ELF4H 4 ((%444444x'x'x'xxd4(44HHH Ptd\'\\Qtd/lib/ld-linux.so.2GNUaiW@d,eL)NB>(&M/8a\K[cUVZ`Pf96H<Ig bX4EY 1A Rh3$_T;^O "!'2 #*.0=C:?7%QGSJ+F5-]DK(=H1;`Y/u=H0A7gM"//vD7IW1{o@b*:; :Z:5/%7q:;]:CPW:3!B5.AQ7*OWi hj h,#3L:8#q@c6:8XGh ;b3,b=^S#(@ t:hyuO:idG;DJ:i 8/t:  @}= .7_Jv_RegisterClasses__gmon_start__libc.so.6chrootwaitpidchownstdoutrecvconnectstrerrorfdopeninet_ptonmemmove__ctype_b__strtol_internalgetpidfgetsmemcpysetrlimitputsgetuidmallocvsnprintfsocketselect__strtoul_internalfflush__ctype_toupperstrncasecmpsendabortchmodpipeacceptrenamestrrchrcallockillbindchdirsetsockoptmemchrstdinsetgidsignalreadstrncmpstrncpyunlinkstrcasecmpsendto__strdupsigfillsetlistenforkexecvregcompgettimeofdaymemsetsrandregexectimepollstrcmpshutdowngethostbynamegetpwnamgethostnamesprintffcloseregerrorstderrfputcgetsockoptlocaltime_rfwrite__errno_locationexit__fxstatinet_ntopgetgrnamfopen_IO_putc_IO_stdin_used__libc_start_mainstrlengetrlimitregfreestrchrsetsidfcntlsetuid__ctype_tolowervfprintfsigprocmaskgetsocknameGLIBC_2.2GLIBC_2.1GLIBC_2.0$ii Bii Lii Vg&'3TW  $( , 0 4 8 <@DHLPTX\`dhlptx| !"#$%()*+,-./01Ĺ2ȹ4̹5й6Թ8ع:ܹ;<=>?@ABCEFG HIJKL M$N(O,P0Q4R8S<U@VDXHYLZP\T]X^\``adbhdlepfthUS[H&WRB[5%% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@%xh0%|h %h%h%h%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%Ĺhp%ȹhx%̹h%йh%Թh%عh%ܹh%h%h%hp%h`%hP%h@%h0%h %h%h%h% h%h%h%h%h % h(%$h0%(h8p%,h@`%0hHP%4hP@%8hX0%<h` %@hh%Dhp%Hhx%Lh%Ph%Th%Xh%\h%`h%dh%hhp%lh`%phP%th@1^PTRhDhQVh`CUS[0 t[ÐUPP=t ҡuÉUQQ0tt h0fÐUh4$((fU hh@hXXPjQZYPj ÍUPP PEh@PhPj^v'UPP&CUQQjR贒fUPPFЪU]H&UVS5  hh9J^dQhjV:uRR`P\PC4PC$P#Cu#PPPhh^h (h h39h hjVa: u^dNh RPPPPPP&SNluCPRh h^h n@PPh h8h hjV9 e[^]ËQRPPPPPPShhh^h 0jPPPPPPPSQRFlPFhPPh&'UPP&逨UWVS$E} EEu5 E4? >  < $< jjlH; ; < < \C7lB0 _ܻ7ܻ(  v@PPj/PuN8-usX@ PhԻEEKܻ h+1SUf€}t Ш}f%ND HPPjV"EܣCNãEjj jPSU܃E܋ MQ럃 UR Bq h/0 NUjj jNP  N B jj jNPjj jNPd`x jZP P PhH.Xj{vt j QQhbR/Xjك ht뵃 hPj Ph랐t&UWVSE= f PE^,S8YR+XPX$PXXP^hS1 4CQ~狗1ۅ~ CP9䋇1ۅ~ CP9_8G8E9؋3u+C BCS $T69]u֋ppE9؋3u*C BCSǙ$69]u֋+C t{t Pf ؋PHCtƃ PXCP ̺P̺XкPк5Ժ_VmԺ غ[QVغHZP@HXP*X@ PОX=; WÞ^@ S趞Y; R詞X@ P蝞X@ P葞X0? P腞=@ u e[^_]B 5@ V][ @ QPe[^_]B)C t{t Pf ؋PVtCt̃ PXsV5봋]4u싇d91v$utUP$dE썶_0G0E9؋3u*C BCSה$69]u֋_HGHE9؋3u7C BKCQ7ZCP$w69]uɋ_@G@E9؋3u GC BCCPXCP1XCP'$69]u DS" K3QZCP蠜$u׋,& C3PXCPh$u׋wdC$t/ CP\ SDI NHt; P JP H P*[NQ 4$ut>^HUtɋC d Sʝ9L= P؃u RaXPTXPG${Eu F$EFPP_^SFYV R >  D 8 VI1$a2$2 < ޅu4? ue[^]vUWVSEM] SQXZh`j/^_hj !Y[h0jXZjj "} 1 t&Pj.ƃu6t,l WjjjjEE' Ky4?  QQhj5XZh j'Ѓߣt t кܻ ĺtn̺t P$@5EESESPjU衴9!=1~GRt8U܅t]WPhSYURF@95E܅t EP кPx кt/t&xt{ tu95tptt; PX=W^S #:= 0{F jBEEPPEPj@PPE Ph #=EEPPEPj @5M WVSh8# S.葷dĺm۝ ĺV P@  hKZHP P]@=PPE Phhx"Xj/*E WW0Vh"QQPPPE RPh"  PXPXP( PY =кhhAW@9RRh.PhEM WW1VhT&M SS QhM WW1VhTl!u jttP PPE Ph!XM PPPh=M PW1VhPlS@tpE RQhM ̺SQM Rh u  BкE VSQh뼐USMfAҍu1[%]Í'US]E Ch@J‰1t#1t&ʉDAv]ÐUWVS] u Q\Z|S{T‰Ce[^_]Í&UWVS } WU^ 9YtPPWPbtC9Xue1[^_]Íe[^_]É'UWVS } EEPM^ 9Yt!ƐPPPPtC9Xue[^_]ËSCBCE]He[^_]v'UWVS }tM1  SWSCBC9uFv PbGe[^_]ÐUVUUUWVSu M]~)<;}|o{1%A% Š1҈CQA% ŠC1A?Cu [^_]Ê%Nt>1ҊA% ŠC1ACC=C1C=CېUSQ]{t]Ë9| C]RRjP> C]Í&USP]C~ t C]PPjP> ⍶'UVSEP@p@9` SO9`ue1[^]ÍvUVSEP@p@9` S_9`ue1[^]ÍvUSR]Ct0 1]Ít& P1C1]Ít&PPjP> C뻍t&'UVSEP@p@9` S9`ue1[^]ÍvUMyt]fABHHIHH]ÍvU EPLHP@L]Í'UUJLBPABPBLBPBL]ÐUV1S=XtC0uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC4uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC8uCLX=ue[^]à SЃ ƋCLݍ'UV1S=XtC뇍&E ;]%uve[^_]ÍE9sJ'UUEutËEPE PR/ øw$ÍvUSQQ]jnjh`$@1҃lwRPShbf``Ћ]ÐUU0 vv %&]Í&'USMȊt-1Cu.t:t _t-u Au1[]É[]ÍUSMȊt*1Cu.t _t-ufAu1[]É[] UWVS]S1Åt^PPj:Su1t@jj jPƊ<*„ Шt7fff Se[^_]PhSju S`tȋ@렍&UWVSE}WDžPPj:W|1EtBCPPj-SƅFjj jSojj EjV]Ɗ<*„ ШtHEffE UfEE0 WEe[^_]PhWju W tNj@돍&B'UWVS(EPǃ1txEU PPj/WKÅpPPj.VtCMSQVjtRE RPWjtB W؍e[^_]ÍvEjj PV{t UtF:tA1à W$t@U 렋UE RPWjuà wt )ȋULE>'UWVSEuEuE}uF11ҊڍB=UuE@E}}EtOFYЀ ƒ.%u3 vE.…%t8}t2GEu}~E UE)[F^_]Ív1[^_]ÍUS1ۋU t&ABHЃ v[]É'UWVSP1ɋE]߉f@f@E E9vl1C9//:%uف//:u=K&UF‰U9wE E}pttht1e[^_]Íe[^_]ËEPS'^_tӸP;:t fUfBCSY'UWVSVVMEuE;M s>] K] ;M s/t)؉%}E„uFA;M rZY[^_]ÍA;E sEA$AF$A U1҉M%ATPЊu]É'U1҉SE ]H1ҊCTBЉI[]Í&UV1SE ]HCPЍ w 4I[^]Í'UVS1M ]~,<-t,I4I~CPЍ ~[^]CCPЍ )I[^]Ív'U1ɉVS] utA-t>K"c $ 9|K~EFPЃ ~Ը[^]F&fFPЃ 433|ލ )9ЉK׋E1[^]ÍUWVS1U 1E-] E K] u(f | }wuEEMU]9]|E9Mr@E‰Ή׋U ߋE JU EMƒ0AEM y[^_]ËE@EwvUB0EU ҁ333 |ȁ4333rEEɉȉU+EUEU9|9wEΉ‰)׋E HE E zE0x1[^_]Ð&UWVSEE]Ew$4EQEt&MCBE QЃ vmdEE1ҋEuE1҉uu E1҉uu E1ҋEuE]MM1ύ\E 1[^_]Ãstut[^_]Ãhub{sX@BNE@BEE<EQ{st < UWVS 1ۋE }9}?tC9}<u CPƃ1tPSWV9e[^_]ÐU jhhLv; %Ðt&UWVS ]uSu*CXC CC$S C9s()‰9~-e[^_]Ít&1^tCS 9r؉)‰ϋM WVQSRKC,{C,sDKSH9t1{%ɉu;K(r pfCXCʍv'UWVS u ]Nt*St01^tCS 9r2)‰9~)e[^_]Ðt&CXC CC$S C9s)‰PQPCPN{S,K{F‰S,FCDSH9t2{%ɉu;K(rFeCXCɍUWVS1M]Q]U EE)Ћ})NjS :9s}C 9v9~ME)VRURPE EPEPE PC;E vCC$;E vC$CCхu;C(r e[^_]ÉCuv'UWVS 1}U ])ЋU)‰USE 9sqC 9v9sy)PRUWPuEujC;E vUЉCC$;E v}C$sECхu;C(ru e[^_]fuCu{}uM PWVQo|vUWVS 1ۋu}N99r e[^_]fRE )QE PE PEE…%uTF;E w>F$;E vF$FFхu;F(re[^_]F뻐PEP]SM QE U D 농t&UVSEu] PEPF)RPV)9Fe[^]ÍFe[^]fUWVSE} EE]EWhSMQJ W$RG PGPGPGXPhEP%E G9EvEEPShuV;]}3ރtvPD;XPhfEPt2C;]|͋EEEE Ele[^_]'G냋EH9tPPEPj C봍vQShqURdPD;XPhfEPLwEPjjhz믐USDt0tf< EčERRPEPi蔿 ] PEPEPEPEPhPͿ S]SQiZPݿ]ÐUSDttf< EčEQQPEP Uȍ] PERPEPEPhPMESPP[ Q]]ÐUSQ]ttERPE PS$(]ÍUVSuPPVP蔾tKye[^]Ít&'UVSuKxPP VPOue[^]Ít&'UWVSEE u]= Ȩ< ;G9EPS)PRbE^);EQED Kx(EE‰EEEx2M D ÉD D D }G}1;}t&D1һfft3 G;}|1;}Dž||G;}|[|Et*f>tE|E 9D)|D)D);E }E »tt dd0gfffttKttU)ʉttw)K^Mb)ٍe[^<)ʍ_]ÍUWVS] }stSWYZ1҅x Ѝe[^_]Ë)ЉwMb))ʍʍt&UVSU ] )ȋJMb4C)[)ʍ^]ÍUVSEU uHZًNÁ?B~FC[^]ÍvU1҉VSM]u At$VЋ=?B~-@BCB[^]ÉC&UVSE UuXJ)ˋ^)~ x'[^]ÐtF[^]Åy퐍t&@BFA[^]ÍUSU ]MBt+C+~4xA[]fA[]@BAB[]ux AA[]É'UU M9t%]Í&B]9A%UU M9t%]Í&B]9A%UVS]jh< ]\< 4‹ < 0uȁ?BEU;; %PEh; P~E 9E%EU; ;  ; Mb)ʉ< ҍ)Ѝ< ; £ < e[^]f@B@UE;; 4;; )E9FRU ؅t1Ph; V< U)‹E +< x:40#< < 40EU@B4B0UWVSE8]M Ef% fQ%غE.ų))) 9Et[؉ھ )))9Et))9ufu#P<ERhPe8[^_]ÉڹQPЉ )ʋMRhQүU‹EHUE%&E.P)Rhh8莯8EEvڹPЉ)ʋMRh QFU‹EHUEf8?ډ)UWVS}W> 5HL0$\0 … ШuAf\AY C@Y ;|rA D3$WHD> Hx4 HȀxu t&Jx (ʀ8t > e[^_]ÉA됍t&'UWVS 1=D9}-1PPEPt< P[u ǃx< F<9|Սe[^_]ÍUWV1=D19};@< tF89B8~A<9|tF8t VV$uF8te1^_]> e^_]UDV1S9}1@< F<9}"tS8t FSS(D<9|ލe[^]Ð&UWVS EPjjhEEE D19@< t&EEuF89B86x9z8~ExE9B8}z8C<9|Ã191 C<99x< uPt< PEh,P֧x< MQj jh5C@< $l< EPjjh@~E@EPPEPCj 軩 D<9cv}19} PtUB4uDMPVShtQe1[^_]Í&UEPjjhUziRPEhiPҦ'URR> uà h> Ѓu h> > 1ɉÐUSTt'B PTLHCLPЋ]áP19~XtLJ AJ 1҅t̓ EP4x8ڋEC CECP@P뒃 RW믡XP JP 1i&US]CPqXKQgtXP JP P]HPÍv'UUu&TB L@TLPH]P]x&U jjhUXPLÐUWVS ME ϋ]MNJt<\t,9CAu9s ȋU)Ѝe[^_]ÐC3DPt>uƒ0CT~ƃ~)49stERPQiuGu+& E@Pt{@ SM QURh 6yƙ E@Potd@QPE PEPh\腙_3VlZYPWs^SUJQU REPhDžt {<_3V#ZYPP*3_VUZSM QURhPE PEPh Fu5UB8jj jPTurUB8jj jP=@=`@ h@PE PEPhL@DžtERX u1uۋUB8jj jPw u1uUB8jj jP5u3 ̺RUB8 Pљ̺ U1۾B8E W Z}D8h%U tVf;uӋĺĺE;jvPE PEPhPE PEPhDžhT MQ:t&SPPRBuU EQRPh/Dž vމhPP;u鋅@  L޿/}_@E PdXPXXPL_5V? [Q2ZP&XPXPX=(W^SYR݅ ŴP躅@~HhVB1iu1Cdu1C,UB8jj jPt5hll 9tꋽl9luփ E QRPEPh  Dž_E }SPWh\Dž:M UVVjSQRjP t DžUB8PE PEPh#u}PE PWhM} uPWVhſuuPE PEPhH薿F1tu1Ccu1Cpu1CB  n1ہ UB8 M UÃ8uLh hPeM hyW萀l@Pj hhlVu^ShQhhl}PPjPE PEPhjPV t DžhxP!