a #T g #X 1tstru#lenv#  ^  U p z ]# L]# z# ! #fe%#be%# # @#$ Z 0#( D#,req^ #0rep^ #4si-!#8 # %# #srv# p# Q # > =!#txnR# # h# O!# y3f!# # w# w# ,!# 0#  [ x ] Tn  X# ! # k auid^#gid_# `# buxa  !LfdM# N# hO# $@P# Q # R# $S# T0# U # V]# *W# BX# 'Y # `Z# [0# b # )c# TQ um# n# So# p# qX# rM# s#$ 6t#( !7u#, v3#0 w3#4 {x3#8 @y3#< hz]#@ e{#H |]#L    #3 #ZCfA#bB^ #.(?cbC# {D# E7#evF7# G# HM# I# J>#$9c> J 9:#get#put# u# #)  D# # # P# ]#:D a ^# _%# k`%#a+e+ ,+# -1# .# /# 7 eP # w# q qe7G  &0# f 0# 0#p7$@4cun5x in6p2u7#45"8len"90#cr":0#";0#b "Cv"D# 9:"Ew# "Fw# 2*"Gw# 4"Hw# !           D !‹2!l!#m_l!#u!#u_l!# v!#v_l!#!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!2LD! P !0#col!0#sov!0#eoh!0# sol!#eol!#som!0#  !߉#sl!# !W#8cap!L#@! t4!# b!4# !d #req!#rsp!#\uri!# !# !# FJ!# @!0#! AI J# K# * L# M# N# O# B P# (R%# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X]#@ !Yz#H $@[#L p\#\ ^@^#l `#| oa# b># @d# d# e# o f# wgw# h# i# ;i# )$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v+# hw# yi# yi# jz0# {# }i# }i# ~i# ~i# i# .}# 0# i# i# i# Qi# U#%(tDR  # 2# O2# # h# r# # # Be"#,acl]#0 ]#8 ]#@ ]#H >]#P ?"#Xsrv#d e #h ? #l h +##p K# Z # ҉# # ԉ# 0# ։# g׉# [# ى# R ډ# # ܉# ݉# <# G # R# 7# m.$# # /# ]# ',$#id# +# ]# t# 4 # # 0# i0# 0# 0# }# 0# +}# 0# i# i# i# $0# 0# `0# 2# z2#2#2## #8##0#j0#  # i# i# i# i#  i# i#) i#i#Qi##cap#p#^@##o#%#m #u #Jp#p#### # #g# #B #p !+#"+###Z##$$#]%$#&# '#O(#q)$# )$#*#w +#,#-$#= .#/# 00# 10#F2!#:2!#H@h;    ]#  ! #srv "#  D # # # /# # #  #$ u&P#( } P#, P#0 i#4 Qi#< px%#sv# w# Dw# @0# iidˉ# Jˉ#sidˉ#  "Έ#!iidщ#px%#buf0#sid0# ptrՉ#bol։#-!( ϐ ק =!/1 O! C! f! U!!x , @#t0@#t1@# }:+# +# # D#$ #(e" #len0#pos0# sid0#srv#oe%#src#bufg #"be%u"  !0# .]#" srv"# # ##Xactl!#bckl!#,+#act@#bck@#$ # Q # # # # # 8 # #map"# "#, V## T &$# 8&$# \:&$# /&$# &$# &$ $$  # 4# :# <# A# +# \# !#m.$! $$ $d 6%XD7#?]#g#@]#pol#A##B0#.#C#$%%#dow##h1##m1##h2# #m2##%#min#i#max#i#%#ˉ#w%#̉#&# $@#2# O#2#9&#i#ȉ`#͚%%#%%#<%c&#ptr#str#reg#c&&%,# #]#val#&#ptr#9&# %## len#ډ#$ @#ۉ#(' #p#i#ll#id#'a#'J'i'[%0#i##ptr##len## @## ctx#&#'%#kw## #'#%#(#yC#(# #0#&# #'  ' i&'( %  ( }(%(}(C##!]#kw#"(#arg#%(# @&#&#%#']#''( }( '((H&##]#kw#(#(i'!"(#%#str#$i'$S)acl#*#+]#u#,#2D#-]#  #.##/0#)E#3#4]#acl#5)#neg#6# ()nD#9#:]#oC#;]#%))u'#2D()#)&c*E<,,U'px:%'l4:  'l7:'dir:(2D;((_%;}(P&*]FG,,U'pxE%'l4E  'l7E'dirE(2DF((_%F}(P&9+CT,-U'pxR%'l4R  'l7R'dirR(2DS((_%S}(P)+E`--U( _(GF_' (1_ )+'Cg -*-U'pxe%'l4e  'l7e'dire(2Df((_%f}()$,Dm0-7-U(_%l}((GFl' )e,pFt@--U(_%s}(S(GFs'Q*3u),D-b.U(_%}(V(GF'P+DS,ret-.b.+DS) -Fp..U(_%}(S(GF'Q*3)L-D.5/U(_%}(P(GF'V*3)-D@/0U(_%}(S(GF' *3ɉ.endW.cS/-0'+*ԉR-//**ԉ&.F0\1U(_%}(W(GF'R(+s+uCl+3h.cW.endd.psV.plS/w.H'0* 1`'2* P3.C`1v1U4_%}(P4GF'R3.7D(11U4_%'}(P4GF''R39/OF.1 2U4_%-}(4GF-' 3~/aD6292U4_%5}(R4GF5'Q5s7~/R23/DD@2}2U4 CS4GFC'W41C 6lenE7/EDP22U8ptrP3c0CW22U4 VP4GFV'V41V 2Xc&S23YP3S2Ew345U4 vV4GFv' 41v 5ixiVW5jy0Q22*y0p29 y0l5ptrzS9>1I3`30&~%0~%-I3`30~2~P91d330&%0%-d3302P/1x'0&%0%1'02P/ 2'0&%0%1'02P-330&%0%-3302P3?4D@5n8U4 V4GF' 41 5iih5j0V22*0d29 0`5ptrW9*3550&%0%-5502P9t3550&%0%-5502P/3'0&%0%1'02P/3(0&%0%1 (02P-6660&%0%-66602P349C!p88U4  P4GF 'P41  :49E-88U8kwl,4P(:4E588U8kwl44P18(0\63V5TC>)8 9U4u=W4b=V5acl?)S-890&A%0A%35-EK( 99U8kwJ0\L2DMP5kwlN4W75BF_9:U8pat^'S;$6/Fs( ::U42Dr(W<$6+:@:=26-.:@:>>6P>J6V?W6Cl@bk6patm'6tmpm'387D(:=<U4?VAD:A)D<A>F;22D(\2C(X2GF'S21`2CW5argT/7P(6end0E-;;5retR37C)@<<U8acl)22D(S2!C(V-r<}<0\38E)<=U4?V4fEWAD V=ACC=AE7=2'F)R2C(S2uV38ED)=>U4}DCW4fEC ADl>ACi>AEg>2'FF)R2CG(S2uHV2\IV-=>0&L%0L%3:9RDr6%>H?U4Eq6%2`Es:9W2Es:9p2OCt@9P2~Ft@9S)S)3_:pE6%P?@U4?4fE 8polPAD@AWE@AFC@5arg`5negW2FV2'F)\2 D@9S2E:9X2E6%T-@@0&%0%-@@02P3o;EABU4E6%P8px% 8l4 8l78dirAE8oA2`E:92OC@922D(S5acl)P2GF'W2_%'2OE2F2C-bAoA6__s 3;Ca)BBU4E`6%P4C`0V2`Eb:9S2OCc@9R5acld)PBCBBUC1$K;; >C$L << ~C$M <C[%/<CJ %/<C.vO<ZCws<DC'Qb<<< 0EB<~ <+C/(<< )FD)<| <2%v(8',YFB0Fy 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez  D E# F# n# p#e" - e# ref!#R]4w xR#ye#z0#  {0#'|0#r}0#9:~0#@0# -0#$uX#( h n 2L40YsG ~o b#$[L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 -C5 - @># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 O>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#` # #B >#J  C  3   b #  6    #  #  # bit >#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj)8J K0#* L0#{M# fdN># @O0# expP0#D6Q#6R#06S# 6T#$ ibU0 #( obU0 #,x V0#0W#40 # U@ }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) ' #< E#@ E#A e#D< #L #P  3 #T 9 #X_ 1 t str u# len v>#p p 0 v ' p  z e#L e# #! # fe # be # ># @ >#$Z 0#(D #, req 0 #0 rep 0 #4 si #8 # % # P# srv #p #Q #> !# txn # ># :# !!#y3 8!## Å# ą#, # 0#_  - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#$@P #  Q #R>#$S># T0#U #Ve# *W #BX#'Y #`Z# [0#b #)c# TQum #n>#So>#p># q# r# s>#$ 6t #(!7u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    J9:># get># put>#u># #>p7$@4un5J in6PWp2 u7#) D##>#^# e#:W a^#_%#k`%#a>e+,>#-D#.