׉x ޿ u^A d)s A=M USQRhcDž0u9F } uPWVhDž8 EDžDžp>3 UUUU}@:1au1Blu1Blu1B! 1ou1Bdu1Bdu1ByEE _}PE PEPhDžhx1au1Ccu1Clu1C} OQ:t* WRPE PEPhDfDž PPh0PEP%E} u@PWVhu]>u WVSh\Dž޿J }PPjPE PEPjW t DžUB8h @ DP9~MXhAPV} DhDPK| uHjj jF P@| LjPFP葱t] >]u WPVSh边 nuE RPEPh\菹DžDhPRRhP*=hG%GEp>UuRF@FC}~~PE PEPhw'MuD81C X uD8DžCl C @jPhChQKv E} uSPWVh蓩 CV o}wW=hUB 8t4R1lu1Beu1Bnu1Bu uF8u6} WRPE PEPhH PPjjláhXEx WkU Cr Vj MCjj jIQj C @jPh%ChQKE u ]PR8WVSh u} uPWVhUQQjE RPEPhjP t DžMA8h pÉpSakhǀYREkuXhFPbj=h PQiDž Ep>tX5hFFu@;u=hPЃ H!ƒ t1PE PEPh~hQЃ4H!ƒ4 u ]WVSh03PPjG=hPE PEP(PWi ]h$J!J މuC5hFPE PEPh舥8މu?5hFsh$Z ÉZDžމ{ 5h~~cuvuD8t9DžEPE PEPh衤DžVU } uPPWVhp Dž% J uD8 CDžFJ  UPPjPE PEPjPr t DžMNq u1viu1Ffu1Ft%8 PhS0PE P #E AhtQtp E RPE PEPh DžMPPj} uhPWVjSY t DžuS^uBhH@Hr} uPWVhx薟Fb hPPu ]WVShAkJ/OuF8txSSPdPaEU QRPhÞs}u} PWVh@蔞D}PE PWhxjm}G8WWPdP蛈] MVSQhMPjPAP耕} uPWVh话_PE PEPh腝5sz  E@81=12fGu*u% _t-€.%u F<1ut <7t6E HQE RPEPh,莜 >UPPBPdP荄} uPWVh? M1I9tx1} CQ^t08uRRVj_NjE @PhKWX`U4B 8uv8u غhdVVWP( WH_PPdjP7} uPWVhhdQQRP9PE PEPh˚{}PE PWh蟚DžT މ5h^^M U ES QRPh= Dž uD8tJCDž<cމ5hN Nu PPE PEPh蛙 DžPBuD8Cjj jP[--k PPE PEPh DžމH}D.W@RRj.PhXAu \S裆Hh LQ[F}u} PWVh<>Dž 1 P(ZZËUDPZt 4$Y}XDPhPhVSZhW[h #u TRPE PEPhh) EU EQRPh\Džv uyAAU] M2VSQh論[u M U~WSQRhu %޿ 0}W:QjPR蛍Oh( dP|rPE PEPh蘕HU}BPE PWh8' WKY ] MSQhBMPE PEPhMPCPhKVYUƃ8u܋J7UPPj=hBPE PEPPW ]hJ!J9Z UPPju :]WVSjQ蝴 t DžMRRj:APS} GPBtLhBAB AB$A B(EPE PEPh\诓Dždu ]WVSh臓7uPE PEPh XMPPjPE PEPjPW t DžuF8\ } OQh  W}RPE PWh< 萒 @UM USQRh\aDž1lu1Cou1Cgu1CEX;t-@8u ;t uF8u%U EQRPh ڑDž P?Å)}G 8U1B8pUB8/. P…xB|BEB fDžxEfzu fDžzhue xQjpPRShhu]~u WVShDžvu ]WVSh蜐DžQxQjpPRXShh Pg}…t\xQjnRPSfDžx PTDžzMAPE PEPh$S Mu ]jkyWVShLď Džy PƅG PE PEPh떋^M USQRh BAtv1iu1Bdu1BLuD8jj jPO=|` @dt9t ;|n苅E<>RuBǃt I C hPlBPlCCtՋfu_fftfffuCCufffu*ht7fx t&f@f%ftKKPf@f؋} uPWVh0 Y PE PEPh /hxhGxhMEU IQRPhfDžEPE PEPh誊Z%+}D8jj jPdL~6tUw}EU QRPh 辉nM} uPWVh舉80C 5 ?x5E$ICC}@4!} DPK CLQJC_] MVSQh4 PPE PEPh  骿} DPJ CDPIC WP6W66 _ hLr}D8 PJ}jj jDPIff} DPt…tOBBB 뮋EU QRPh ^UDPE PEPh'׽$u_Dž@4P}jPDPr}uGMb uFǃ } uRPWVhH T  5}D85CCP PP|W*t…4C\BC`BCdB Ch9tgA=N4F4:4924)PPrD6PjMH1ɉ‰p 0~fDJA9󋅸U8*5}t>_4x%4CC5ĺ5ĺu 9n}jj jTREC<}RjPDP{tLuV}jPLQzp4VV}SE U QjRPh ͂ } RPE PEPh 薂 FP}jPDPz=tz}jj jDPmDƒD8.Fu]}  hDžwǁ$ >W}D8PPPDPk h!ÉE;a鱲UM ZUSQRhtzDž醲 YYQ>$h;tRjhP^=5h}džwDž> }D8BP PPDPj h !ÉE;acUPP} uPBPPWVhty Dž)މ}D8/ P=XDhP3<h  P; $UPP} uPBPPWVhx Dž^މ}D8 PIb j7tRjhP9,hǀ0Sϻ6MAPE PEPhxVvDž u U ESQRPh%v DžڭDžuPPj} FhuPWVjSS t Džh ,Q9=hUGLJ,% GB8}w > P74$7MAZ8ts P}7à So6=h,ZUYB8uMPA PAPhS,PA8 0馬Z 떃 P7p4$5h,WhV,V7 0W j5tRjhPU7,hǀ0ESSjU HEQRPhjP螔 t Džht B BA A顫}PPj5hG}PE PWjV) t Džh ,S7hBǂ,% B3(t-uh Pd5_VU5t4$I4h,EYP R@PhV,W96 0鞪 j4tVjhP5,hǀ0\EU QRPhr2} uPWVh@VrܺVhjphP4h jphhd P4hx2uPPjPE PEPjPܑ t Dž}G8&QQj j5 ËEjPRS&hjjSP M}P5hE PWVÓ 鲨MUM SQRh\pDž鈨9}PPjPE PEPjP t DžUB8\&QQj j%4 MjQRP&hjjSP}5hP}E PWVӒ §uM USQRh\oDž阧AUPPjPE PEPjP t DžMA8QQj j53 ujVRPuhjjSP-}5hP}E PWV ҦEM USQRh\nDž騦I UPPjPE PEPjP t DžMA85QQj jE2 ujVRPhjjSP=}5hP}E PWV EM USQRh\nDž鸥R UPPjPE PEPjP t DžMA8QQj jU1 ujVRPGhjjSPM}5hP}E PWV EM USQRh\mDžȤ\ *UPPjPE PEPjP, t DžMA8tA8u/u} uPWVhl0QQj j20 }jWRP9 E @PT/PhjSPU} uhPWVSώ 龣EM USQRh\kDž锣FPE PEPhkg} uPWVhk;FPE PEPh^k} uPWVh2kFPE PEPhk鵢} uPWVhj鉢e uPPjPE PEPjP t Dž}G8t G8Eu ]8WVSh=jo1tsPPEjPE PEPjWU t DžUB8tB8uYM] 1MVSQh iY}E RPEPh\ziDž/PPj j1- ujFPS@} WS,PhjSPu ]PVSh8h駠w/MWWj] 1MVSQjR t DžuF8PPj jD, }jGPSu`hjjSP@EE RPEPhP UPE PEPh\hDž鼟u ]WVShg鏟PE PEPhgc /MWWj] 1MVSQjRLJ t DžuF8PPj j+ }jGPSxu`hjjSPEE RPEPhP賉 颞UPE PEPh\fDžxu ]WVShfKPE PEPhof /MWWj] 1MVSQjR胆 t DžuF8PPj j) }jGPS4u`hjjSP踂EE RPEPhPo ^UPE PEPh\eDž4u ]WVShWePE PEPh+eۜ /MWWj] 1MVSQjR? t DžuF8PPj jx( }jGPSu`hjjSPtEE RPEPhP+ UPE PEPh\;dDžu ]WVShdÛPE PEPhc闛 /MWWj] 1MVSQjR t DžuF8PPj j4' }jGPSu`hjjSP0EE RPEPhP ֚UPE PEPh\bDž鬚u ]WVShbPE PEPhbS MWWj] 1MVSQjR跂 t Dž5h }W:td CR(%M UEhSQRP$ 飙UPE PEPh\aDžy}PE PWhaMuPE PEPhnatYt=MA8tA8uTu}PE PWh `Dž鰘UPE PEPh\`Dž醘}VVjM USQRjP t DžPPj jW$ ËEj@PS4M qVy#PhjSP>} M UPQRh8`͗GPE PEPh_頗ESSjU EQRPjP t DžUB8WWj j=# MjqVP hjjSP5|PE PEPh8_Ė}u} PWVh\^Dž隖ESSjU EQRPjP~ t DžUB8WWj j7" MjqVPhjjSP/{PE PEPh8^龕}u} PWVh\]Dž锕EVVjM USQRjP} t DžUB8tB8u/MPE PEPh L]PPj j uj~WPv} GP PhjSPyPE PEPh8\t}}PE PWh\\DžJuM U^SQRhj\PE PEPh>\FUVVjM USQRjPR| t DžMA8PPj j uj~WPuwhjjSPxCPE PEPh8f[E}PE PWh\7[DžNEU QRPh[鿒PE PEPhZ铒 IESSjU EQRPjPz t DžUB8WWj j0 MjqVPuwhjjSP,wPE PEPh8 Z黑}u} PWVh\YDž鑑uEU NQRPhYaPE PEPhY5trESSjU EQRPjPy t Dž5h MQ:tK CR颐}u} PWVh\XDžx9u ]WVShXLUPE PEPhmX t$ t AuRRjPE PEPhjPrx t Dž}G8Ejj jXSU 2\ QMZËAPD$uË~5WVh S Dž9=@~ۋM UVQRh@W$ Ԏv] MVSQhV駎 C tރ~ F uӡh 4Wqh48 Qx}ZËGPiD$]ËGPP}PE PWhV鳍PPEP~ W* UdS Qhh^h hEh^h hRjPV |/DE h PEPhUDžE h PEPh=UDž dM} PuPWVh4 U Dž鿌PPEjPE PEPhjPIu t DžUB81QQjP#ƅRPVjD^~8 }]h^G} PWShT^ Sl SPV9E PR@PE PEPh0SV_V開M APAPE PEPh|S x VO} uPWVhsS# VWUjj jJQDž94=KA~E VPEPh}SXP頊MU E QRPh\RDžvRRj jx UjBPSu FPPhjSP_o>]u hWVSQu uPE PEPhPtEE RPEPhPtʼnFPE PEPhQ阉h 4Rh48X|uEU NQRPhsQ#PE PEPhGQUBPE PEPhQLjMAPE PEPhP闈}jj jDPC0}jj jDP=wi}jj jLQC, M UVSQRhd7P  u P]WVShP 鳇u} DuPWVhO| <xCM UhQRhxO( E hh PEPh8BO .PE PEPhN駆 _}D8tbt PU TR P C|ĺĺU} uPWVh9N Pc<…t^{ClBCpBCtB {Cx M Uh hQRhM sEDPE PEPhM< E h hPEPhVM Dž }PPjPE PEPhjPm t DžUB8ah PPPhMǀǀXAP;h}ZAAA ZDžw>.}\;~xމ;hHHĺĺ};{颃EPE PEPh\KDžxPPj jz }jGPSuwE @PPhjSPeht(PE PEPh8HKU}5hPE PWVmۂw] MVSQhJ鮂 <މhPPE hPEPhJSUBPE PEPhsJ#u} PWVhGJuFPE PEPhJǁ} uPWVhI雁u}FPE PWhIku ]WWhhh VShI 1 މ}D8ht P h} DP h P =ĺ=ĺ}M USQRhHKMVVhhEUM SQRh8`H  S6t9hAAA B Bu}DPE PWhG&UWVSD DžuDžhDžV IRPhPY  ADžVX <0)=1F1DB u1ۊtot&\#€  Шa X1DB F1DB uCƒ?%u8{t}<#t)< t%< F€#%t t uPPP)Ѝ{@PWPEPhE C@~‰1nu1Bou1BDž1ۀ8t C8u싅t4uPWVh@EtS t:t)t  dDžQZPd}PPPWu ‰ dP6XdPe[^_]ÊN €\ Шu~#tyrntxuSF9s FP?1lPPEPhCFDžQ)F@RPV)׃ =EhRPhP2C    tFtjU]WVSh|BQ dDžPXPdMVPSQf FP/|F F00 w< vDžݍ&'UWVS$EEjjSEE uЋ]쉘Eu E t&u~  UB M싑t 9Du~NpFMy @t ,uFt F Ex,JExMϋqHH9t^Sj]KQV R=EÅ;E N Q^ M1ҋxtx ‰x69u]{wlt xt"tTuFdtJt u6E P?U WPhy@uu}tEM싑|9Mt9MAFu싆U싂PjhhN]u u1Fdu ЋUBd8EҋxduMApǁ%ǁ=6= }WG]f{yu~w!tt L Exd2UztBwu_ t4M Q=] RPh?>uFu?uu~dW0G,9BW,uPPj/VÅPPjVJCCEPPSuVCƅ@E9EtMË@Q%@@9 PO?.EÍx\0t&EpXu9X\tuF@t BBu쉊ǂǂt~umUBVjXSH,QAÅ;Eru ~,WQx1҉^,tx ‹E쉓xxaS E{uVjjK Q@ƅ;E. { WUs x1҅tx ‰x뛋E싘CHd8RRPh;E@EuF [V PNp< %FQ:RPhbhT;EE R:] VPh:MAM] %CWY:VPhShT;]]! }W@uƉuMAP R9 RPhA:E@EF R9] VPh\:MCMPF PU싂Ph9]C6]jt uG09E싘 Q89U RPh9E@EbU싒U}  M  t71ҍu싂$Ft5ĺ, Ɖ5ĺ uхt11ҋu싂Ft5ĺ Ɖ5ĺuыE싀EuE~ }}Ee[^_]PF PE싀Ph$ P8ZYVSQu싖RPh\M8E@ ?E]쉃|[u]uPPSuV=ƅME Q7$RU싲VPh|M S\7ZYV]䋛SQu싖RPh;RjPhV<MQjPhV ǁ0~j~l] ,0ShPu싆t[|4tb]쉃D EP7 VAET QU쉂|u싆tm MQ<MUƒUu^d Q5 RPh6iU쉂[PMA,PPh5E@ERUB,PPhPC Pu싆Ph$5E@Ev hP5EEe[^_]à P 5] WPh|Q5uFu P4 RPh5}}M S44$Q]싓RPh RC PM싁Phh !'UEP]fUEPQP@ ]ÐUMAt ; 9}]Ë ; )Ћ]ÍUUJtH9ttu]ÍuދܐUSá; 0(@(QS3 RPh 3XP13YRPh jS;5]ÍUWVS x@P@E9tg2 f69tYZC@%@HuC$u߃ C$R[C$u Sz<C0@6C0E@9EuEe[^_]Ít&UWVS1 tn1Qt&FtVtLX PW[S$u S;C0G@C0F,t VT9re[^_]ÍvUWVSƋ9tJVNЃ މE; ylYh VV E }EEXZPFF#Quw$Ph#h^W 0  F4N$PEPFQPlt Hh#tw$RPlR@hPh h^W/(h hK1}tlh hKjNQ2t FPltTvFtt&udže[^_]h hKj뒋xhu롃 R@Ph#h^W. t&UWVS Ƌ9t%u9|He[^_]ËNAlu yhm ; 9}Ӌ)߉F ƒAFAqt!8& ]VE XZPFEF#Quw$Ph#h^S- F4NPWylt Qh#tw$PAlPyhWhD!h^S~-h hK/Nh hKjQ0 FtYuc0; 9})É؋,É,0d VЃN R@Ph#h^S, Vv'UWVSËHu H@S E XZPEC#QCuw$Ph!h^V4, C4PWCxlt Hh#tw$RPlR@hPhD!h^V+h hK-h hKjCP#/C xluphtTCt&ue[^_]à R@Ph#h^Vc+ 8륍t&UWVSËHu߉H@SE XZPEC#QCuw$Ph!h^V* C4PWCxlt Hh#tw$RPlRxhWhD!h^V*h hK,h hKjsV- Ctue[^_]à R@Ph#h^V+* PvUWVS|}Ht|^@DtBF$u V4F0F0PPjW> Hde[^_]ËSB u 0,EBta< ȉA h@@EPQW;ES8 EHD1v tPEPQh C@UM  E#UE#E#E#E$E$E$ǁ X-HaBproxBy-SeB rverB-StaBte: CEEREt )эQRDPEPsZYEC4PS)PC$PЋH|щTPSэD1PԺPPCQh"EUPM0C@Mt\ E; 9}@9|<)ʍ}RPh$EMPU‰UUM B EDEU Ƃ  BƂ  BUƂ Hde1[^_]è@FCLECPECTECXEfffEPEjPWbu rtswt j%dCt  < t UEEEHF4Et?ȋH9%E TLQ%,6&UWVSMHtu~@}䋇|Dujh^h VR…uF@E  v ,$׉U䋂t}HDMSSjQ> EP$u P/UMB0B0Hde[^_]fEt(~u <wiu䋆hE@t~= 2&M䋁f 2<w.M䋁}䋇E@tuFt ^։uU䋂U䋂U8 QHd1UWVSEEx@UEBUxLЃ>UB4 < t )Ѕ$LJEe[^_]ËE < H4t)ЅGS Gx F LJPjjjƃtl9HL$D E… Шu"AUfTAQ B@Q ;A D$V EH4 < )…uUɉB4 < uf;H  LJV8Ⱥ1~f QWȺȉ)΍6P$]P$ 4$M}fEƴ fEm]mƋE)ƃ  < WcEX4W@tJ ;  9!⿉WWBqt=\Wt:G@@t1 tn uuЋH9|~ LJVn7Ⱥ1 QWnȺȉ)΍6P$]XP$ 4$M*BmE9WUBq)ًET}U WЃU < J4k)…_EɉH4 < u;t&;H E5 < H4)|WuuEH4tڅtʅt )؅~ډыUɉJ4u"PhjV@ jhpjjV @G@@E؋E܋EEfffEڋG%EE=uE EG\EȋG`E̋GdEЋGhEԍEtxAxED$VMIMA |1|t/QfDQ%EB;gA|HA ExD tD L$ffEʋEPEPEPVAE#EHT L$҉U… Ш&AUfTAQ B@Q ;AAeWB%1E=u Et" @PPjjV5 WMSPQV@tJu-G QW RPh<"]PjSV1@srj t&GLE؋GPE܋GTEGXEPG\PEPV?EE[}}8PPGPh"t&A jhhj jV VHDF;> ~> HML`DDD \DDPPjV>  < uEH4G < uڅtʅt )؅~ڋMQ4G PW SPh"/Ӆv)ЅjuUB4у G|@PSjjVd jOlEMJQRGPh(#Zv'UWVSE EEEfEXdtCvuEEuЋ}D j$7 EEXdEU‰E Ct; 2DB @B DF @F$EF0FDF8sHF<^@= < t S;E S‹EЃ}~4tF t;~y V!uMEFuMEEe1[^_]Í& Sg=~'Et SM;E} S<EE@EDU@ RgVSEQht#1e[^_]ÿ UWVSQ]CE9r`s,C@tI ; 9}09|,)ʍQuƉZ[^_]ÍK0{,9t׉1u9sU jjh8$0? %Ð&UMQPQQA ǂt)H4BJ0? P JP ]fBBJ0? P JP ]ÍvUWVS uN41҅tV@] ыttXt tO1t5YQ K$K$V BV U Xu ؍e[^_]à VЃ됃ttNWEA9t0%{n&#WC]9Cʼn'UWVS uFVEZ9~ }7PPEPVt$XC$u SC0@C09~ |ɍe[^_]ÐUSR0? ] B @B 1tdYA C$uQSA@;~C]ËtBDAJDB@B4@B4;B8~B8S븃 R葆JUWVS }]ECD(f(tQWVSDR?C$ C$e[^_]à WVjPjP @t̋C$ C$e[^_]ÍvUWVS\EHTػ 9 < 9JhDžPQSEPD@ @ 2 J AJ FF$F FF(fh) @ ; F5@ 0@  B @B  A C C$C0CDC8RhhRPL9 ]ShjQ@ jhpjjR @gG@RV^r@B ~> HDTHDA(F0DA,DF4D GLGPPjP> A$u QC0C0@;vF$tbV ; 9.KAK;@;v v < @ < $< @$< 9 e1[^_]džPFdžA~$ VfHjSPjfft&t&yh VVGl!;G_F$ jhhj jPF jhpj jP$ G\t&ǂBB\B$B0BhBtBxB4BPBTǂǂB,B(BpBlGtB4A\ bZ CZ ɉHXRPjQ~E 6Z CZ ɉ]RPjQ> f@eZ CZ ɉJЃfxtf@ f@f@GvB(XP^F$ uVDž`$DžPPPPF0@4F4@B4G tDžd$DžQQPRyF0@4F4@C4}SjQP{9'j.QPj h0f*fffx$% t}$RRQSPSh$jW$0~ RQx R>xU Q'x= Qx‹^0~$,HjSPjzBXjPPjX f*fffx$% t}$RRXQSPRBX Vt; X KX JtH IH tP JP HXtX KX t; P JP =O=FBF@ 0p Np Sge1[^_]à R`vF CXR@v R-v V Q@ 0P JP  h$XPG  h$Z)ÉHBB h$_XPrG s pj a 5> VSh<%jW> h%As)ƉHttCCg: > PPh%됃 > PPh$&viRBC눐&UU Mf%tA A]ÍA A]ÍUE Uft ff%B ]ff%B ]Í'UVS] u{$y/f(%t<0F Fe[^]à Sf(%uŐ,F Fe[^]Ít&UVS] u{$y/f(t;f*f%F e[^]à Sgf(uf*f%F e[^]Ðt&UE @E]Ðt&UhfÐUUЃt uuuf-]É'U&Utt)t&]ÍUWVSn&EEE؉u}}UU؋]عxtk& EuxxExEP:PEjPRUuQPuRUWPSh4'uV]S\E UEEe[^_]ËMtU9tSht'UREPEt+z u^EuƐE Uu||U SPh'EPEPe[^_]tT& tD&tv& ubEu&ƄEgUuˆƈUCSh'EPEPT$uUu”ƔUJ t1LuuZUu€ƀUVh(MQURbEuƌEE{EPhh(.t&'UWVS&]EE uuE &uS}:EjjPRƋEUtREt=UM9t) h&h&h(EPEP\E 7Ee[^_]ÐPM$RPh&h&h)벃 h&h&hD)]MSQ몃 Ph&h&WsVPh&h&h)&UWVS E}  t&t;!9uPPEPPuϋC;E uLEu]뻋Ee[^_]ËEP4$$PEPh)e1[^_]P$] S$MQh*XE ZP}$hL*빍vUWVS 1u  t0!9uPPEPPFuхuɍve[^_]Íe1[^_]ÍU1WVS 1}t-_dt$t&PPE PPtue[^_]Í&uދSQU Rhl*e1[^_]ÍUSP]uRuthCp0C%C1]ËQRPh*tQRPh*rkQtRPhD+BhIQDRPh+Cp'v% CpQRPh+0t&ϋQRPhH,C%C1]Ít&UWVSDžt5 fF uDžputz{uPxjdPSNjEutt ttpۉpupuF Ph&jVtte[^_]ËQ}x$RPh&t t[ppeP%x$QPh&릐t&US 5  jjv{ tj(PPP$h&(ZYPPP$h&jS(  < tu]ø䐍t&UVSuFt&PPjP蘶u"PPtuP Q薶tF ue[^]ÍvRRjPHuPPjP> ~ tF 뺍&'UVSu t&t+ S{~ S[4? H4? F e[^]Í'UWVS < }5 9~ _tl9rЃ~ u SguF 뾐 SCuF t~ u͋5 5 }t&PPPPPPPh,1 SQRPPh,jV>VedtG~ t < t )ȅa9YӅt˅t )Ѕ~Ӑ믍e[^_]Ë SuF {SjQPHgP < tڅtʅt )؅~ډI܍'UVS1 PPjj8C PPP$h'XPQ$h'jSSD{ tKRPPt$h,GXPPS$h,jSc %ue[^]à h - h -jj)e[^]t&'UVS PPjj t&{ uPPV$h!'{YRP$h!'jS3 C tPPtuPPȱu; < 9~9sPPjP> C 렍e[^]f~ thfFfƋPQ$VhH-XZQR$VhH-jSSKfFf떉'Uh4ÐUMyt]fAǁǁ@] UWVS DžtUB@@9Љd`!t ‹;dt`R1{uҋsplh{A  RVh.hP =  PVh.hPֱ = Pٮ P迮PPPV赯PjlPzPfDžxK ƅjjj趲Džc9RhjP蟰@0PxjnPWepƒl ШhWPPjW蔮PPVP P谭;C HDG;> ~> HDDD D\HDD1te[^_]PPVh.` h(/08PPVh\/f8uPPPVϭ8 PPVh/%놋hQQRP@PPVh/ PY<$$C-QQVh0PlPpPP!@ 덃 ht0WWVh0uPPVh0fjPPVh1TYXVP٪F88 V藫'PPVhl1UWVSEP@x@9`9`C~ۃ PP CCjtjjVƅxPtjlPzPfDžx议 xjnEPV舮x7 VH\PPjP> Cdt&e1[^_]Ū8ou tQq뫐&UWVSU=HD`%LXbDždhPdPREPn\@0`9 < 9@  z Gz @ ; CC$:C@ @ C CC(r Fr } AG G$G0GDG8PRhhRPs\9 =VhjQ@@:`\GD_@SG<KD{CCǃ|C4C0C<C8ChCl{@CP{CTPCXC\CHCLCtCpǃǃ{xǃ{ǃPǃǃǃC|ǃǃǃǃǃRjDjP> hjP( ; ; ; $< fǃfǃq Fq S0BX`B4B,B0BB B$BB(^C8PBLT ; spBDBHBTrPS`B4BBB 6A @A S43BXrLB B$BTBP`s0B,B0FFF8BB(^B4B BBBBB8BDBHBTSdG4t F B\4HD@;> ~> HTDL`HDA(C0DA,DPC4LD PPj\P> G$u WG0`G0@;}>X5 < $< IFCX5 < $< Xe1[^_]PPj:W> `A룃 R(V RV QV& QUK0t; P JP t; p N8p I CBC@ P JP \Poe1[^_]à h1T붃 h1Bà h%0l h$鍴&'U1WVS\M 5 A1DF u1MtM1DF A15A1DF uGLƒ%붐LG~u.18u`].ubU:EUǀ|B4@<QQPRe[^_]AS.K18uE8EǀUB4ǂǂ|@<QQPROE8E8Ejj jRlUjEj jPQUEjj jP6UEEǀ|@48@<8VVPRjj jPѢUUWVS ]u |tt e1[^_]ËS0PBzXPj WtPPWSt7ueuau]V8 < t)ʅ~J t |u= @PPh-C0@LPǃ|1F4e[^_]Ðt&C48@8ѐFS0ǃ|fǃ@ t&C0p4߉p4ǃ|1e[^_]UWVS EU@@B0EUZ0J4$E9MAHJEH4EX0CL83E uE1EEpt6CL8v̀C4f%1ƉptEC4u'CuCC,C4u u CL8ЉU% = (%`=@%` = `@E1ЩptECL8EUJ4vE u 1߁pt)ALڃ8v΀%1ÉptEQ4u. u&AL8vA9A,sA, uA0=9% = %`=@%` = `@1ptEUZ0CL8E9EQP U%%B8B UB@~Uh耻ÐUSS1ۋ ? P辘? C~Rhjh@ | hjh@? h1ɉʉ@ @? A~ʉ@ @? A~ݹCJCJƒ@ AuIJIJƒ@? AuPjhhLJiF @ jj@hwSF]@ QQShF|&UWVSE]E} S艗PSEW ЃXPEPt;W _‹OW UB _OEUE ue[^_]7'e[^_]ÍUWVS }U] uWEPC ЃXPR7t8KS‰KK SF K EuE }e[^_]&e[^_]Í'U1ɉWVS }]u 9s;:te[^_]Í&PEWPEPE1Ʌu׍S9s'1C8tvB9s18u9rMG)Ή9~ыE)뒍vU1ɉVS1E] 9s t 1@9r[^]Åt\t"u1@"t,t@Թ@̾@čv'UWVS M}UAtjEU9fY%q 489C9s 16uMEA)9AVS4U)޸r e[^_]ËщUf1ҊQ%DfAf%EttUMfU %ҍ48u"9s?:E @E U 9s8:u});E ~ M <:t1MU1D|0fDf%Eue1[^_]PQEPWWuU X9@%6C916ut&'USE]PEPE PPSZYPSJ]Ðt&UWVS ËJ,֋}AXA A$AA(PPA,A0AtN(̀E…%u(C$puM ȉC$uU ЉC$e[^_]ÐEtPGP7VQ뼍t&US]M C44u!C44u ? t&[]Ít&'UWVSSSUE1ҊA<w.%@9C~);Eu{9uu ZY[^_]ÃCغ U1҉VSH@p(XD9s.