>#/h# J xP ##x5#8len#90#cr#:0##;0# b #C v#D #9:#E##F#2*#G#4#H# k"           D "&" l"># m_l"># u"># u_l"># v"># v_l">#$" l"># v_l"># c"># c_l"># r"># r_l">#A"rq"vst"D"P "0# col"0# sov"0# eoh"0# sol"# eol"# som"0# "># sl"$#  "e#8 cap"#@"t4"k#b"# "6 # req"A# rsp"A#\ uri"# "#"#FJ">#@"0#7G &0#f 0#0# s! AIJ# K>#* L>#M># N># O#B P#(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H$@[P#Lp\P#\^@^P#l`>#|oa# b#@d#d#e#o fP#wg#h>#i>#;i>#)$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hw#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#(tDR # #O# ># h>#r>#>#P#B>"#, acle#0e#8e#@e#H>e#P?\"#X srv#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#O#G #R>#7>#m.$##/>#e#'$# id#+#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pP# ^@P# ># o# # m ># u ># J~# ~# ># ># >#  ># ># g>#  ># B ># p !># "># #># Z#># $$# ]%$# &# '# O(# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H:; !! e#!!p # srv!"# D  ># <# <# / <# 7# 7#  7#$u& ^#(} ^#, ^#0 w#4Q w#<b  px # sv ȗ# Ʌ#D Ʌ# @ 0# iid >#J ># sid >#y " ΐ#  iid ># px # buf 0# sid 0# ptr ># bol >#  (  b  y ! !!p !8!p '!J!x ,# t0# t1#}:##># D>#$ >#(>"<# len0# pos0# sid0# srv# oe# src # buf9 #\"beu" !0#.e#"  srv"# ># >#"X actE!# bckE!#,# actƻ# bckǻ##>#Q ># >#># >#>#8 ># # map"# ĺ"#,V"#T ##8##\:##/######~$ >#4>#:># <>#  A>#+>#\>#!>#m.~$! $ $ $6 "-%FBCU#u#9:0V#@0$FS$IR$V+W%O 0&%FC4DU$F> $IS'outC(h($o0R$V"%FU@DDU#FTS)retVP*&FjDDU#FiV$o0kP$kS"<&FD1EU#FS((%\*&F@EFU$IS$ ^V$^W$F>p+[&+J &+L&+.v&,+w> &, +$Q&$Fei[FF0Gy7i 2-y&Skint3CzDH7roSz UzH %z  D E# F# $[ 36   # 6# F 9 -Q5 - @h# ! #  # b  # # # A# # z# #$ #( + #, M"#0 0(#4 .h#8 Oh#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3")8J K%#* L%#{M# fdNh# @O%# expP%#D6Q4#6R4#06S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U@ }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    7G &%#f %#%#<2G %FOFUctr<R!%V-G!%Qage"%PB3@%9 -w5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Os#<z#@"3#D #Z#FH$#Gb(#H1#L7#Td8#X:s#\"<#`   #  # B s#~  w  3 $[ 3&   # &# 6 4%G 6go  bA#5)8 J K%# * L%# { M# fd Ns# @ O%# exp P%# D6 QG# 6 RG# 06 SG# 6 TG#$ ib U#( ob U#, x V%#0  W#4AAg5#  U @ }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#,  %#0 %#4 H s#8 ) #< ,#@  ,#A A#D < A#L A#P  #T #XMp   ]ss C f A# b B#.( ? cb C# { D# E,# ev F,# G#  H#  Is# J#$   [@= ?>L# ??#?FG$@H@I-? B opD# vJ#oH"sMMUQ@#Xfd$sSret$sV*__s&W&&%&3 &,__u&__c&a[J . v ws  Q!bqRM0Hy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % 0H"fd#s# I$l# H%l#J7 RJ GR# b0 AJ;oBTGQ[ 3   # #    R # J z# t #  w 234%Y$G /ko  bE# ڎ# :# n P# " # , 9 -^5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Os#<#@"3#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`  #  # B s#k  d  3 b#  W ### bits#u32"%* + #key,W#n#p#1 H0wq1b#rq2b# 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1]4w x^# y# z%# {%# '|%# r}%# 9:~%# @%# -%#$ u#(  )8J K%# * L%# {M#fdNs# @O%#expP%# D6Q# 6R# 06S# 6T#$ibU% #(obU% #, x V%#0 W#4% # U @}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )H #< ,#@ ,#A L#D <#L #P T #T Z #X< < % B p +  N k ] Tn  # ! # k auid^#gid_m# `x# buxa  !LfdMs# Ns# hOs# $@P# Q # Rs# $Ss# T%# U # V# *W # BXG# 'Y # `Z# [%# b # )c# TQ um # ns# Sos# ps# q# r# ss#$ 6t #( !7u #, v& #0 w& #4 {x& #8 @y& #< hz#@ e{s#H |#L   ss s  & s  M CfA #bB% # .(?cbC # {D# E,#evF,# G # H# Is# J #$ ,    C<_ ``# Aa #setb #clrc # NBd # Ae #remf #clog # 6h# }:i(#$ OCj:#( _%k(#, Hl(#0 um#4 ns#8 s s s      s  (s : .hp7$@4un5k in6kp2u7@# S COs# Ps# hQs# Rs# @ ;uids# $?s# ,@s#  As# !Bs# aCs# Ds# |Es#$ Fs#( <G#, H#0 I#4 +I#8 JJs#< Js#@ Ks#D Ks#H Ls#L  Ls#P m Mh#T u Mh# S# T # YUs#A*sMMUfd) Rdir)sQMM +PA/sMMUfd. Pdir.sRA5sMNUfd4 Pdir4sRKIB;sNENUfd: Rdir:sP!ret:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Os#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#9:~%#@%# -%#$u~#(  \)8 J K%#* L%#{ M#fd Ns# @ O%#exp P%#D6 Qn#6 Rn#06 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#$@P_#  Qv #Rs#$Ss# T%#U| #V## *W #BX#'Y #`Z# [%#bo #)c#v TQum #ns#Sos#ps# q# r# ss#$ 6t #(!7u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a C<_``#Aa{ #setb{ #clrc{ # NBd{ #Ae{ #remf #clog #6h # }:i #$OCj #(_%k #,Hl #0um#4ns#8v sv s sa  v    s   s     p7$@4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7I8#>#cfI*5+%#fd,%#H"sRRU 9:"sS!*"SAUsRRU"fdTv Q"dirTs #f4IgSSU$ofsh!NIisQ!5jsS!jsR%chgksp%fdksW&fSS'wS(('V)SS*S+mI#s,I#s-op#s-fd#s, I#.*# /HS/TU"fdv Q UIsS%ptrR5SAs0TTU"fdv p"dirs %ofsV!IS!UIRAsTTU"fdv p"dirs %ofsV!IS!UIR/AT>UU"fdsW%ofsļS/EI@UUU"fdsV%ptrP/xAUoWU"p "expsS.FJs%fdsd! sp!Hsl0U V'S'Q( ()U V* W0,8WBW(=(H&TQWSW(e(p+,H$s,I$s,I$,I$s,'$s.