<*t(%5DFu 9s 9/tA9r19tʉ[^]Ít&A9s,1Ft3A9s1Fu+t-t.t9tA<:t1҉[^]À+tȀ-tÀ.u9tA:tF;ur~;}s!1F6tG;}s 16u]uU)ЋS9uPRCPEPmuҋKEMu'S B @B UE SUMEt|MC )M9}EMPQWRćCUM]vE U1DUDUEfDf%Ee[^_]à hGu룃 Rw6C'UWVS]u} UCM$>B917tЋ^0))؉F4N)ȉF [^_]Ðt&B916tꀸ8Ћ^()B)ػ F,9s|16u\)F0낐B912uꀸ8Ћ^)B)ػ F$9s,16ur)F(g8tJB9r } tE utE1[^_]ûڻ ӻ ̉ЋN())ȉF,F4)F08tB9o 딻덐&UWVSE]UM}$>B912uꀸ7u )K0)ȉC4{)C [^_]B916tꀸ8u )s()BC,9ʸ16ugu )C0jB913uꀸ8u )s)BC$9ʸs316u[u )C(U8tjB9zu tM t1[^_]øٸҸˀ8tLB9r붍vK(u ))ȉC,} )C4C07tu )K)ȉC$} )K(뺍&UWVS E} X$p9svUZ$e[^_]$>:1؋M)CXG9sɊ1Ѐ83C9r몊1Ѐ3tC9r돋MXMEW$PEVSRPWÅl8 EfG f% Љ_ uC9&G4tB  C9_1Ѐ7H uC9 ECUX$)ÍCGGG)ЃXG G9s WBW9r1Ѐ7uC9rr_ uC9Z uKC9E1Ѐ8uWMA PQ: %PO)R#MY$EXEEW$PEVSRPWYÅ8 EfG f% Љ_ {C9f؋M)ȃXG1Ѐ7 uC9P =C971Ѐ8OEDX9KUDX G@GDX9,UDX G@GDX9r7 C9; C191Ѐ3tUXU9_G7V "C 9G; 6C901Ѐ3tUXU9t MjjSq$VQo ËEpU)ЋUX_Gfzt tM fA fAfAG @؋U)ЃXGWEЍPXW:M EY$jjSPQŸEUGà rGC9 C9x1UWVS u}UE UVEG])ЃXC=^v^FXQPRo~FxW~)< C < SUCCECESEE Ue[^_]~VG$)ЃX럍t&'UWVSLE}EE dE1UMUIDM1ɋ]9EUM@0EyR@ЉUÉE؃XE918cU؋MuD U9VEЍ&޿dJC9]s]]UZt@MEȋUM\XDN9r&Ef ޿hJC9]s捶UEЋMU\XDT9r Ef޿sJJC9]sEME]E@E܅]MC0CEf1CT\XUfBfƁMfǁ~PjShxJL}!U1D\fDf%ƅuMYU俇Jr}&U܋U܅M܋QB9uEypу9u΋U]K4fǃ@fǃ; 1; C@1@DA<"PPQSe[^_]ËEEt&ME VY SQh |]EǃXEZUPB0xLW MA0@4A$puPA$n] C$^EX}}UM]EU]@DER@UEME]EUMERDUI@M UZzUWVS ]u (uF8 < t)Ѕ~ e1[^_]á; )Ћ ; MbLJE))ʋMʉtJCF4F8dhC$puPC$k C$e1[^_]WWjSZYPFLPF뛐UWVSL}GW < DBUԋU 1ۋB]ċ,E؉MEPPwVjhJ ]܃ }M؋ERjhJPy] uE[]9GE01ЈU7uqv ҉UR聢M̋PЃ vPɋEЋ] EЋ[EЉ] ЉEЋE@Eԋu9vGE01Ѐ7tMԋ]M9sNwEu$Ɖu3E1҉E;UċE#|;EsEUW=E)ÃtX  t`E)ƃZMSjhJQu>E0'PEjh}KPutuGPEj hJPuuUωPEjhJPYutыUQjhJRAu8PEj hJP#u뙋u)MSjhJQufUB<"<, ШLE &UVS]u fft>fHtUǃtPPjSqZYPFPP赥C$ptu C$%e[^]ÀPC$ٍvPCdPVSxe[^]UWVSEEM E܋P0ыUf@%ETTXUM܋=?E܋MPfDf%E<] f%41GD0EEUjh> j SBP+F u|MAwq$T? Eh> @ PSh^h [  M Ph VSQ茫Uƒ fUU܋ZJ z$ljZJ z$tUMEM1e[^_]Ë]C9CuыEًP I0S[4AC AM|A Btqǁ@eM܋]ECTX[EEUB̋]܋E uM jjVSQgM܋Uƒ qY UQ$ƉY Q$q]IfWf% ЉfE܉]fH ]Kƒ Шt&UWVS ]}u_O1tLS0E EX EƋC8ƊEEjh> j POQC tUEe[^_]Ít&Gw$p?UB9BuҋMW Y4QI0C AAM|A Bt ǁ@E뉋MATXҋUBك Eh> G PEPh^h -ƒ ! ERh VPE PV{S$‰{S${0U K XDK S(jjPE XMQjPCPƃS f‹% ЉxOƒ Шu 1@UWVS }]ۍt/&ut.Kƒ Шtu1e[^_]ÃttPE SPWH|uыM PSQWSy&UWVS }E EuUWL9}B@tGO,B@  B @B O,4PVEPQlG,0@ >B @B PVEPSl3Y^SGPPơ@ P JP O < M苁1Ʌt EN@@u^ C^ Nt]UZdtSRRFPPiu4CMA@G%~U싂$? ue[^_]f@  J IJ hG諨GEGE Ee[^_]H RU싂$?Cu M쉟G$G$e ߸ R7&'UWV1Mu S19s t1A9r[^_]Åt<\t)<"u1A⍴&<"t<,<; ШuA»A뺿A벍&USP] M::ubJ1B8u1؀7u+BAB9s 18tA18u jjQR]Sϣ]17<B9s 1B8tĐt&A18u jjQR]S耣]Ít&'UWVSlEUEE싂Muf@%I(DVȉEfBf%Eti}EԉE܍M܉Uf%ȉE1BU؃jhKRDEԋEPu(}u}VfDf%Eue[^_]ËM܋u؃EEM9]C;]s'}1G8tvC;]s 18u]̉;]s;v=€, Ш;1FȀ8;urȉuuĉuȀ;$M;u9uE@;E}MAXu싖uxUċ\)ډU9|f9މu[@ u B @B }ɉUB`;E}PVSQgM0uE)؋vu; kEE}Dt\fUċH)ډ9~Ѝ4)ʉuMU9Hu(D9މ׉uPEPEPEPEU؉E9EtKE] u؍EWVPS4MÃfUE؉EԋB؉BB ؉B B$؉B$MMw;u؉u&}Eu]ЋM EVSPQuƋUuԋu‹}؋MljUV$‹^f}؋N V$EU؃9Љ^N EE9މ׉vEMUċ@dUEA U9UEt|M)щM M MtfuVtF ;Eu9uȉ׉uԋE@UB@MA%|UM $?M ɉuU싂x $?@u}ċN9}%E}Љ}t&PEЋ} PEPW>U9r9UruƉűMȋU‰MȋM}u؉UĉMԋUMƉ}u؋y q$fQƉQy q$Euvu}ȋE̋U))} MԋU܋E jjQRPڝu}à NufWf% Љu}EfO f2uȉu9}?~GEĉ}9r;u_>=VFU؉E9s-1F8tEȋM@E9Ms}18uE؋}PWgZUYEE91A8Eċ}HE9}U1B8u E@jjPEPE P讜UԋMUԋUuM؋MƉ}fyQ$uq ƒ yq Q$EEE19ut$ EjjVPE P>ƋEȃ EȍF;ErnEċUEċEr EEJ$E؋EEԋEr f8BJ$B RHS hH!{ uȋM jjVPQ褛Uƒ Uku}$?Gt- u}G$G$Ey\ э&UWVSEEM Wtf@%ETTXUvWMfDf%EuU܃ f%01BDEEUjh> j VBP4 u!MAta~8tFtUM]MF1e[^_]Åu؋E Eh> @ PVh^h 薸  M Ph SVQǙUw`‹OdUUfWhà w`OdWhG EjjPVu V肙]O`ËWd]]‹whO`WdfSO]whf % Љ]fO EfUBƒ Ш,'UWVS ]unUJ1҃tYStE Es| xXEUjh> j WBP2 uUBt@~/tUUe[^_]ËEօuҋE Uh> B PWh^h 輶 x M Ph VWQS`KdS`Sh‰KdShKtU ʍDXSljjPE WXj PC\Pƅ8PPM WM E XP膏KC|> f‹% кEHƒ 1Ҩ]&'UWVS }]ۍt/&ut)Kƒ Шtu1e[^_]ÃtPE SPW|u֋M PSQWXyÃƍUWVS\EUEE싂Muf@%IlDVȉEfBf%E}EԉE܍M܉UfE%ȉE1BU؃j hKRDEԋE܃ EEP:uMFuDuFXpE;EX;]s+@%8t&C;]s 18u]Љ;]sBv=€; ШHEt ,81FȀ8;uruĉuȉűE9Es}U؉U;u(9uE@;E}GXU싒uMȋ\)ىM9|m9މub@ u B @B }ɉUB`;E}PVSQkZM싁0&uE)؋vu; }DtKfUȋH)ډ9~Ћ})ʉU4Lu9U~U}H9}ĉ};EEEMuQfDf%EJ}G,tJRRPGPP wÅV}1ҋ < Gt ‹C S@C e[^_];u؉u 9މ׉EM҉t uFu}G$E@EM؀8:9M% uԋ]܋M jjVSQdu}à NufWf% Љu}EUfG`ډG`Gd؉UfO GdGh؉Gh}싇UMr:J/uF "B @PBPEPEPE P裑ËE؋}ԉEċE߉E؋E}ԋ}Php`ڋHdPhUىp`HdMf @ ~u싆uŰMȋE)щUL)9щMdMPQEXZ5D9މljOEH,,@  B HB B @B UɉJ,u]WVSQVMuA,0E؋uj h KPVqu}EE EE@` Z ESJUQRPE P$ËE؋MEċE؋UE؋E؋ydqhEfA`ދ A`ydqh4f;u>=~E؉}9s-1F8tE̋U@E9UsM18u}̋EPW}Z9EĉEY|1B8hEȋMHE9MU}1G8u?19ut$ EjjVPE P ƋẼ E̍F;EEȋuMEȋEf9EċENhE؋EEԋF`NhF`FdFdPEPEPE PXuԋMƋUuԋu}؉UNj^`VhfNd‰}؋}^`NdVh R hH臑 űM jjVPQ Uƒ U Rb1@ 2GB @B @ F z Gz b}GRLPG,PQSGL PR@  x B @B NMRWWNQUSF XZVuFPPvp RU: h4H. h4HEj@Pؑ@  hpH hpH˃ R hHя Eh4HjXS{UYBVT6 R h4H舏 Uh4HjZS2YMA뵸'UWVSEp^Dt ƒ%tte[^_]ÍPEPE j;PODžtхu]E E&Ð]9vKE89 Шt苖HE@EE9EsfF%fEu|=uQRCDRPRu]f}u]EL)9~Ѕ'VPS]S} PEPj?WNE U))QRj?WNt E;E UE;t&'UWVSM }]Q0BPf@ %PBLf@ %PEPAPVhKh R]Ɖ)) 9~@QP WPxƃƆ  FuE  Ee[^_]L'UWVS,EU}@0R4EUMA4a_\A]9A$sGVPSQs]Ћw]Ћsx!E UHQSRP@x$P M]ЋA4A4ȋsXCE߉PPs,VS(ЃXP===MEH$pH$RMQAZ@ ة!A$_GtM1fCETfCf%LXME܅E܍]ԋ]Uf%؉E1BMj h0KQDSE跶t?UR$ŨPjhKSOE̋]E̋ẺC$U܋_UfDf%E܅]1ۅ~9t&~)PGPEPEP xAC9ˋMA9ƋrRPEPEPXUt,0<@M]A4@@LJ]VVjSظZYPExPWy~UR$Upu MPỦQ$Euű]űẺC$e1[^_]=,q=-?]UB@J06 MEjjPSQɅW`_dÉW`_dOhU]‰OhUOfS]f % ЉfO Ef MEjhKPSQ]UOd‹_`UUfWhOd‹M_`Wh I$M=nUtDH\`D]SuDuXu BzPBt ]t"C$u[Ct?88][$]̃uVEP@Z@ ة!t>~6EЃx$i@M|_0XẼE̋EỦP$d'Gfxt WtMЋ]f@ f@f@UAK,‹C$)ЍPC)9r*C,EЋULJB4B4])s0։s0PPEPEPEP]SBtDH\`Q;KtQPhH7UX;KtMRAVhHjPÇ ]PPEPSBu(IPQhFKh SJUÃB$ ES_h SPEP蜰 >MA@t ~tG\rUЋEZ؃XEƋJ VuPVh`K?O1]fATfAfӉ]ÁfM%U4VQRhgKO1DD0EfDfÁ뱋E@4AfP]ЋPGPEsXP.>UMЋYx#] CPQRSCx$P U M@]U@t,0M]AC4LJ<@PPjQ膲^_PsPV*xE@$Epu @UẺB$E]̋M]̋]̉Y$sUЋJx&M uAPRVQAx$P ] U@M@]t,0UMBA4LJ<@QQjR虱_]ZPsPV:wE@$Ep0EЋ@x$U BPEPEPRBx$Pb M]U@@t,0M]AC4LJ<@VVjQް_ZPsPVvE@$Ep`PO EЋXx!U uJQPVRBx$P M@]t,0UMBA4LJ<@QQjR+_ZP]UЋJx&M APERPQAx$P] UM@AB4<@Y$]pu ]̉Y$EE E̋EỦP$My,RP hPE ωEjhnKS]PST TMA(^y]U; )ȋ ; )Mb)ʍڋUщRAJ@!ȩt"]PjCL@ PCP@ PEPUOh ǂR]ǃǃ]33 GjhKPEPEP ][$]tv'UWVSM EU`AU9A$sESPRQ螽}*EPx!U u zWPVRB|Ph M ȋY4A8Y4]SЋS$XCj`EXlMg]K4]/E`X\{8s8] t&u:?9 `MjPQSWK uЅ%tƋ}`; ; džQQjW._ZPE pLVor}w$pu Pw$u Ep$1e[^_]Ë}G$G$Mq$urY;]tj@;v ; 9#rFr;vEp$p$` MYQCJ ȩ! `1u {0[fCDžlTfCf%tXtpphthf%<1Bj h0KWSD8t t6Mq$PjhKSe?NEp$`plYfDf%pM]1~9`^t&EGP\PE SPSU9ՋMdt`u^@@9B}uD9/ `jPEPEPCP#‹C xuŅ1҈…tEE C=-=/  5V4<GG=^u uQPRV<{ NWK =ZEPQCPR&1҉Ft P7%F$e[^] UVS1ۋEutxt [^]ÍvX(PHڋX0HL)ډI~B ]Ð&UWVS,EMHELMY(|D%ƃvEԨ yK0RSK(U܋UEM؍EЉEt&E܅CXC$C C}؅jWCPEPCȉCCȉE܉CEȉEC0t9vʋs,)։C0s,HUЀ|w39CuKDSHS(U9U 9(E}%\CAC@@CA<v E%EԋEԉHEDEu#9 ~E@uEHEEs,u KTCP@IST1b PP$tCTt90MAAERRjP> EԃCE)@EpF$u V^F0F0UԋuԋMuԍUԉHdEe[^_]é UCr 1CTt&tWWjQjHQjV +{0)CDCTSH{0ʉUԀ8Z89 ,K0fSC 9vYE)ЍxX1&Uԉ3D3CE܁u9C~CXCs);}UԉUBQЉU%tJE)@]C0RM9FCP8:AW+vMA띋C 1ɋ < t K똋2CTtUJJ8u P'nCTEMAuEHM dEPt8 HM DHdQ> EExx E PP~EtW}%CAC@@CA<v uԋEԋUEԋEԉBBM9MuC@CA@C@<vʋE E뽁}%}!lj}YCAC@뉋BBPPjV> CPC$P$bt/Z8 MAACT33P9}ԁ}ԋEԉjCT MЍUSP]S, uY BStwCuS K QfSC(S@ C]Ãu؉SPPjK Q> XZjC PC( u]Í'UWVS EMH4|D<_,{ uhډqEQ CT C,%"=uC1 < t sƉsG(PtG@&%"=uCL@t PP  )_S$u SXC0C0MHdEe[^_]ËC,5% = 0PPjEP>  CsT%P 5 < EttoUUPHM DHdQ> G_GC$u SWC0C0e[^_]ú늸? W it&GG<PDPDMPQJu rt[stVt jHDC0us,u KT#?CL8( Ev UWVS }w(G E_, u,%.PPEjP> F u7K,u8STu1%=uWWjV> Ce[^_]u˩tċOEORRjP> CuˋC1ɋ < t FKtG@uF 1ɋ < t N넋GGPPEjP> >#FF 1ɋ < tt)NGGfWWиSrvUPPUB(:u# u%tt/PPjB P> ËBBPPjJ Q> BBPPjB P> ƍUWVS u^,> FF HDC,ډ\K,ST % = 0%=8C tUC,u{Tt%"=F(Pt+F@u%P = < Et UUP)^K$u SSS0S0e[^_]Í&CTtPPjF P> FFCuC1ɋ < tt K #aC1 < tt lj{> Vx2FF F H DF Hd~ W> ^^C0u{,u [T>UPP  ; A @A t.B @B$B0BDB8 tF < B@tHB4B<`tJ t;By R>Q @ 1à QsffUWVS  = t 1ҍe[^_]PjjhKݸ@ t@ @ Et=L_d;E~Et P 9}Ƌu⋿uË}GS}jMFQhKG@ >RjVhK&@  @  PjjhK &UWVS E# < UuDtfEPuEPuZ{%&Ct U)Ѕ~XuS9uۋE@E}vEEyEuuF4e[^_]át:tt2CuLPPhLh  Ph jCS PSUSRu < PE4 < U_UE PEP%Ív'US] t@ P JP Kt@ H IH @ P JP []ÍvUSP v PPq&u C t Sֹ9tlC$t- CP踹SDH  t; X KX  I ]눐UWVSEUBhJdZ|@E ǁ uE9]}`UUf1Ett A#;EtK uEU䋏)ى<@E9}UBd뮋E[^_]Ít&t01҉ƅ;E Шtϋ u낉낍&UPd@l@h@x@tǀtDBt2 u.t*t.Alu Au@AlAxu]ËAh@AhAtt&U‹Hht@tB|]ÍtǂB|]ÐBxB|Bl] UVS]Ss;StMu3uSS[^] uut&;u[^]Í&'UVS]Ss;St!t uuS[^]Ë;u[^]ÉCSfUWVS}GdLJLJ LJEÐu]䉷EEt11ҋCCtnEȉEuЋE9E}EuSSjMQLJF}e[^_]e[^_]Ðt&EȉE됅@+!Ut&t܉u}UET&'UWVS ]SK{9 P()P(CwlNGxwl9tBtt ut቗l kuffSSe[^_]Ë;䍇GGtGhHGh P辳ǃ UWVS ƋP@ut tdže[^_]èt_$9s G(9r8))Ћ_WWPSze[^_])QQPW>jUWVS u^ddžЗdž `dždž$&CCu߉(FtFx^ddždždždždždždždždždždždžtNCt; u7t3t=)ЉPPPW譲t&ue[^_]Ëv'UVSpXu;Bt';Bt:uuQ@ [^]Íǁǁ[^]Ãu#@$‰[^]Í뭍ې&UWVS ]CKs9uC [^_]è ut狻t uG(ЉG(CtVFxFl@FFluP؅tt>9ut6.&;aiFtFh@FhO(G$1ȋO )؉Cu1&'UWVS}GOEG9PEu9Et u%EU Uu&Oe[^_]f uè%E봋EE…%EE…%MMUMB()؉B(AtAx;B= P6 UZ(B$؋Z )1dELGGe[^_]f9&}e[^_]1}e[^_]EEjtH]1ҋC(LJ9ʋEH A9sUB$J ȉ P VE싗Y[X)ЉVS?vUVSuue[^]Í& S葬XZV )1SPǭe[^]Í'UVS]SKs9tKu4t uu=fSSe[^] uu;u܃tBVx)‹FlHVxFl9u8ftBtt utቖVt)‹FhHVtFh P{ǃL'UVS]CKs9~uCe[^]è ut胻t vtZFxЉFxFl@FFluT؅ttB9ut:2;v~FtЉFtFh@FhS )1PPPQǫCu5t&UWVS]CsEC97EuIEt u%E萍t&E Eu+se[^_]Í& u%E뤋EE…%EE…%EE)xxωxxS )1QQURPnESCCe[^_]Ë9]e[^_]a]e[^_]aE)ptΉptY P葨sv'UVSu^ddždž dždždždž$&CCu߉A^ddždždždžt\fCtG uCt?tHS )1PPPPϨue[^]Í붍&U1WVSEUu R|PEPj?V$Ã1MC؉])u)ƋEu(E3vWuVj&SÅCM؋U)ȉ])‹EU9EU<=uM9$މMωuEME)HZEt,B#UCЋUЋU)MEt<&uًME1q|e[^_]Íe1[^_]Q_ v'UWVSLEEp0@ẺUЋ(@|M1ɅHS Cz< tz>FU1ɃX)UEM EEPEЃPCPjhJ]]܃ }M؋ERjhJPF(EX;EEPX1Ѐ7ua StlPЃ vPɋE]CE]E ЉEF(X;E+M1Ѐ7t1Ѐ7tU1B7u 1ɍe[^_]ËMMMMċF);EsEċ],}PEPj&W@ÅtCu؋M)])MċE9EvUMȀ< =uE9$uMȋE)ȍ HEčZt9B01҈€3t`UCЋUЋU)MĉEt<&űM̋E1q| Q>XEM1ɀ6ut&UWVS,1]sEԋV|<E1tL EEPPEԋPREP8PZE܃ tEu 1e[^_]ÉËME@u=AЉ)Ku1v|e[^_]VEYhLE"fU̅tЉ)IKt<.uڋE̅uEv'UWVS<E@$Ut SSjP^MYǁCp%u|C EtU1B$B$}t=ME9UMBQ4ugtAt tHe[^_]ËK|=~x==ttEX,t P2U9B$s MQ{e[^_]ËS  ==uMEKh7t@uƅC,C4F @u@1ҩt t@u‰볾Mffif muư11~1Ѓv1s|ыM‹E;@dhSSPQ0\=J MQuMyE1W|`Uǂux;G|| LJ1EE*;u2u]9_|%!9ڋC4F,tà V9F$s밃 S9C /9]E EEt SXK|0t)9~%!?EЋUЋU)ЉENG/űE@EԋE94뽉[]=U EKhɋEuu‹SltEEEF$u F(F$F بt @ut@F 9w5ЅtmDžuoEeFVFF(EVF$F 롋Ft t&@utǂǂu1DžtF 1ҋF(ËV 1҉F(9rw)ʍC PsF @F G,t)G4tU}艗 Wa9G sދE;}… Ш}뒉F(11҉F(9r)ڍANM}{1҃~Eʉ1s|UPM WPSUu EhxU1W|-6x;G|| LJ1EE*;u uȉ]9_|%!9ڋC4F,tà V 9F$s밋E1؅EwSll@SY/S^y RM]ȅt M̉E]t MEWXWiXMtQ9}t5M^)ЉPPPSޚEU苒Uum9}tEM苉MuI&UVS]s$uSfBpALQPҋATAXAtEC@u 2f(fff*fff1s$e[^]ÐB tMBB B$B(ÍvC@u ,QRt2yc(,04뗁 YLfff*ff# Sbs$댃 SQs$S S7s$UVSuuiF$tj1tW9tOF%t SC,C4S<~ 9S4} V e[^]à VÅtH;x%=taN$F<@N$LPt~btcpPPSVR1`?ɀxPPPڃ S> 9C r䋞48FDH\t&UWVSLE@$u PpUB0XPPjjjƃC %9ܻ PhjV\@ jhpjjV @}WB0B@EC%EE==E EC\E؋C`E܋CdEChEEĉEEEċ=HL8$\8 … ШuAQ Bf\A@Q ;AAU]ȅD:$LMIMȋMA E1Ut,QfDQ%EB;AEHA EUMD: T9 D9$ffEڋEPEPEPV7BEPj]èSV@} HG0@PD D HO4L{O0DDL \DF;> ~> PPjV> EUH0AP=z$@z$P$BP$;P(X}W VЃO0WMQAZ@!ةPPVA0@L@ Pf}WB%11==9vWPSV@Åm V!KRSS}GQhHMGRhMjP `e[^_]ÐEPYP1ҋ < t j‰S1ҍe[^_]ÉP(=9}Ǩ#vPPhMP^4$Zpe[^_]Í& jhhj jV t& jhpj jV WsTrKjB bn=HL8$\8 … ШuAQ Bf\A@Q ;[A D$Vp@ @PPjjVE P=2EE̋MẺMEL PEPhL=W=HL8$\8 … ШuAf\AY C@Y ;A D$VXEZPUWBVhNjP`zSlEUH&AA}ԍC\WP]SV~=EЋMЅD=HL8$\8 … ШuAQ Bf\A@Q ;0A D$V}PUPBWh"tM^SARh8NjP  dC| @PSjjV} - hN4$P=HL8$\8 … ШuAf\AY C@Y ;A D$V0PPhL=Ww&it m => WUBVh<%AELApA`P}PGVh(#[QGRhNmPPUBWh OMAVhTOA 5> VMASh$& > Q}GRh%&UWVS ]9fS$%HugKAtaS$ S`uC0@PH0u@0@4C48e[^_]ËKC0@Pp0a$(481҅tC0@PP0;@0@p4tU\L ; `L9 B@BP;XvXt$(C48 ~4u/ F F,t V9F$ PCs01ɋ < ~Ptt[FPO|@0p4z})ljHt"BLB랋EB UMA|t0; 9},]Ë0; )Ћ,]Ðt&UWVS EUtM uUBp% Bp1e[^_] M t* u.UBp% Bp뿍t&UBp% Bp1Eu0UBp% BpEp>iXUD8jj jPUjj jDPU0E: 1lu1Beu1Bnu1BtMaUD8(jj jPOUjj jtV1U@4g1Cr1Ci1CM UB8U Bp% Bp$RcXE@PU $E@P~U (UB8%M UB 8+U,ǂ,00M.sPPj)VmÅ9 ШU Bp8% BpWU)<ZYPV Uǂ@8UB85MEǀ@Eǀ,EDPhOEPE PKE|WhO܃ PWU,ESh PQhPPPhPPhPPh(QPhhQUWVS }u]G Vt@ (tPPF PPAtuԍe1[^_]ftChu te[^_]ËCl썶UWVS u}]F Gt@ (tPPG PPtuԍe1[^_]ftSdt Buue[^_]ÍB,tJ uU1gu1Biu1Bdu1Beuh>upyuE LQ,@UU:tYU1uu1Biu1Bdu1B*jj jMDPU죠U:u hn@e1[^_]Ín&jj jE@P…=x)xУjj jMDPjjjE|WE tV@PEjPMAPuVEtqWhSUREPce[^_]ShTRh8T؋MLQhTVhTPhU붋U\ShHUQhUPhUPhU돍t&'U E h@VPEPÍUWVSEEME U@4Ew $x1ۍe[^_]ËEMfǁe[^_]ÅZ t|u WE2CTT1.u1Bu Mu 9qt-t}9{uƋU KT9ωƋMuf}ttU 9l]fǃ uuhVV} …Ru)RRUE Sh Wh^RMM1QMQ]ufdž }E Fbhh: M xRtP;Ehh9 ] pPlPEhhB9 u PP1҉Ehh8 RP1҉Ehh7 RP1҉EhhA7 RPEhhh6 P1҉Ehh5 RPRÉhh@5 WP5wZ1YRP*}WuVMQUR}W}uVMQSPhZh^W0hh6 E hRdPhh5 U `P\Phh@5 M XPTP} /RW t 4RJt9RQVSPEh[h^P uWWV1ۋuV>&}E UxdfǂD]3uR t+9|t#U]lj' }uE܅u}܋E܋P ۃ]Eƒ} ШcZU?x}E  tUq} S PtPjE QRlPP1U zdPM ; ˋ0)P(PAlPAhPI|ʋ׉ƍTPU #P} PSLQHRDV@S<Q8V4S`Q\VXQTSxQtWpVlSQM苀PPPPPPWh\h^QDİihhA7 M 1ҋRPEhh6 QE Pns_Z1ҍ}RP`|hh5 ] RP8hh@5 u ËRP uV|QSPh]h^W hhC; E xRtPxhh: U pPlPthh9 M PPphhB9 ] VQV1҉lhh7 RP41҉hhhA7 RP1҉hh6 u RPx^ZQtRpVlQhRSPh]h^WJ0hhA7 E @V<Sdhh6 U 8Q4Pnhh5 M `P\PIhh@5 ] XPTP$\ClPKhQK|‰XXTÉP #PQQjM ; 0)PmP] PPLQHRU苃DPdPWV\PhT^h^RM yd4>R] P] (Vuhd_h^V ]VVS]S11ۃu}fLJahhC; hPdPEhh: `P\VEhhh9 _,SEhhB9 G(RPEhh8 G$RPe1҉Ehh7 XRPFELhhA7 QP)o^Z1RPEhhh6 _^dJSShw$uw$REOQhrh^P~ PPhJuw$RdJuw$RGPEh$sh^P>_hJ]P]OQMhPsh^Qh|sh^SXZSE Pa1҅# fdžfdžPWSV1MPhSh^Q[E_PM Q1҅e[^_]áԺԺغRRdJhhJuw$RMGPhth^QM %KMPhSh^Q~Phh@5 Q Ew$t&UWVSEu} E $LxPPEPGPPmfdžfdž ; < )ѨPغuw$PԺPP LPSRP < PPPP1PS<QRf1󸉈QR1ųU RE.R RUPPhth^RXEPW1҅ fdžfdždžfdžt5)v{ t uAfdžÉufdž%e[^_]Ðt&PjSVu1܋넍vKUPPh^RY[]SW1҅y%눍&USP]|t]PjE PS}tǃ|]Í&UWVS\E }(z|t e[^_]Ðt&uEE t&E fLJLJ|e[^_]ÍE;Ut BUPB4PC0@PC0Phvh^V>S0J w$ZPh$Sh^VS0J8w$Ph+Sh^VS4Jw$PB4PC4@PC4Ph4vh^VS4J w$uPh$Sh^VS4J8w$1Ph+Sh^VpSLw$PKDQSHRC8Ph3Sh^V@w$PC|PPCpPhMSh^V SJ4 w$DPhgSh^VCP$Phv$h^VY^uVU R"É@ TC PShoSh^VsC f@% 7PCH8Qj; )POZYPC@0P|PhTvh^VS0Jw$QhB < )P S0v@DPh|Sh^Vt&PPhB4 < )PPh < )R Kt&Ph < )R} t&QQhB8 < )PXQQhB < )P8kQhB < )P S4QQhB8 < )PQQhB < )PEj4PPjިffStRUCPCPQRhSh^VE E fLJE LJ|hEj4PPj EffbPPVU BPP‹@ EfLJC US Sf9A}&UWVSU (]|te[^_]Í}EhE <U|tt2}x9lttG9luoEUt;AShtvh^h]QWXZhSE P UEǀǀCvTUǂ} Eǀ|e[^_]Íx$t]뺋}t;pt&hUYPxlpl^{ 9t+RVhSh^hP.t ;rhYg€\%tbl9h ZCZpG@p? tp;J1ҊOʡDP@uA<€  Шu€\ Шl9dh\1hȋSB SV U ch hXCX/h_h Bp@BM9WWhVM Q+}xމt;XN\L\El9Zh\hhSZXËDxsh^X$Dȋhr$^ZDret]ߋ4nPPWE @PP  ǃǃǃ}E|VVP|P茡tY[JMb)RUREPEPElPEPEPhvh^hPt0fz]j.St$Pj Mt G PwVGt|RStRtBtlRStRtIQS]lRPhvh^hP'@PPhWu V]ǃtGfh G@GpÉxHut G PGPGt|RStRtBlWBVJQSMlRPhwЍ] j.SPj]M%fǁǁ|UhÐUWVS<1] utLtt;EEEEfEt UfBfEڃ jhpjjVϝ t4EQjPV軞x 1҅ttQ1ҍe[^_]Ðt&ERjPV臞ʃ jhpjjVi 2 E܍UȉEfEj EREh ,fEjEVE @t Ej Ph ,jV @IAUBE jhpjjVœ Ytt&UWVSE] Mۋu…%tE 1~te[^_]ERjjfF %PWÃ9PhjS?@f jhpjjS @H jhpjjS @F jhpjjS軛 Fr-P@ PF PS苜@WWuPSؚ@F HDC;> ~> HDDD DtHDDUE…%u Ee[^_]PEPEPE PEEEy SEE8yEEhy놃 W@$WjjS[ @EEyE jhpjjS( @p jhpjjS @REEyE=& jhhj jSЙ ExEEExEMExM&UWVS 1UB@z@`*t&PjjS ƃt`9u֍e[^_]ÍUMyt]fdAdhǁ ǁ`@h] UMyt]fAǁǁ@] UWVS } u0FPXW8 < t )ʅE‹X\t&uMVB\9tGCt: EPjVRCPE ƒCxu1҈…t{ t,G4G8G4e[^_]ËFEqF4@@G4@@FTXF$pt@u F$1e[^_]Ë_8ۉuF@Xt < tG81рPF$븸G8t&UWVSEEX;xlxME9MUrZE8t#xE8E1ۋP %itֿ8PQE0PEP^AÅ'@tPPPhSDtH x@puxRQhyEP}WFE VVjj豗MUP XQ`PA`ʃ\Ee[^_]ÐU9UUMQ:tESjPR+EE QU RPMAPPhzEPEP腖E ;M%u#e[^_]1Bfq1BgUPhx})ω}uVEP#뵍& PWhMRPExW0Vh)EPEPܕe[^_]ËMYXuUEBX1 QU RPMAPPhPz랋U QM_ZVPEShz]SMQP  QU RPM9WqVhz븋M VOUZSMQPBPPhz냃 SM Qh{oU WM^Y SURPAPAPPh<{EPEP芔 SE8Wh{M WU[^J QMRPh|{v'UE Ut@0u1]Ë@B |]Ðt&UWVSE tx0u 1[^_]Ëw_ A<€ ШnV?1C 1CE;uNC+11ҊS1҉E1CS1҉E1CS1҉E1CSЋUEÉ/]ƒ}%EUEЋ]B 9]E~x11ҊCS1҉E1CS}B=GO(ȋ_ )؃X9}9|EU@ |o]C X~1CE Uh 耳$t$$@4ÐUVSu] 9t"u'tC @C Cu/e[^]fBJ IJ udž빃 SЃƐt& RЃِt&UWVS uVEUt'F$@U{4FbF0@T^4CT]N0t; H IH t; P JP N,t@ x Ox ]EHtU싂H IH E5ExXtHU싚t!C tCP JP utU싂X K8X Et@ H IH Ut@ P JP Et@ x Ox V~9׋u;ًBABR@ tA BQ J9׋uŋF]BF@ 0p Nۉp t Uz e[^_]ËU싚t&C tCP JP uU싂H I8H u࿉F$C${4HC$FC,t SB9C$ P臵y P^4 Pp PC2 *"qSSjV9 ; Q"=EZP=X@ P=X@ P<X=@ W<U^S<UEe[^_]<fU @ @ @ @ jhhM:@ %ÐUVSuF0tTPH@D+ t,FVlp9t