*$+Tyks,js-nowjs+|U's-nows-exps1 BspWXU2p V3I35X3wI5FX3)I7WX3H9hX3I<X4kAsS5AFX !]I?s %evD   #s !Ic36g!d`Z0Iy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Os#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#9:~%#@%# -%#$u~#(  \)8 J K%#* L%#{ M#fd Ns# @ O%#exp P%#D6 Qn#6 Rn#06 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#$@P_#  Qv #Rs#$Ss# T%#U| #V## *W #BX#'Y #`Z# [%#bo #)c#v TQum #ns#Sos#ps# q# r# ss#$ 6t #(!7u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a C<_``#Aa{ #setb{ #clrc{ # NBd{ #Ae{ #remf #clog #6h # }:i #$OCj #(_%k #,Hl #0um#4ns#8v sv s sa  v    s   s     p7$@4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4+I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7I8#>#aCJe%#s1%#HEs`ZZU9:EsS *ES!IZZU"fdv S!MJZ0[U"fdsS#pos%V*As0[b[U"fdv P"dirsQ#retsPuAsp[[U"fdv S"dirs $`J[#i%P%As[S\U&fdv S&dirs '`J)\(i%R)A&`\|\U&fd%sS)EI0\\U&fd/sS)xA9\-bU&p8 &exp8sp*6J:%$ *I;%( *FJ<sl(eo<sh(fd=sP*NI=sQ* >sd*J?s`*H@sW*.JAs\'I(\+X**;+OsW,:.^b^-S-Q../:^b^0X+Px*(esQ,x[`a`-"S.-.7.A1g``0LS,Xaa.i.t2aa..3 HGs4IGs4IG 4IGs4'Gs5*G 3XmIFs4IFs6opFs6fdFs4 IF 5*F3yks4js6nowjs3U's6nows6exps% B2s0b;cU&p1 S'JLb'$JNb'HPc'IS#c)$A]@ccU&p\ S%ZAtsccU&ps (fdusP%Hsc"dU&p )'B0ddU(p R7[X7J 7brs  7}t7.v 7ws "8 7Q7;%7 XZ7s7 Q%7R%7 U%7 V7W Is  Is   mJs  J 5 J % I ,  ]Is0 #ev 4 Kj0Jint7ri 2-y&dk3C/DY76H 9 -G5 -@!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8O!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3JI!JJ(JMdJNRJJJ  $xJElowE#E#CPsNllOJP$9JgUnfVWdfPQ'9 KU_*judtpVRWlhWPQ* RP"&P#JUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Jm1m0 C![;!J ;\kP!0Jint7ri 2-y&dk3C/DY76H 9 -G5 -@!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8O!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3JI!JJ(JMdJNRJJJ  $xJElowE#E#CPsNllOJP$JK[UuZvZPQw\pJ\fpl*{`VW\DRPPXT8*P'LP4JUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: J!m1m0"C#[L#J L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; @ '1(1).? : ; ' I *: ; I+.? : ; ' @ ,: ; I -: ; I ..? : ;' @ /: ;I 04: ;I 1 U2: ;I 34: ;I 44: ;I5 U6 718.? : ;' I 9: ;I:4: ;I;1 <.: ; ' I =.: ; ' >: ; I?.: ;' @ @.? : ;@ A1B.: ; C.? : ;' I@ D4: ; I? < E!F4: ;I? < G4: ; I? < H4: ; I?  I4: ; I?  J4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I .? : ;' I@ : ;I 4: ;I 4: ;I  : ; : ;4: ;I% : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 24: ;I 3 : ;44: ;I5 : ;6 : ;I7.? : ;' I@ 8: ;I 9: ;I : : ;;1 < U=41 >.: ; ' I ?: ; I@41A.: ;' I B: ;IC4: ; I? < D4: ; I?  E4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U1 24: ;I 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I*4: ; I+ ,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;41 <.: ;' I =: ;I>: ;I?.? : ;' I@ @ A.: ; ' B.? : ;I@ C41D E4: ; I? < F!G4: ; I? < H4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1.1 /.: ; ' I 0: ; I1: ; I 2 U34: ; I? < 4!54: ; I? < 64: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1)1 *.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I0 U14: ;I24: ;I 3 : ;4151617.: ; ' I 8: ; I9.: ;' @ :1 ;.: ; ' <: ; I=.: ;' I@ >.? : ;' @ ?41@.: ;' A: ;IB.: ;' I C D UE41 F4: ; IG.: ;' @ H4: ; I? < I!J4: ; I? < K4: ;I?  L4: ; I?  M4: ; I N4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 24: ;I 34: ;I4.: ;' @ 5: ;I 6 : ;7184: ;I 91 :.: ;' ;: ;I<.: ; ' =: ;I>.? : ;' @ ?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH.: ;' I I J4: ; IK : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I. /.: ; ' I 0: ; I1.? : ; I@ 2.? : ; ' I@ 314 U541 6.: ;' I 7: ;I84: ;I9: ; I:: ;I ;4: ;I <.: ; ' =4: ;I >.? : ;' I@ ? : ;@4: ;IA.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < D J src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdio.hstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hPgg<!W!gK!!Y&"lt [a<.Y0frAuzt? .w <(ZYYYYYXuJu?=w @bj*\m؟Z tt;/KFJsxRi3<M<3<M ~7<I<7<I j-<hxX5<K<5<K sɣˑZu#أLugYK/N˒1g0,0ZW ˅ST*<)GLz~s~JL)g;K~f@<<<K fX"J5yJ~f~ .~< .w  tw<~f~ .~<@f~ .~<<~t"Y~XYh<.~XYX/zX~  wtf~Ʉ,Z=!e!eɝ!eY=;g91U=;g91U://vfuZuYggYZɻͶ~Ȉɽ://vfuu 䰑xLgK=;g91UK=;=;Yg82T=;73Se/g=-TAMe/g=-Ywzw;=/fh:"OX1zJM;gg/g.r?:h8@0;Yz:>Kguf# srcbase64.c0#UX9y/-A7-=Z:=[K$<;/gM@8Z0>=;0h6qQM 7A1@80#@;= Xx<6mXf;/ src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h; w-=Y-/!=e X/L>/tv~AAY=#isX -uhy2"J>-v/82J?-w/z<4  zB=S4;/M)uJ!ghZtKvJrBY;/ s. XttLK!Jj#!c/9w1pKvpJ%=-M=;ghgh< :hu.ZKvoBq@Jj.<q׮/u|mfuL XghKvii=;/=t .}J-=8uXf"27 <t.3YukvX tIg-= ׯ 2=uX/!;L/.fY tw6"Z?ugh } .}.=~ .<~<@W=~J. ~< uYZ !-OSjM|guuX^tJZuYgwY/%S191G!u;g-/;K;/K' ^tY!u;g;/-K;/";/ ȕvygb?=u-//YY>:x $8itft~JJf~׃;>;=-/u-//YY[;x֘*8@g;g[?>,0d>/KYY>,1lfz.?U?1h,0d>/KYY>:1ktz.?hk[>,0d>/KYY>,1u pf!g;K\8kgqi!%Y>/vKzX f,yh/K" srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hglobal.htime.h=xȭ~?=>mxȭ~?/>lJ#U?=>[UkC[Uk< wq<f"A!W=>,Zfjp=guzM/V/Zuf0gsK Wi#~d>KcL%>hAXgX  7ZX v?;=m"OJ1fO 6gedq0<bV srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h@J JfX<aJCy.C JYhu%J!gV>!Wg>wu-g/iwttT@;0^J.$.hXzJB|J.(Jc.~X@zJ<txtzJBJ|<e<<sY*JVQtbtgWgY/Zhg;+.\ <~@zJ<txtzBJ|<;f<</fZ:Q /--;Y/ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Xfx~~t0~f ~. ~X ~.<~of!W===/LU?<fk~ .~ ff~ti/B~$ff}g=}.<~<.=~<":Xg}.g=-g~Xfg~X ~XI=/e//}X }.JYguY}XCXI=KK}Jt2g}tf}X(Jf-=/K}itX}XXg}t<f< $<=fE;E<; E @ɪ>/~ ;R/J;=c֭"Yg=~<Y"h=hR.< ֒rk,v]C@&#s1;/I=z&; 1;/I=mo srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h %=|gK>Krt=;g=W X^/,v;/E\y%SA)%18$ . 8"uuu=v7Y#!uwsf s.=d</bz<5zXzJWL1u srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h0%x>dYgYfotY-h-M2k*>r=ht!t=Y;g<=jegYgYy. fY } src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.hg<dfJ==;/`t!#i:"/;/ X?t<";=vYukytY-<kfJwi/=v X[t<?;=5 fXiLtvth;==1;/ R src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includecfgparse.cstdlib.hproxy.hbuffers.hport_range.hstat.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hnetdb.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hpwd.hcfgparse.hgrp.hacl.hstat.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.hhttperr.htask.h3h<.g>H"hidKJ"g;Khd>p  pfKیid1:vg;Ku82@X?d?!J]a .f h;/dXWt?t\TixT[U][k)PttV~=;$9[~J<4z.=Z[4<4)EZ[<4)EZ[<4z.=Z[4<4z.=Z[2s@s0s0 #U}Jf}f}w">~&~ X~<~ ~X}< &~eY;u]*.LY;uY.2Y} v4.~K~X d~~~<N9 .yX!e=sgW;/s!=-f JJNh-=={~<v t<E &/tK|X.;/K>,Y@;Y ;/  ;/O>/)W<hX0<Q,Y;i<;/v,!;>E.בsJmv"xgh;%gU=Y====z<X(xXɝL= u" yBI=-*oXo:hf}/;0;~<K1w;ej JK~,׻ɻʁY=WY"<yfyf<f_Y);~0;"L;dvg;Zv;dv;*<K1BzX!e=sZ=Uh;/Ys!=-=K;g;gZ:jJ&J '1;+I M;7Jb<lfg"**Kw;h*u";qv;JM'끟/;gw E<<wf; f!u;iv;eYhgJgIfLg;gs</; !# fJ JNWL!W %>:=Y;gXv; w;1;K<X  !#*g=ɏ=g=Nege=?i9@Uj8?dhV>Y~&v .vf w;ww;e=2{Lww;R;Kv"vv;rJhtfؑ; ;v;O'$WL- $=s= f==:>XKg; v;0qf0g;cv;2O'WL!W J$=s= .;>dJvg;0qf0;iv;+JM##ML{'&/;gw <vf f=>ge0qL;x;-?ؑ;e=w@< <v< <9=el<;-?ؑ;e=v@< <v<  <9=em<ב;v;~&Y;=egK/g"9fg&;<*Y00f.z/nfL;/f}zggw;;" J%&xVh:>dhm&}&+/;vK;/g;K/;JK'$WL- $gz";'hiXKg;L}X/g;JK/g;u;}/g;K/g;dYZ;/;PPLNg-==ّ;%/g;M:01Y!DžgWe=xxE/g;^$/;M;zg;"}g;u  t;}gm Y=d>w; }<#/=X}<';v;(x<u;oؑ; J J JK|X/;6Kg;v;ns!=-31M';/On"v; Yg;yu;  JR'g;nv;* (1;;/;Y ;/ ;/>&YZ:gj;0;sYZ:gd;/Pp;/;k;/x..JP%'gv;z fy<@cY>Skg:v w< f;/ofo.<t蓭g}Lk*0,>k.0Tf\f<t =h dg"*^d>.<x;};t(=j8j::Yg/;g;=YgDwXeg$ .l<'K/"(=i;:Y-"eg,.</g;pLg;u9gg;gL';/Kk"v;L'e/lKk"v;L'e/lKk"v;L'e/lKk"v;L'e/lKk"v;L'/v;e/l&j"v;@Y;xKg; Y;xKg; Y;xKg;)L'gv;L'/v;vv; e/l&Z;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;K'P!eulv; Kg;yu; %/w;xv; ';/&Z;~Y;L'e/lKZ;hv;L'e/lKZ;hv;L'/v;e/l&Z;gv;o;xK;3L'e/4KZ;hv;Yg;xK;L'e/4KZ;hv;;xK;K'Pmv; Kg;yu; @&eeXfefe.<*;/ ~Yg;J!sJ@z4sgC.eusKYKvg J?sggY tOf3uIf\\XQ`ru" *m}^f=;!  <=Cy(W= f;/  &i9ibhhX~p֑>gbkgg};/@z;/^g-!'z;;gi K7~g;A ~;Y=` z"X~u<]=; `! ^ "!e.=C<=;/} srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeserver.cserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.hmemory.hbuffers.htime.hfd.hport_range.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.h<>Kiǟ<>[~g  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includechecks.cproxy.htask.hqueue.hticks.hport_range.hfd.hacl.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.hglobal.hP1t/tff/ dv!=_>:>fsftW<).W<).d<sJ .s<.*?Z=*L>:hds< <s<Jv< vf f/3=;37@8?Vhg=zv. .[sA4C#gst unt148KFP#;idZgjNCy4 <wU?}t v< XX]egBu</Y <wxJD"NJ?U873X6&=M\<} <}&`XgK̟zgj $K;/ L# fK| fs<J<|<Yewfhiyrf*M ؟>tun&gJ3<zY*JyY*JmY{=-=٭K>t;z<YX*`UxX6<YX!!l;iW/u&y@>=g ڢi1w;iW/&'h_5d=zY*`xX6<YX K!!z *^>WUzN.4JL.6JOX1.O<t6?Tuwwu5hVhztiL=uw#KK-=zf-=#K><T/wugy"!u;gz==; A '~t6wB({<zfXuKYzUz֟'XN.4JL.6J==; u*`Uy=s.& twX e '/&zfoXtp tXd?u/ht~)=Cy CeXts<t%J#c?L-Odg=>muehhg-vqXKe>Ys  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeclient.cstream_sock.htask.hproxy.htime.hfreq_ctr.hbuffers.hfd.hhdr_idx.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hglobal.hstandard.hsession.hо/>=shC;= ȻKk|=#>riy 2XNf2N.2foffU +fofuuuubtO<ٯ=8g; <yG}&<}}<}t}}<~ *uvx?gu,\/^dh,h }$Yvhgfu, f=K=euql=K=eu}Y"ue]C~ .f.XDue EZ#}""~o.~ ; yYvf9;c*.#ȑvf <az)ugis?Xgis1xYs1=g v srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproxy.cproxy.hstdlib.hticks.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.htime.hcfgparse.h1<=W[WZ=WMY#U.>MW[W[Y  vX w=%=;WY= f!Xɱe.=y/E=;Ye=;ggV.<H=;WZfpX}=;eZfkX5b=;g ftX!=;ggVzjT=;Yg9u+ vXCw= tv< <<ס/=~e#&rX  r@g'u X=~ 82nX#t,@!%K|;/~2%),@Mf/tK) J_82 JKܮ}t }f<}X }f<} }f<} }<<}Xf}e }f<}<f}fe }<> ux-i91彿׾Yjffj<.jf.eu}ֹ׻}<%wgYg'|,f|X>5wt=1ɑfX?!~xXAi ngYʥKv /3p}f*J}/N.4JL.6JJPKp}'fY.(JN.4JL.6JWr<\/g<s+$s='Op>d \gbg${yt"qtwrh&v.g   srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.hp<=lHdv/Vg@ff~'$#vy, J ~OX tv'vo Y_zX?D%Yt <t. fNKP1>Cyt5~.( )#~Xf?q~..;i~t/f~fo tpfuuutOyfnfs;k7'<mfp<>uvuu=uuuvuvן=uɠ6zfjZx.@h|<|fpuuyt@bluf|<t=>uuv|<|<wf|<t|ftuu|txhtvuuyuu|ttvKY|XXWL%}guve=IN| <s<J<|ffɇegs!sg.n~ ~...5.}Y"~tXXYt%)A/ <vJM\N&XZ.K| <|>-uYQPN Jv.K|<<|-uu}J;E<;<Ef;E<;<Ef;E<;<k|<.