lpuqF4tfPH@D+ t>FVtx9t txttx[^]lp끍&'UWVS ] uC,K(C@A  up t^; )Ћ ; MbCC0C4<))ʍe[^_]É%=t F@u SS{0 C4{0tQQSVЃ맃 CK QS01uC4CC01^'UWVS ]} t C$@C HC uQCDHG9_0uG0 < Ge1[^_]ÅCt48듃࿉C$B$HB$C HC pw0rt$(C48QQjSECtEV4ut4Ft' u#tF, Vհf WWG,G( tVVWSЃ &e1[^_]Ít&C@C%QQjSCtPV4ut?Ft2 u.t*F,t V蹭9F$s Ps$s$ G0W4 Vh9F$Gv'UWVS } uG,_(EF@unC(^{]Ft ܻ tZFV@r!tEQjW RUBL@ PY*C4C(XC4{Wv,dž$ E@e[^_]Ëҍt&Q VO&UWVS ] utt|e[^_]Ít&CF$; )Ћ ; Mb<))ʍe[^_]Ðt&C,@u hR CSS$SC0 C0 3] ue[^_]Cg; )Ћ ; MbC<))ʍF48 SS$SC,{0uC0 B V薡a\L=; `L9YCYP;X XF@CCF$=p{{] ue[^_]C,@u u F@; )ȋ ;  )ѺMbC<)ʍSS$SC0$(VS0DC0@S4tX\L=; `LE9@A@AP;XvXt$(F48QQjVFtPW4ut?Gt2 u.t*G,t WQ9G$s W蚪 SS$SC,; )Ћ ; Mb<))ʍ@Y)ƉHt@ALAaAE+EHtALAY‹EAt&'UMQ$u!ApuAdhQ$]ÃtwQ$Q$ރtytt Q$ȁQ$뽍t&'UWVSEp@@07 ^0N4$E FHM m VpesN4 ^0CL8 CP8 ;E uU1UEptACL8v̀C4  %1ljptE X C4u u CL8 uC0t ܻ jЉU% = H E%=%`=@D %` = `@ SP:u"t%=%VpBwc^pfJFpQQPVVpu.tϋ@tF%tPPFpPVfVpt^0E1ЩptECL8CP8E N4t&EY uE1؉EEptAALڃ8v΀y4 R%1ÉptE A4u. u&AL8vA9A,sA, uA0=! u;A0t4ܻ t+P9~VFz@ E% = %`=@%` = `@SE1ЩptE^0CL8CP8U9Es- AP8 J F@t F$AP8^0CP8 N4F8FXN4z^0:)C0C,@_PPSV*^0t ALPPN4A APPPVpB ^pS$$蒩F<@t,0^0S4,F4@4F$pu@F$ F$t&V$p V$VX^0C4@fЀ@ CLPP^0 CPPP^0V$0V$`F$pC4N$ N$VyX^0 a YF$@t ࿉F$B$HB$PPjVFtP{4ut?Ct2 u.t*{,t SM9C$s Q薝^0T WF$ F$_F8K ^8SVP$VT$l^0{4"F4H4F$pu F$ F$& F8PFp$٦^0¯uC < t )ȅ/uC < t )ȅuC8 < t )ȅN4¯uA= < t )/uA= < t )A8= < )t~p ~8 N4^0CPHFIF$tFJ < H < ; )Ћ ; Mb))ʍډV[t+F$ u%F@tF0PH@D t V VEP t! Pw%U9u MA$t2 ȃPG%MHQDEt; Mx Ox 51N5vt CLPP^0Co CPPP]t0V$V$t)AF$F$t4F$@F$t@0 PPSV F$0ʃ 0GtWWCPf@ %PF0@Lf@ %PFSQh{h sPh jn~<@PPfF|%PfFD%PFPWh{h GsPh jgn~tPPfF|%PfFD%PFPPh{h rPh jnvUS E M@0u  tA$pu ؉A$u ЉA$[]f0uf@uf0uf@ufpUWVSP1}E fufW ƃf9WtZfGf9|Yf{Af<uUfDf ƉE% EfO fG4Z[^_]fȋ@fG뱐UUM Ѓ  ]ÍUU E  1]UU E  1]USUE у   %t []Ít&'USU E   t []U  E ]ÍUWVS 1119sa=   }ԋ=  E؉}f}ԋ}ĉ% Ƌ}؅%A á> 9r EP1jt P1t P> Pk}PWzE > 9MdEE)t&Ű] ECỦ]E9M+]   tƋ}̋EE E9|1볍vHUЀ|uG(M߉ut9} 4u 4tH]Ѐ| > 맅 < )ȅ3ƒ U~EEMbE)‹EU)ЍE WR WTee[^_]EEE UVS(u Sjm PPSjm t\QQSjl  t5RRSjl t e[^]à  Pl  Pl  Pl1F8Ѝe[^]ÐUS  ]Q~lZ  PrlX PflX PZlC8]Ít&U]ÍU D |)A D@< ǀ@< B4[B8B,0+B$*B(*B p'B`&B&B &B@'B@'B&B']ÐU D hjh@ k hjhD k$L fÍ'USP]w D u%PSh| Q2XZjSlg]ÍvD uD =)@ @D BD PPh ,S)g]QSh@|RͧD ŐUPPEU =w.D tOw2D U EfvhPhp|PjÉD E ,Ef벍UWVSh1WhL jsh D 9}5f@ D D t@u,ǃD F9|D PjWjhe[^_]à RЃ D ÐUEP P ]Ív'UEEtP P 1]Í&H H ]UEH H ]Ív'U]ÍU]ÍU1]É'USP1M ]Q$;St ]ÍA(u PRCPYS/gu ]PRCPAPht1]Í'UVSuF uCVF jjjE NQPRD; VFɈe[^]PPF@Pjh1ɉÅtPFPFPSfVF u^F v FPgF V؍&'USP1M ]Q$;SA(uPRSRAP ft1]PRCPAPgu]Ð&UVS1ۋEu PN$9)F(u3X)SQRFPet1fe[^]Í&XP)QRvV1gˍt&'UWVS E ]H$S19ZC<U )B(tT9 MrC9wmM9uPE @$PSVfuԸe[^_]Ív9w0U rfC9w!8uPM A$PSVdtC9vߍe1[^_]UWVSNJEZ$Eۋr~;8/?t}~L:M/?O19|HGR(E UM})߉};}wE]1C]U<DAeu1Gqu1Gft1Ѓgu1Gtu1Gu U1Ѓgu 1GetnuE|1Ѓltu!Ua1Gtu1Gt1Ѓlu1Geu1GE 1GEEEG.tX-ƒ: Шt}MuvE}M UEAQ EEG.u}|3}&EUUEǍ&0 ME1%ډE؉EEEMU]UM҉MUUEU1uUX| }$UMMU }~}UtM~1~TEuM EUQ AM UEQUAw!$E @P U BBE@[^_]Ã1[^_]| }tUMMU\EUM EUQAU BB뛋M IE@fU E P RPEPD%Ðt&UEP]fUEPQP@ ]ÍUWVS u }PPWCP5Yt9ue1[^_]Íe[^_]UWVSj(EPXtu=tSu)E_t:QUsREPCP/[u CU<tCu΋?ue1[^_]Íe[^_]à EPZ}r&USRË@tS u CPC\ S7\]à P҃C P\؍t&UWVS ǍX@09uG __uGHIHe[^_]à P[GHIHe[^_] UWVS8uP|Etxu e1[^_]ÐSSjjI[EtU؉PJEAJMA AAAWWj(SVtV@EQQj)PVRRNjE)ǍGPjZÅPWEPSYE܃xX 1:-u BFEF vw [[^_]ËWGщӃH)ˉFFVEF Gwv[[^_]ÐUWVSEEEPU%M IM WE1w%]}]ty{OyϋWM E A9UMOHrBE UGP @VEM 1ЉE]EAEUȍe[^_]ËU MOR Z‰ދU ] F CBV]9Ur>tRM ]N 9UY 1IuEUARRPWDe[^_]Ë] E[ F sTEk렋M A ASUWVSEEEPU4M IMM&WE1w%]}]ty{OyϋWM E A9UM܋OH|BE U܉GP @VM1ы]MM EAEU܉ȍe[^_]ËU M܉OR Z‰ދU ] F CBV]9U|>tRM ]܉N 9UY 1IuEUASSPWe[^_]Ë] E܉[ F sTEk렋M A ASfU1҉WVSEu u&/xW1t*Gw.Ѓu19pt-[^_]Ëwxډ[^_]1[^_]Ë@uÉ[^_]Ðt&UWVSQ1ҋEu u09PUӋR1t1MAw3ЋMu19pt0_[^_]ËSxډ_[^_]1_[^_]Ë@uÉ_[^_]Í&'UWVSE} 01u$a^Kx\S1we4u։9~s0v t&vuv1tt f@u[^_]9{r/vu[^_]9vvtӋ@u[^_]Ës랐UWVS EEEjjjIÃ}ظt4 EE1j Wh ,jSvF @t SDe[^_]XE8%ƃ֐UUM Ѓ $ ]ÍUU E $ 1]UU E $ 1]USUE у$  %t []Ít&'USU E$  t []U$ E( ]ÍUWVS,E> EE9E$  ( =  U܉M}؉EԋU܋EMUEU ta]1Rt&EUЃ t/M}؅%υtUM؋}fDBU}FCw;]|E@EE;Emu=D  1ۋ=  PESPW`BY^PES1.U;u%t1t&  |u FU;u%uӍe[^_]ËEH $ E؃tH|t؉ڃ ( t H| l  DZ FST Ju  < E f1)ЅM )CM  SQ&'UVSuP jD  t\PPSjD$ t5PPSjD( t e[^]à $ PD  PD1F8Ѝe[^]Í&US( ]PODX$ PCDY  R6DC8]U]ÍU D |)A D@< ǀ@< B4*B8B,PSB$`RB(SB PBNB OB @OBOBOB`OBO]ÐUSQ̀Ãv *@ۉZ[]É'U8 MʃɋU B]!Í&'UWVSE4 E9E, 58 Uu0 U1ۋuǃuɋ9tR=H D tɃ@ D ̀Ãv3?ۉ54 uf]EC]9E`4 [^_]Ít&'UV5, SӋu%4 0 @4  ؉[^]ÐUWVSSE] ƉEC<8 1uE8  ى Z[^_]Ít&'UWVSPE] ƉEC<8 1t!E'8  E9~U@  < Uùǃv <߉8MSSWQڍE9}E7u H|t&u]F u]9}< E8 DEMɋuEMɋtU H| t< ]z EPT u]F u]9}lve[^_]Ëut UR8 jE < )ExC]fEZUVS uу<@@ PPԻ@Pj?>< QQSj%>8 tlRRPj>0 t=PPPj=, t e[^]à 0 P= 8 P= < P= @ P9@ 1F8Ѝe[^]ÍJKvUSS]S , Qh=Z0 P\=X8 PP=X< PD=@ x P?9@ C8], 0 8 < Ít&UPP@P1҅x P8Ð&UPP@ x P8@ @ Í&'U D @ )A D@< ǀ@< B4)B8,B,ZB$XB(YB VB0ZB TBUBUB UBUB@VBV]ÐUSQ̀Ãv j8ۉZ[]É'UW=P VSË4u+ X Q ЉT X CX [^_]ÍUW=P VSËt3NX HX 9t T V Љ[^_]UP EM ]%ƒ ЃÍ&'U1VSSS]5P M tt#1^Z[^]Ð \ A \ 5P M 11‹ Љ^Z[^]ÍUVSQQ1ҋ]5P M t1u1m5P M 11‹ Љ^Z[^]Í'USj]SjSy]Ít&US]RP []ÐUWVS,EE EX EUfE1HET MEСP uЊ؃EE܅t\ H\ xsMЋH1 ؃d3E Q HEME|]M h EȋUܣh ]}H` 9vd @MMd  X uu D 1h ]9vUЋԻ9U}UЋ> 9U~U\ h p  l UЉ̀E؃v4]؋UEPPEPW肅EM؃9M\E3vU1 u]F uM؉]9M ]ԡl H DEЍȃdHttttD1=P uЊ` HD < ШV1D 4 V =P U1 $H D< Ш1D  }WTu]F uM؃]9M \ E=P 1ҋE1Ш tq tu u}Ƀ]1Ҋ%t tt uЋp 5x t ̀Ãv c2ۉEI]MЋH |L EPHT P ]1Ҋ ЉVH|-L EPHuf P ]1Ҋ Љ P u1Ҋ Љ P u1Ҋ ЉE5 < Ef1)ȅE)ȍx v` d @d e[^_]ãd E Ee[^_]ÁvUS]@p Ի9|n` @RRPj}3l tuPPPj_3T tEPPPjA3P tЋ]Ðt&뎃 T Q13 l R3 p P/p C81҉Ћ]Ã*t&USP ]P2XT P2X l Q2p x P.p C8]P T l UPP@1҅x PU.Ð&UPPp x P-.@Kp Í&'U D p )A D@< ǀ@< B41B8B,eB$cB(dB ]B0@eB\B\B\B @]B@]B]B]]ÐU=iEhjj1‰tFEPh`M hjR. u 1"t&5,ÐU5,UEEPh`M hj5.ÍvU`M ÉUj uhj5.ÉUj uhj5-ÉUE=t =t!v55U0WV}辘,…uEPu-jx/t&jEPR-Eut1e^_ÐU)tu tj ,1ÐUm5#/ÐUEM BJh1ÐUSUM ]HXh1]ÐUWVSE} ʉȻtzt80t1@80t,@80t'@utttu߃@@)ȍp} tUE xtL؉ڃtzt80t1@80t,@80t'@utttu߃@@)؃1ƅt7t9rU BPSQh"EP|.GPQUR .ED8e[^_]UEPЉ]U S]Eƒtt t@tjEPEPEPRE P+‰ECtjjReC1 E]]ÐUWVSu }UMEE@ |tE@|t1>t: wUU- P)EEPMQSjtzt80t1@80t,@80t'@utttu߃@@)PVjUP]ƃ u|^|uQ19sMUىڋDDC9r}t MQ+9sUډ@C9r18}t MQ+F w$, p[^_]ÐUWVST$(L$T$l$ d$h1ɉHuD$ AЃJ}u,||$t |$ |$~ D$ "1ɉG1Etq֍vC1`~JɃ@JЉGF1C0u9]1ɊMuL$ 1'Aw@@t D$ D$[^_]YZÐS1ҸL$ÊAt:1tڐA1u<}t A<,u9}u41Au1%1tڍvA1u9}%[UWVS11ҿL$ tBA1Ҋ:uv D$ X9}uCA9}t=1 v\BA1Ҋ*uv D$ 9} D$  D$0D$[^_]ÍvUWVSL$l$t$|$ 1Lwf$~1ۊY!#E9t]υt=1A1ҊQ 9At1t1%뎉[^_]ÍvUWVS1]1O~PP$LE PSƍv1C1ҊS À;At묅| 9t;At1뎉1C1ҊS À;At1%`FW1C1ҊS ƃ>FC4M!1̓w3$1ɊK1C 1C1ҊS 9u΃Fe[^_]ÉWVS1ۊL$|$1u14P~#Pd~1ҊQ1A 9ů0%[^_S1Ɋ T$1u1?uP~%[UWVS} jjjE1Ɋ O~U1C1ҊS 1uEPWS t1C1ҊS À;AtυtF1Ɋ AA?w9$S!1C!