|>-u;E<;<fi7YI=K= {Y*Jcm<n.t{=ȅ|<|ZX仢 Cy<B<qf<<c;Y1f:vO1<:h:}twJp 廑pXztY*JdXY*JhY*J_gtY*JdXY*JhY*jrytztxJxȢg 3 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hJ%/;uyfK=/!jY![s/w[s/x!;YZtgv;KIgsY f=vKI=sY t$*?9?h Xx!-L>'-L#+M+jKe XxJKupBuyX?UBzXȔ8j{+?:0I=Wu>"=gH0>u;//WD|v.sdJ:Z,>2? /|X;M;/kX2Cu;= }.<|X$<\.;buvvK9X=t\uy fJg=s=sfu.ZKZ4v X'y.MZQi -N/j#0 .mf"d=ujM;/_=;YuA)uuiwz< tw|gKxt!x-=vvfXg>MMMol frtPqPq>=;gh f"2|Jf| |fXPkduuYgKK8$*jT{{J/e=e=eh{7z(L-KKK8$*jT m&yJ:Jy .yevX tu<ah:0>&Y$'=;YK>o. /;=yX;s tX=f;=9Ÿ.Iu/W= JVu/W=Q!uYuY/fXctht t/slf.GXɻ=Oɻ=#uYK//_Xht\ttPtp usx.7A=:2MX/n}tu=W=fkDJL:0v==;h =uw=2Y;#=c=Zu;kAuY &+;g}L:0v==;h =J2Y0!KX˒ۑUfX=M˒ۑ`K;/jvt <;=v:=/lwXA.W=;='[e=;/g$ ~'yXBz<^zf=AM-i9i9- zf^b@#z% >;sK]/Cy.Cy!W?9mg5;/0;;>8 wX8@j-]v <s<= tY>Y=my,hVN<fc.fn.th/kw2xJ1h껡#L0",>ef!vf.e<:>ɳy{u<}%Pu/tL,_~"XX>d>&/ :v̭/=- <8@}Jv":0 f;x}';u$V>>8/>:-@:?@f@<.ht:0-wc49:=;K~׹">:>1!;?>E;=-/=9=?7/-@=b@Lu~1Yg/A7Y\8=[9=Z,==W=/bK=-/;=;׭;gpxt <z<affBa<a.<atIt=;<q< Y>'K]/PL&Ag5=;-/>;=M:Z!;d>=*=;KD$ wX-]w <s<= .Y>( Y=]xL Yg4wc?/Igx=72`#;<`fg;>,h`Xt1+֐fc.fn.th/k`w2xJ _t <_e"<]<;="J]<"X}f=e>:>Dxt w|z0_~("XlX>e=&/k̭0=e=@[~';/]=-vJ".]<":[W/9N i.Z:=Y-?:==:=>uf;=:>-=d0~<i#}J=u;u\8=Z:=Zd==~">:>1;!)?=!C1Yg/A728=?9Y[9=Z,>3t#=;,>>9;=1=qA:S</h K=-/;.%dvu:L!==ulc.&ɜ.Y+w.Y]U#Y t(# .kBz<.kt^tJ}X<K/=:/-==>Kv>:0:==I=.@P+5 . th=>fDfg;i9YKA<>:giY;7# "4 #82? %y<y r<fs< rY t(0!=;  _yJ q<XgK !eAؼ5@g; >dA7@d>:h# <wJ p<XgKge=u pfbt atg tfKgge=Yg pfbt atg tfgggɼ]Ƀ pfbt atg tf v˭ o<X}$h=9uuY{/ugge->,/e>:W gcNeh:0W=d3Je . 7|/!"-#'oȟXCyfmn??9puvvK<Xtm=-gvJ .<m.<m.Zf -|Xe=;gg;0:=gA,hgg4F`_g?9[KrgECyfm/,"&:0|8h!.l, -?Cyfm/,"&:0~<|g;Y;>;/tȫ=u. tu. ; (?)Ac?ci rf XgyJ/hYg:L;j9wK>:ZH>x82re=;g;h .ޒu:==:gu"<W~r>-=vf Xh-/w>{>tY*J g;:>:gug~tt|L;/~ȟg;:>:gu!gntvf <s .s.f!vJKU .M-=vf{uJ.{=g;g;dvn-=vvfnB?Uwu-;uL un<<n<.n<<q˻Փ"i-/w;=4Yz֭=,=L%).jMfu.//_uYz.,igCJ$*itu-\=-\gY0TYlX=;==,=LW>y^z.kMfu=0-Q*=>v^z.kMftg-Q*=>v&z.JkM f;gZY1=%.uY$*.iM fv.jg?qjY$*JMfntkgeCW_$*JMfstkLW .&z.+=>1j>:ggYWCu:v>,/hXMnaj/;XMje/; f'y.l*@1uLYuYXMnaj/;XMje/; f&z.+=>1j>,/hv:v=W5XMnaj/;XMje/; fz.>=>Mj >,/hr:v>:h/V=mXMnaj/;XMje/; f%)JjMfljZ-N[2T?Jg  srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includestream_sock.ctask.hticks.htypes.htypes.hstddef.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.hacl.hproxy.hin.hstdint.h socket.hqueue.hserver.hfd.hport_range.htime.h freq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.h memory.htime.hproto_http.hhdr_idx.hpipe.hstdio.h libio.h standard.htime.hpipe.hglobal.hwG.c<=utPuytX:0 /;h =WQ]Y? ȃ:0,h=c1YZ[M.\:0,h=c1{ytZ t=zz< t;(JK=s2,h>gV{Ȕq wt<jf ? :0u=-/;@11c=h:>j,;KKOCwؽ/}sft=;;Y~~ <vX < f  w)>V0=;:?gZ֟ &Zhd>]KȆ}J=-gvJ .X}t <t:u2<>:u>;s~/;Y% ;KKO =;bք;KKN}UtK~f;u. .ֻT dJK=s0>,>#i;g/sZwdX~ r fxfDjw-=){=-gvJ .m<h{s<t<'#{vH <>:uz<<z<<z<t;YzXN /WY;5=>e +z.X= <?8^C" tZxv <fxs<t0x<<xft=-gvJH .xUM=-gvJH .xUJg:<n<9' srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeappsession.ctask.hticks.heb32tree.htask.hebtree.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.h<0KoXtp tqXuut<Xqtr<etJrX/..TVh*J/V=:YM˟Y txJe=YAG!K/hL>U#=:Y=:Y=l% Y<*J%LJuuv=gJZ>$X?:>LZX=grJzJuu <8Y><9hY!ggK73S J>ʜiuugsYpy<5ft*Hu;>X@c?~ցg儠;g=B*&/}LJ}Sg=gT <~t;g/?{.gLX{JX.-=ffe<z֐ <70g;=;kuwNN9uf<<i|JLLJ!*S u=@[kJX(<^JhJv}@c?}J=g}LFgLH>/my. J/Ka#fxuu-g\}Jt>?9?}fZZփ=:};gf}.yIgLZX=gytZ YYI=B*/yLJYI=y<;gtX?d>yJ=gxtLFKLH>/my. J/Kc!fttxJ>>:>xfZX=fxL#~X<~fu ~<L:> g=gc@nx< <-";=?+>,>cwu 9t< tw/Y=@8@@8#3/Mi>!XKL!;Y^%=W<pJ<tt >L:>B5,$ -@;z<-Mcw%.`/Z0.RIuMvJgu). YK=W4=-ut =;= 56Vt} B:vz.l{fhfzJB|J .g{X~X@zJ<.xtzJBJ|. t<=W9ti0u=?s uJ?9iiMu <|.Kxgvy w"KYuBzfvحjuuyu}h.zB|J.h mf.L===<t>={X<h.zBJLe1fgvc1i,lzXjf :%SJ@fg-N [uWX= t/ J@>:=>HX5tKX;Wt>Vhqt=uw<q<JK-=f"KWLYsw;qXLKqX=eבu=~%T/1;/*Xqfq<-gvJ .t=;gL*x=;=e=qqXgK>t=;g-~=srUwq==IZ>t;h%,(?*gɃr=K>t=;g~02)%*"~( Z=e=pfuw^Qk(..Jeu? pJ  t w |g xtfKpCEfp<p<-p<vJH.p<<meu p.gvfU <=Yiǟ t`K"1;YUg t srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.h+? Af.?<Y<*JCf/*[\<=uv  J;t?:vqvvgyX?:vqvvgAXW Jt=Y?:vqvvgXX..=-gvJH..<uJU  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h;"VWg;=ۑ/S<+V<;&X`-x tv@\-~X@p<X!;/aJJ~fg1~0yx4f/S<-<X7x+j`b .g  pC:zt=<{XC..o.^| $#zf 'VjZBg-ko/;[?W <%'g- v.x>g;M?g"(7S?=c <RL/e<N 67-@}FY/;E <F#0K Wϑ*#X&ȑ!j8@gjF O IG&$*M)&~l>g-~lA~3ZJt~J~w~zolv#2gN|_}'j>!vguϔEh!-|ft|*-z>zwwzzwz"zP@?Gv @?Ph:eg~=e/.v&7:h,ɟ=Yu< <u< ~f~<<~f<~fbk#)af<eu ieJ-=*ʻ-g-K;=ϳ =g~&%xK-=!-g;=eguuqg6ti9gw vf .OAj@  ?</.<jrI.v< tJg ' srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h ,mKY=u=\O-NJ/`=ht)y<9?=Pv. tx |zXP+wv+Wv.wzBi-fv"6Υ? ~#:Kueggg>:K#oJg=B=W.tKXt:ugg-Mg+w.ZYjzXlUhz fi= .wJ <f".+w{tv,0x 5y.C .$AY X]u!!vi91M6*x:0zX<z<.v,0xyf<4 E X$Ax:wȽ1gg wt1XgN<4JL<6JgN.4JL.6JJ2<N.4JL<6JfxtO<2.N.4.L.1xtN.6JxN.6Jf <|7zzf\kx\k/s{ugW=Yuve~ ~t<z%Wuu .h 9} txx{tMy@=L" Juyfu} <B< q f<<b ;Y1f: Qf1<:Z:fx.K K~K~YhY~zx?wt6qt6&zXAT;=?PVJYuYh#KLL:>KL?!e.={ xsX <W/W/+g;,",,zf4vO[]S\PG i -[fuK;=+(BuuSA;gw[[#UJx-vue=gg"V0 #c1Zjuwuuuuuuuuu srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h*g=JK0/ Jgw̟T xfa3uɑvz Xy. srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.h,;<=<=g2Y4<= "V0"V0",0J$*igYZTv/(X@?9=L8@82==i=,/Mu;>%J$*igY0TvY\*igZVKL 7Ag-Mh:0g`\xKhU`;/`^z< <+?#=-O;ev;=uzt/[!uv< l" K%fX@=-Mgy=uYytz<4fZts .wfuwf,%.. tK;ugK&=[-g,\u>:hܮB?KytttOf p.r<sf .wf=-KwJ'%.. tLK_usXKZ =Muti,\u:>ܮB?KM3.bXthtt f=Y{!e.=C<=;/hK-k;/1^MY+s;/~2vX J>uwђJy.>YW;gL;=vDW=;/fW=1h;=;K=shvMKɄ=;/K=;=?C .vtC twX;/L>;/L=;w <z^t <z$ȔuG1U tl1;/QD;Y Je=u .zu;/_X ;/L;/M>:g1ytC=-;/;/L;/M=i9>:/=:>YK zu/xu叮5 W=j;^7?qj/Y3/ztJ5J <Q#<_. W=4;/O:=g:>Z,h5=-l W=.nt/8?=;gc?  st< hu/oX\q590/=v  <t.JMu-Zz=;!==/xtY=- X>MN=90/=1).JKKg-LuO/Sg;4uW/V0CxJDx< "W srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsfreq_ctr.cstandard.hfreq_ctr.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.htime.htime.hF$TPz.@K[/=K/?=--}<{&zXO)lLY=K/<-~.?+0LK &zXA)BLY=K/<-~.?+0\-KG> srcinclude/commonebtree.cebtree.hGfX~)37 .yz{<N srcinclude/commoneb32tree.ceb32tree.hebtree.h`Hytn/g&;=/X~.<~<<~ <<~< X2=;A8=/>.~ftX}=;>->.p~~ytn/g&;=I/VX`.<i<<i <A7 X2=;A8=/>r.fqt>X|=;>-> .pJ} .X<#KLL:>KL?!e.={ u6g;=;=hKu;= Xgg=Kmtz Xg .!;=",ZZV>>,">0!l< _=Wii<i< ;/-!z<SAWiHw9[M[#U Jz-vuW=gg"V0 #c1Zjuwuuuuuuuuu srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hR!J3,!W.=//*:=W=?=+wNue XvXM/.ic 1|9>/[fL;-A9@+/=MWKYfL;-A9@+/=MW/;/Yf?,Z[{"dLV>KuwzXBK[u t~J,dvCg!rrfBlts~iJ~t -J ȇSAsgZM9[[!;YM!;\UJu-v[,JKZ廻gzn<1-LY Xu.^[2K-=gJ=u'xtfeu<>,K0X/WY  >:Z):Z@:.؟|4"f< vf= tWY*U?(bbf"~ >>V2 :Z/}<f}fGYl$YY$p=W}i<}< W<`tttAdh9[M!;\UJfJ""u/ft!uW=gʻg6<1-LY I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$ .   f.). <.e. E.-.J.,. !.&...x.. %.-. 5.=. .. $.. >.. /.<. 2.<. 0.. .. j.1. \.. .. .. /.6. =.t. q.. .D. 1.=. .R. .T. .. 1. . .6. T.. .l. /.. .G. .%. /.(. /.. .. @.. -.y. j.. k.. .6. f.[. ... ..0. ... .{. T.w. T.w. .. g.. .. .. .a. +.. +.. +.. +.. +.. <.. @.X. <.. +.. +.. +.. +.. +.. C.e. .. +.. +.. <.j. +.0. +./. C.. 7.+..A..}. F.\. [.W.  .<.  .D. .h. k.. K.4. 7.6. q.d. b..  .<p  '.. .<@'  . . A.p  | ( : ( R | 4| Pj !.8. 0|  B.4| P 7.X|  G. .H. T.0.Z.\. X| 6 ..D. \.3.S.,. X| L ..D. \.?.6.  .T| @- ..D. \.'.6. X| p @..C.].0b..^.8| 0 T..| @v   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8| T g..| ($$  $$$(  .$$} 8$$p .:.8$$_  ..,$$ .| 8T%о` . ".tT%0  .?. .. .\. ..0#..C. T%J T%0S ,T%| ?.,T%{ ?.T% $T% .| '7 '* T'@ .... @.. .D'`Y a.Y. .B. T' <.5.... .0'd 0.0'z ".x' g........+..*..L'0  _...=..H' .%. ... ,' .,' S .L' [.. <..i.|'5 .J. ...  . . ... )..t'g  .2. ... 3.l....  .$'P .| +pQ p+T  . K.........<+0  ?...0+@  U.0+  .0+@ =.0+` U.$+` .| 4-9 ..0-  .0-Ps .0- /.(-`V 8- ^..4-P+ . . 0- .$-0E (-a (- <-  .x.N.X-. 0.....2..D-U  w.. .. 0-  .(- (-p D-@ .^.:.. 8-P G.a. 0- $ .8-P . .8-@ R. ..0- .4-" %. .<-# . ~.. L-%+ b. .. H..0-( Z.<-(3 b.X.  .,-*i  ,-P+ h. T- ,) .. .i. .4. <-P4< . .. L-6 [. n.. E.3.0-P8 U.p-8  .f. V.t.v. .l. s.. .0-pC Z.<-E E. &.*. -E6 =.F. G.`... z.. .p. }.. g. .z. g..H. d. .M. Z.<. .+. .. \-Sq  1.F. ... M... S.. .@. 1. .G. a./. K..z.V. q.7.. .. z.w. *.}. .. ... Z..R. ^.;. V.r. &.&. {.<-pn\  ..&.-nD ,- oo =.,-oA  .(-oY (-@pY (-pe -q: ,-Pqs 5.,-qv 5.0-Pr *. ,-sE ;.,-Ps? 5.0-s_ -. ,-sE ;.,-@t? 5.8-t *. ^.,-0uE ;.,-u? 5.8-u /. w.,-vE ;.,-v? 5.(- wd $-w .| (<wC D<xA M. {. .C.,<Pzx I.T<z .I. .\.1.$.,< 8.8<@ ..0<@ 1.$<Іj '.0<@W .| $> .<>p) %..P.0>J .$>& .$> M ,>p .| (,@@  ,@P ,@Q (,@@r (,@n <,@0b ...0,@A $.0,@ x.0,@ u.(,@p (,@" L,@@  . .{.'.r.,,@Кc %.,,@@ .4,@0 . .D,@P $. .B.0.,,@  .8,@@F  ..<,@ . ...8,@0 W. f.p,@P  2....\...G.T.1.,,@p .,,@@ c.,@б   .{. .. 1..&. `.. Q.. O...0,@J B.,@; 0,@  .0,@  5.0,@ 5.0,@ 5.0,@  5.0,@y 5.0,@0y 5.0,@y 5.0,@0 5.$,@ .| H- H0* ,H` .,H .| 0HU <.$H .dH0{  .. .v. .4.0#.. ..'...l. #..0#. .@4. .. ..@ ..0.X. .D.pF. e.=.0./. U... P.-. ]....p...TH .. ..pd. .<HPY 5..` .,H9 .H . '.\. '.T. ].p. D.!. -. %.?. E.?. #.. D.XH*  .). s..0+..@.$H .| <L  f. .S. LL O.F. v.!.. 0LT .L@Q LQ 0L\ m. tL`f .\. .. b.G. 6.V. ..0..L+ (L $L6 .| ,N { _.8N ..$NP? #.(N 0N C .0N > .0N  }.LN  .6.t..t.Nu N` .&...$.I.4..8._.F..2.. .R. .H. .$N$p | (pQ$ | Q %$ QP%  Qp%  $Q%5 $Q%0 Q&$ 8Q0& . .,Q( .,Q)L  .Q)  Q* | $pS*C .,pS* %.4pS+t 5...0pS,  .| HT, HT,0 HT, HT-  HT -  HT0- ,HT@-c ,.4HT- *. +.,HTp.X !.,HT.e &.0HT@/ [.0HT0\ .$HT`1 .$HT1 .(HT1m HT2) 0HT@2=  .$HT2  .,HT2d  .(HT34 (HT@5. $HTp8+ .HT8 HT8 0HT8@ .0HT 9 .,HT9L .0HT :a <.<HT: .X..<HT@<c ./. .<HT<  .. .<HT= !.. .0HT>h +.0HTP? .8HTA . .(HTB; $HTB .| 0ZB M.,ZC Z.8Z@D\ .#. .,ZD4 .,ZDQ  .<Z@E .R.0D. | (L\FO (L\PFF $L\FS | (\G (\G | 0L]`H_ .0L]In .(L]0K{ (L]K (L]PL | DL^M .5. ..| ^M$ ^M  ^M  $^N5 $^PN0 ^N$ 0^NR .,^Q ".,^Q@  .^R  ^R | $``R' ``R" (``S ,``S? (``0TU (``TX (``TN (``@UK 0``U x.,``pW- H.,``X .$``@Y( .,``pY2 ..``Y | $b`Z' ,bZJ ,bZP b0[2 (bp[t (b[c ,b`\ .$b\ Db\ ..T.X.,b0b  K.,b@c  .$bc( .,bc2 ..b0d | (`e | (e totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavail__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgosrc/haproxy.c__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnputcharbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognameforce_persist_rulesdowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authnode_copystats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_namestats_set_nodeout_realmstats_add_scopestats_set_realmstats_check_init_uri_auth__lendesc_copyout_base64ulistnew_nameout_ubase64stats_set_descsrc/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sun__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_r__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.chex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_strst_sizeatoiforce_persist_rulest_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintnew_listenst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalnew_leninit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportnew_ptrcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uphttpchk_build_status_headerout_errortask_newsrv_hlt_stprocess_chkfd_insertprev_srv_countpc_endevent_srv_chk_rsv_statependconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledtick_addsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterratioevent_srv_chk_wsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrv_dynamic_maxconnpendconn_addsrc/queue.cpendconn_get_next_sesspendconn_freependconn_from_srvinit_pendconnprocess_srv_queueget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportout_free_sessionladdracl_testsalensrc/client.cmax_setpatternsacl_keywordmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchbuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_closeout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockfindproxy_modeproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxmanage_client_side_appsessionhttp_msg_oodhttp_msg_rpbefore_crbuffer_abortdone__tv_isgehdr_idx_set_starthttp_msg_rpreasonhdr_begfind_cookie_value_enddebug_hdrHTTP_200delimcmp_lenhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdratt_begret_ptrapply_filter_to_resp_headersret_statepreserve_hdrprocess_responseatt_endacl_fetch_stcodeacl_fetch_chdracl_fetch_shdr_ipbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stverval_begacl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiedel_frompathlenquotedhttp_msg_rpline_eolacl_fetch_chdr_ipacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqvernext_paramhttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urldel_hdr_valueapply_filter_to_req_lineis_cookie2acl_parse_verhttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenhdr_endhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valsessid_tempother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crvalue_lencur_ptracl_fetch_hdr_ipseparatorhttp_is_tokenauthenticatedhttp_find_header2end_paramshttp_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshdr_nexthttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setfirst_paramreturn_srv_prx_502stripped_afterval_endhttp_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntcur_paramasessionreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxstripped_beforeperform_http_redirectnext_responsehttp_process_request_bodyvalue_beginacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitequalmsgnumhttp_header_add_tailhttp_msg_rpcodenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrprevprst_rulehttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshappsession_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupssrv_is_usablefwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_erracl_fetch_queue_sizeprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queueacl_fetch_avg_queue_sizemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serveracl_fetch_be_connsrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdacl_fetch_fe_connbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serverssrc/stream_interface.cstream_int_returnstream_int_check_timeoutsstream_int_retnclosestream_int_report_errorsection_typesrc/dumpstats.cultoaprint_csv_headercurpxstats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_match_subacl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_strtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01BT h r S a  l ] x P' I Pl t Xi  EHKSt~5V0GGfB|PSYx#1E&0<j@GmpsypsyTsuIA C P c q s | Ni$,68BG^4vAFchQY^h T }F2     W |   5`0{)KN\FW\_QVsaiI "S"!#"-"!%!+""E!"&&r%%*%O%r#$D//%&/n0&&%%/n0&&%%'*n01*++,%,&.\ll_ee!KPKJJJHIDHHfBB=>1,1.D/2222x4444<56l pf\lddM.NGHY==<<788$9Q9;:>:::<d_ePKKJ!KIJJHHHDH==<Y=AfBef LBLDEGGFTGMMMuMF GMMOQPБ+ papTa{P*Sapp"QqQQQPRrRRRuRRySTŖU:VYZZW XVW$W.WVW$W.W[[aa`a!`^`[/\Y\\\],]c]~]_+uF]Q^F^^,^3^^*^+_h__!`h__aafgjkiiffffgikpkijgh h)h'mmmmmnnnaooooqqpqqqrp̘rrrsv,wsss}t,wwtttmuwwuuuuvǂvvwzxБǏXxyϐyyzz{{{{H|]|} }}}E~M~~~np`y܂̓pӄyʊϊՊފՋǏϐ"~+\Ŗ̘ٚVPHJ<.׭ 8ȨШƨE\iZ]`f~׭ ׭  efl[ K % 0 P X [ U k  a h p % K vfJ,hk,G  ' U +)]c)@vnp]c)@vnp' r @ u@S39SiViQS :  :M9 ?  M ` E G iM^qv~  D 0&%B _ ] i U W H T o    V \ $Z"+AAINd~~@Sf&+>  O R ) L !!!!!!!!!!!!!!!!#C$h$%m(p(((x(~(********+++,d,y,@.S.,,--9---5.0L0q07w11/7W7w1}1/7B711 2g2 55225u52222273B3O3=3@333B3H3-3733'3v34~77I66u55444444x6{66666666/7W7~7667/777777766K9N9T9q999999999;<"<T<<Y?F8F?Dn>>DDn>t>DDw>>>B?F8FDDA[BAA??8FFDF@@@@@@TAWAnAxA]AkAB)BDDBBBCBBBBC6DDDCCD6DDDDD6DvDyDDVDYDyDDlDsDaDiDDE8FFEFDEOFbFE#EEF*E?EEEFFEEHHHHHHaILQfWLQWJLMMMMJKMMM*M4M7M0M2MMMMMMMMM0O3OpOO=OLOnPPU"VX!Yoon#onnmmk#lkkUhfhf&g + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_ .1xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh07 ?(( `GoTo\\@c 8l ԏ u%pԒ{T;S  T &88&t&<&&&''x@@)\ 5 5 SQe@FP. Gm-u #9- eF0d KQp W` +p e `8'v xJ /04Hh(\ԏ  Ԓ   8@ !"#$%&' (/Ę >I/Ę Ę H   !.<H >^/ (5 (x2=H nMRWag@sDH 2 P@ &$1 >@tDG(R[dPj u P  6 L @- p 0  X0S *J 8| F{ V f t|@ `Y P `TT 0 ` Ľ'pn\ 6nD E oo ToA boY r@pY pe q: Pqs qv sE sE 0uE vE Ps? @t? .u? Av? S wd bp a   Pr s_ t u w xA &3 C Q _i  y    y 0y y 0 P Q 3@r Nn gA  " @ p Кc @  0  P 7  F Y |e U x       +  |P `f T T  T 4/ 6 C M W c %$ o  w P%  p%  %5 %0 &$ 0&   ( )L )  *  8 ,  ,  ,0 % 2 0\ = 2  J 9L W :a f B q z          c M$ o  w M  M  N5 PN0 N$ NR Q Q@ R  R         R' c R" o   S      % S? w 0TU TX TN 4 @UK U =   pW- X @Y( J pY2 Y S _  g  q  x     `Z' ZJ ZP c 0[2 w p[t [c `\ 4 \ $  (  \  0 = ,  4   0b  @c c( J c2 0d    d `e   e" , e" B f< R @fk f eg m /hg y ~ @H /j  8 D T   j/ l| xm n *n> ;o\ HHp@ Up kxqF zqO r] pr\ r2 s0 0s t l L  / $,ƙ4v >4! D/ S/ _/P m/P PF / D@,= 0b   C p^ #; /Ps EO M|h^ j@ |K@  70* > `(0  "` 'E 1d <0H5 Y2 _hй H? .  ;8@ 4g1 6p # .@ =OX? X= i>h x1 : @D\ Yf; 7 : 24  : @ :G HH? Op V M ^ t/PL     P 1 - t &5 4M KV" f0S rp) =H@ T @v  > 8: 0P ܛ"6 (79` Ie- \, s zMp  `H_ P g/ ` ^//C "N / AS`3 \4 e` sPY ` ' @v D7ܡ@> 3 '@ A0 J( X$p j( PFF = I%+ `w 10K  !wC (A 6e  B Of W+t g  wz 3  0@ 0 0-  @P? ' 2PO GY cp.X q ~p- 0C p x Pzx .e :I  ;J )@+ 5 G:[ lty34 Z 3 1 @ :k FS C  P : %57`U GěY= iR v/  P 8  _ @1 P? p 7 5PP ? C V ex:    < &  ;(3 Q (8 @@-c Nu b0E p:p: `Z : *i  p  : $8 ::P` [3l r}B`V @  @'  .`1 `,7: *0" 9AI Yb{ y=   1m  / C 7 C  6  7- G : 0 C W p m -   p 5  0) 1 @z P P  pQ > !$ !: "!?!@2= M!D4 Y!K f!`m!@ !! !P4< !@? !p8+ !@ !4 !p "H " { %"`= -" = C"  Y" c"} q"*C }"9 "<"O""D? " "" #@$#0.#@#LM#B; _# n#h v#: #̓) ## #` #C #G #\ #p $J $"$04$@1 R$o$6 $B $W $i $@5. $,$9 $A $d %  % S *%P >%@ K%2d Y%S a%x%P+ %@ %% ,) %f %3%* %:&б  &8)& /&#@&0 I&q[& r&ء& &<&c&:&&4&K &; X&X'hg ' '0K{ *'0 3';K'0O'h g'bx'3'0 ''=' ' '  ': ''' ((1(DQ ?(^U(@  ^(Ss(In (@/ (P8 (3((((U ((P+ ) \ )0{ *) ?) Q)0D ^)} l)pQ})@' ) )@p )2) ))P? )))t)(L ): *: *E6 !* :*@<c D*PI T*p j*h|*J **A*u*Іj *:*+@W +5 #+0+@Q C+A V+a+X= g+w++`= <+++@F +P8 + + ++= ,, #,pC ;, L K,i, q,Y |,<,7 ,$,@E ,FO , 9 ,;,# -F -м" -@# 2-  C-` X-   c-Dx-* -:-|h -/--- -g - -= P-@.z .#.:5. I.Sq ^.`? l.|.~<. .  ..о` .3 .@. .-  .P . .* /9 !/0 ./=>/G/  V/3 h/r/\ /g /T? / /: / $ /@ /(0 07%0 abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidscfg_nbcfgfilescfg_cfgfileoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.2sa.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerdefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_chdr_ipacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_shdr_ipacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_valacl_fetch_hdr_ip__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_rateacl_fetch_fe_connacl_fetch_be_connacl_fetch_queue_sizeacl_fetch_avg_queue_sizerecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleunix_sock_usageenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroyinit_default_instancegetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlinefindproxy_modeeb32_inserthttp_capture_bad_messagetcp_splice_initfdtrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserverhostnamesess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0manage_client_side_appsessiontcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0find_cookie_value_endstderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_mallocstats_set_desccfg_parse_listencheck_config_validitywaitpid@@GLIBC_2.0acl_match_dirunix_sock_usage_msgparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0str2sa_rangea2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requirestats_set_noderegcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdel_hdr_valuedata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingurl2ippcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info