̓w$1BR Ѕ~1(jjj1PÃ9>e[^_]ÍvUWVSu]}vWU RP u1tC9sݸe[^_]ÉVSL$ A1A9^uAD$1ҋX t A1u19uy]u D$1[^ÐUWVS1۸Nju =t3%9uVPEPJ" uC<uθe[^_]ÍvUWVS]u },1ҊQ1A ‰G9rAЈAEPQue[^_]ST$\$ L$@BB+A*YZBBB[ÉS1ҋ\$D$L$ @)1CS )CK[UWVSEUMEEEhDžd`Dž\DžXhum e}EDžxxDžTDžP}ut|EpppE1ۉ\\uyEuDž\AMPtU(RQPQDžP h@k`E(PPEPRK` A1Cփv?t{uAPPtu:Pt1dd!M(QEPPWDžP hh@t4M(A #uEx}1ۊXt ut-u)`U(PREPPQa` |S$ГEU|M 1`}EU5ht }uE`DžTF``DžTG`}uEE|`txT ``ET@<:t<.t<=u5}(WEPEPK tEx:u EFEPU1ۊX^uDžLHM1ۊX DžLDžDDUDž@󫉕\t)\ExEDž\@EW[EP:t.t =lu(VEPQ` SDž4~E0x:tEJPUx^uDž4EUE)PRPƒ}Mht1ҋ0R}4Lt|>|01ۍU @C~01ۍ}4 ;BC~}ރue ue4t1ۍM 4C~1ۍU  C~uFuDžD \wjhWU PMQEP؃u Eu X6u)Ex\uxEu E^Dž\Ou(ND$ĕ1ۉT@C~ 1ۉD@4C~1ۊC~1ۍv4C~1ې C~e1ۍv 4C~Mnh@tuE1ۊD}-]GEw\uCjhRM PuVEPLƃ}ut}X9tx9,hڅ}Sك, t#U(B1Ɋ ʃ D@C9~bڅ}Sك:ht&U(Bډك D@Epu1ۊX]`\\DuU|xLt-}uEE`tB@ @E}uEU|txLt1`<F`1ۉ` C~ `;F`󥃅` H9uVEPEPE@PE>#.EEEEEETu} EutxU|T;E1҈ lU1DžHMB<+uEDžH EuT` t }(G0]u}u `E3:u }u`M5F`au}u`E7B`>`M9EFEF`}uEE`EG`OwJt K`]uDž(+TDž$u/T1A1ҊQ 9Buꋅ`()(uT`M`u(VjjTPWTRCST`MMT~`U(RjjTQtWTVP`EMFPFT1҃$tT$TVTMZ~HXt|} E|9}$WTR`Qt` F;u|݋E~+EEEp`EMB`tFPB`1҃$t `+$`$`P`WTR`Q` Ny$``+$X)11ҊAQ )$u Dž$`BF^`AY$u$`+(UCM HtRE`)SPPE`J`BF^E`PEX lU(DžT B,u hE<Dž8pux?ox}@%߃1#$ܕEPUx) EHMx)u EPElUEKzRu%`FLFFDž8E71B%z}1BHЍBEz)tU 1rLHЉuz)uu}#o `E@L`BJDž8EEEEFEUJM1B!t=xEGEHU]EJEN`PDžd@E`1ҍx}@%t1ҊTBЍAE1u~U&l`u(}AF)lj@FU(ˆAAA`DžTUJMB<< u(z^}EE<>uE+HDž E(PM(Y s 9 }a 1t u |;uE+n}M(+ A RSP u @CRQ VR D;E( @3<j1ɊJE}u(^?)tvEPUx)uME()1;pRCPWW t M(FY ;q|܋}(;w1Ҋ1C ƒ>`T>``V}(`w(  }(w(E(;P$P$EM111ҊEMTB1u勍`Tuu(^Rj}(GP ÅuE1C1ҊS u(jU$R`QS tu(^`JGG?U(+BG*Z_BGG`EhEEUdE%Eit1Ut>-t>Xt67stmt)xt"U     J @E<)t<:uh}E< ``PW`ECDžT w `T`ۈB`]]`hT`tT1ۍUv`F`C|}ui|Džtxt pu0p1E ЉEtt`}(1ɋ,N |YDž||EDU|txt pu!`pu(1v,B |EE}1[^_]ÉU0WVSU$M0]]EEƋEuMMq}@E1@UUEEЍUUԍMM؍EE܉E;E tEEPUMHE} t EIUBEBE@EE4PURMQEPURMQEPURMQ[$>At E}EIE}|9Et}}E}} | }}EMȀ9t σ} tKEEPV]ƒ}(u U$ ME]1SE8|])1F1ɊNV^ )ޅދEBU+EBEU*UPUEJM;E tE8)uBEE] EEUEME](U,:2EAU)BEM(шHuuEEe[^_]UWVS]u }jjVCP1Ƀ P~2d~1ɊJ1B    MQPPtEt JtKuEPWVRu01KAփwt z u}tAv uՃu1C1ҊS À;AAe[^_]ÉUWVS]u }jjjCP1Ƀ P~/d~1ɊJ1B    WPPtEt JtKuWVR u18Aփw z utu1C1ҊS À;AZe[^_]ÍvUWVS]} vjjWCP1O~PP;w?$E%PWQ |},}t |1A9t+qt1C1ҊS À;Ahe[^_]UVSu] MUEPRQjSV e[^]ÍvU|WVSDžDžDžDžDžDžDžDžDžDž}u}BEc4U}t M}uDžEU tDž E tDž}uEMEUḾMЋMEԋE @UEE1@ t  U t?E #u-Hp u { t/*t*+t%?t {u@PuF܃X $jE PPSPƃODž|  ڃuDž  F  JU U;M~Mx{f P!R SPPPtu uttuux? b @Psf PPP@P u tt u u)C)~ȉ~ @x? @ D Hx^uDž  Dž€:vu<]t/8\xEDž@r<\usjU RPPQƃF ؃usuXguDž }ODž <[u3EPPP tDž 0-Q\uSAjU RPPQÃ] ؃u1uX%t]tA1ۊY} |Dž 9P@+8uDž u l!x{[PGPPPPcd uttuuP+v?DžDž1z?FrF߃1$H@vP@t<)u担87DžRt#H@%u㋅8) PB<v?t { 5B1Buz)|lJB<uT);<w>M؃B1Buz)Dž*Dž)P@<=tt$\uxEuDž@DžHpt~DžË|(WЉƃ؅uDžM ERCP~NF fF(ffVffNfF}tSUV RDž-qDžbDžSDž'DDž5F F$EE1fNM1fF1fVEEM]܉MPDžEPjPPjjPPPPE PE PffFfEfF0}tN u8t Dž);~ DžfFf9Fv Džt:VЋU+M M}tE1U E􉕸PjWStNj}jWS |7tEЉъ%9tffNN @EPjStN |FFtt9tEЊ%9u fffFN x[^_]WVSD$|$t$W L$GH_D)9~1ID$ t2I~211Ҋ:FC88uӉIFC8uI[^_ÉU WVSuEMP9r a!]E$;Cr L!UM t]88pEvU M1Dž y8t;qHr ;qLvA<Pxd~] 1{C NjU? ;BB \щQ)IX]+KD ]$CPjURMQ]SEPE PV > M SX11ҊAQ M 9AtC  MA TQA ) 1PP$ ]$CPjURMQ]SEPE PV U 1ъB1ҊQ M 9At눋] {L1C1ҊS  =uEx`1҈"M19 }] C E$@Pj]SEPMQ]SuU 1ъB1ҊQ ЍDE PVD]$CSjjEPURMQE PV u?] 11ҊCS ЍDE 8Au@U 1ъB1ҊQ M 9AtS] 11ҊCS É] PjURMQ]SEPE PVUZ`t?{u9B`CPCPB PC MAL[E] Uz4t ;rLM]qPYTU 1BEU gM$ASjjEPURMQE PV t$K] 11ҊCS É] ;AtE 8B=U m]KTU 1ӊB1ҊS É] ;At] ME$@RjjMQ]SEPE PV( U 1ъB1ҊQ M 9At] "U ]1ъB1ҊQ );sDh U ]Dž@1BDC HCDLSH)‰PSL)‰TU )ÉX1ӊB1ҊS Љh1C1ҊS ЉlEUE\BX`Bdd@PуE SM 11YA ËEX@1Ed~1C1ҊS ЉEUM B`EEB`MMNjQU~#PЉEupEEMP EPRQ'UM$ ABLErLPjURMQEPURCPV u'EMA`Up9R]Ex`UH EPRQ1C1ҊS à ;AoEUB`Up9&RM ]$($CvPjURMQ]SEPE PV2 t&U 1ъB1ҊQ M 9At] 9{u9A`C ALESH CPRQ[] U E] M~ u/];sDdUB\BD9NMt(];sHs> +Ex(Uz( My0u)AHH9x ];sHUBH]1;sDtS1FE1;pHs]1S1҈‹] C] <u 9r09(`EU@Hu 9s > ?F;0MF;AH];sH U1ۊBFM;qHU1ۊBFM;qHU1ۊBFgM;qHU1ۊBFDM;qHyU1ۊBFd!M;qHVU1ۊBFAE M ]11ҊAQ  M 9}U B } ]CH)@ D)Љ] 138>XE Dž:KE M 8:1҈‰ 11yA NJY1A Éu DžE 2EPURQV SDž494 F4949> u))9~49u;i]1SUF494<;01t!49 ;M1QF494;1u49;M1QF494l;`1tQ49=;1M1QF494;1u49;M1QF494;1t49}q;siM1QtYF494}D;s<1u0;E$@PjEPURMQ]SE PVN u;,s[^_]UWVSM uDž88]}<4Dž,DžDžDž]S oZt mt}t } u}$~ H}$} 8EDžEEE@ t?t ytAEtAEtA Et Iu DžE8ERCPtDlWRDPMQgu wt1ҋG( ((($$$ 1fGfW1fOUUEMԋEEE܉NjAEċA EEUMȉEEEu@ut@ t nVUUUJm$E$)4R0fztK1fJVUUU)9|3tIPЉEu Dž,U U 6VUUUuEE)ʉUM$1fBE@9~@Et/ @@)B9sV(uc@t4fF1Ɉ Build options : TARGET = linux24e CPU = i586 CC = i586-flx-linux-gcc CFLAGS = -O2 -march=i586 -g -DBUFSIZE=8030 -DMAXREWRITE=1030 -DSYSTEM_MAXCONN=40000 OPTIONS = USE_TCPSPLICE=1 USE_LINUX_SPLICE=1 USE_CTTPROXY=1 USE_LINUX_TPROXY=1 USE_STATIC_PCRE=1 Default settings : maxconn = %d, maxpollevents = %d Usage : %s [-f ]* [ -vdVD ] [ -n ] [ -N ] [ -p ] [ -m ] -v displays version ; -vv shows known build options. -d enters debug mode ; -db only disables background mode. -V enters verbose mode (disables quiet mode) -D goes daemon -q quiet mode : don't display messages -c check mode : only check config files and exit -n sets the maximum total # of connections (%d) -m limits the usable amount of memory (in MB) -N sets the default, per-proxy maximum # of connections (%d) -p writes pids of all children to this file -de disables epoll() usage even when available -ds disables speculative epoll() usage even when available -dp disables poll() usage even when available -dS disables splice usage (broken on old kernels) -sf/-st [pid ]* finishes/terminates old pids. Must be last arguments. SIGHUP received, dumping servers states. SIGHUP received, dumping servers states for proxy %s. SIGHUP: Server %s/%s is %s. Conn: %d act, %d pend, %lld tot.SIGHUP: Proxy %s %s ! Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has no servers. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.SIGHUP: Proxy %s has %d active servers and %d backup servers available. Conn: act(FE+BE): %d+%d, %d pend (%d unass), tot(FE+BE): %lld+%lld.Error(s) found in configuration file : %s Using %s() as the polling mechanism. mode incompatible with and . Keeping only. is only meaningful in daemon mode. Setting limit to 1 process. Could not open configuration file %s : %s Fatal errors found in configuration. No polling mechanism available. Cannot load configuration file %s : too many configuration files (max %d). [%s.main()] Cannot raise FD limit to %d. [%s.main()] Cannot fix MEM limit to %d megs. [%s.main()] Cannot set gid %d. [%s.main()] Some options which require full privileges might not work well. [%s.main()] FD limit (%d) too low for maxconn=%d/maxsock=%d. Please raise 'ulimit-n' to %d or more to avoid any trouble. [%s.main()] Cannot enable tcp_splice. Make sure you have enough permissions and that the module is loadable. Alternatively, you may disable the 'tcpsplice' options in the configuration or add 'nosplice' in the global section, or start with '-dS'. [%s.main()] Some protocols failed to start their listeners! Exiting. [%s.main()] No enabled listener found (check the keywords) ! Exiting. [%s.main()] Some configuration options require full privileges, so global.uid cannot be changed. [%s.main()] Cannot set uid %d. Make sure you have enough permissions and that the module is loaded. [%s.main()] Cannot enable cttproxy. %s[%s.main()] Cannot chroot(%s). [%s.main()] Cannot create pidfile %s is running on backup servershas no server availableselectConfiguration file is valid %d [%s.main()] Cannot fork. Incorrect module version. ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+//haproxy?statsHAProxy Statistics0123456789ABCDEF}c\bufferDumping buffer %p %02x -- %04x: - data=%p l=%d r=%p w=%p lr=%p Dumping contents from byte %d to byte %d -RCHDLQT-cCsSPRIJanFebMarAprMayJunJulAugSepOctNovDecemergalertcriterrwarningnoticeinfodebugkernusermaildaemonauthsysloglprnewsuucpcronauth2ftpntpauditcron2local0local1local2local3local4local5local6local7-+[ALERT] %03d/%02d%02d%02d (%d) : [WARNING] %03d/%02d%02d%02d (%d) : sendto logger #%d failed: %s (errno=%d) socket for logger #%d failed: %s (errno=%d) <<<<>%s %2d %02d:%02d:%02d %s[%d]: %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %ld/%ld/%s%ld %s%lld %c%c %d/%d/%d/%d/%s%u %ld/%ld task%ds%dh%dd%dmAvailable polling systems : %10s : disabled, test result OKnone test result FAILEDpref=%3d, Total: %d (%d usable), will use %s. pipe'\%c' : deprecated use of a backslash before something not '\','x' or a digit. yuHAPROXYSSLCHK HAPROXYSSLCHK N /0123456789:@O_k @ ( 3=GO@@Xcl vsplice-requestsplice-responsesplice-autoaccept-invalid-http-requestaccept-invalid-http-responsedontlog-normallog-separate-errorsindependant-streamsabortoncloseallbackupscheckcacheclitcpkacontstatsdontlognullforceclosehttp_proxyhttpclosekeepalivelogasapnolingerredispatchsrvtcpkatcpsplicetransparentMissing port number: '%s' Invalid server address: '%s' Invalid server name: '%s' no backendneither frontend nor backendno rulesetnot enoughno frontendglobalnoepollnosepollnokqueuenopollnosplicequiettune.maxpolleventstune.maxacceptgroupnbprocmaxconnmaxpipesulimit-nchrootdescriptionpidfilespread-checksparsing [%s:%d] : %s listendefaultsbindinterfacemonitor-netmonitor-urimodehttpdisabledhealthenabledbind-processevenappsessionrequest-learnprefixquery-stringcaptureretriesblockunlessredirectlocationpath-parametersuse_backend(unknown)force-persistoptionhttplogtcplogheadercaphdrrewriteindirectinsertnocachedefault_backendredisprealmhttp-checkmonitorfaildisable-on-404send-statescopeenablehide-versionshow-nodeshow-descpostonlyclear-cookiecodedomaindrop-query%s; domain=%sappend-slashbacklogfullconngracebalanceserversourceusesrccliexpreqrepredirrisefallfastinterdowninterbackupweightminconnmaxqueueslowstarttrackclienthttpchkssl-hello-chksmtpchkforwardfororiginaltoX-Original-ToexceptX-Forwarded-ForHELO localhost HTTP/1.0%s %s %s OPTIONS %s HTTP/1.0 OPTIONS / HTTP/1.0 EHLOHELOreqdelreqdenyreqpassreqallowreqtarpitreqsetbereqisetbereqirepreqidelreqidenyreqipassreqiallowreqitarpitreqaddsrvexprspreprspdelrspdenyrspireprspidelrspidenyrspadderrorlocerrorloc302errorloc303%s%s errorfileerror near '%s' in %s sectionclientipintefacehdr_idxptrcapInvalid port '%d' specified for address '%s'. parsing [%s:%d] : '%s' ignored because %s '%s' has %s capability.%s parsing [%s:%d] : a '%s' rule placed after a 'block' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqxxx' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'reqadd' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'redirect' rule will still be processed before. parsing [%s:%d] : a '%s' rule placed after a 'use_backend' rule will still be processed before. parsing [%s:%d] : '%s' expects an integer argument. parsing [%s:%d] : '%s' already specified. Continuing. parsing [%s:%d] : user/uid already specified. Continuing. parsing [%s:%d] : group/gid already specified. Continuing. parsing [%s:%d] : cannot find user id for '%s' (%d:%s) parsing [%s:%d] : cannot find group id for '%s' (%d:%s) parsing [%s:%d] : gid/group was already specified. Continuing. parsing [%s:%d] : maxconn value %d too high for this system. Limiting to %d. Please use '-n' to force the value. parsing [%s:%d] : '%s' expects a directory as an argument. parsing [%s:%d]: '%s' expects a string argument. parsing [%s:%d]: '%s' requires valid node name - non-empty string with digits(0-9), letters(A-Z, a-z), dot(.), hyphen(-) or underscode(_). parsing [%s:%d] : '%s' expects a file name as an argument. parsing [%s:%d] : '%s' expects
and as arguments. parsing [%s:%d]: 'spread-checks' needs a positive value in range 0..50. parsing [%s:%d] : unknown log facility '%s' parsing [%s:%d] : too many syslog servers parsing [%s:%d] : Unknown host in '%s' parsing [%s:%d] : unknown optional minimum log level '%s' parsing [%s:%d] : Socket path '%s' too long (max %d) parsing [%s:%d] : unknown optional log level '%s' parsing [%s:%d]: '%s' expects an integer argument (0..50). parsing [%s:%d]: spread-checks already specified. Continuing. parsing [%s:%d] : unknown keyword '%s' in '%s' section error near '%s' in '%s' sectionparsing [%s:%d] : character '%c' is not permitted in '%s' name '%s'. Parsing [%s:%d]: %s '%s' has same name as another %s. parsing [%s:%d] : '%s' expects an argument and optionnally supports [addr1]:port1[-end1]{,[addr]:port[-end]}... parsing [%s:%d] : out of memory. parsing [%s:%d] : 'listen' or 'defaults' expected. parsing [%s:%d] : '%s' expects address[/mask]. parsing [%s:%d]: custom id has to be unique but is duplicated in %s and %s. parsing [%s:%d] : '%s' not allowed in 'defaults' section. parsing [%s:%d] : '%s' expects an URI. parsing [%s:%d] : '%s' only supports the 'transparent' and 'interface' options. parsing [%s:%d] : '%s' : missing interface name. parsing [%s:%d] : '%s' expects [addr1]:port1[-end1]{,[addr]:port[-end]}... as arguments. parsing [%s:%d]: custom id has to be > 1000. parsing [%s:%d]: '%s' expects an integer argument. parsing [%s:%d]: '%s' not allowed in 'defaults' section. parsing [%s:%d] : character '%c' is not permitted in acl name '%s'. parsing [%s:%d] : error detected while parsing ACL '%s'. parsing [%s:%d] : unexpected character '%c' in %s timeout. parsing [%s:%d] : '%s' expects 'appsession' 'len' 'timeout' [options*]. parsing [%s:%d] : '%s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d] : error detected while parsing blocking condition. parsing [%s:%d] : '%s': error detected while parsing redirect condition. parsing [%s:%d] : unknown proxy mode '%s'. parsing [%s:%d]: %s references process number higher than global.nbproc. parsing [%s:%d]: %s expects 'all', 'odd', 'even', or process numbers from 1 to 32. parsing [%s:%d] : '%s': missing argument for '%s'. parsing [%s:%d] : unknown mode '%s' parsing [%s:%d] : '%s' expects a backend name. parsing [%s:%d] : acl '%s' involves some response-only criteria which will be ignored. parsing [%s:%d] : error detected while parsing switching rule. parsing [%s:%d] : error detected while parsing a 'force-persist' rule. parsing [%s:%d] : truncating capture length to %d bytes. parsing [%s:%d] : '%s' expects 'cookie' 'len' . parsing [%s:%d] : '%s %s' not allowed in 'defaults' section. parsing [%s:%d] : '%s %s' expects 'header' 'len' . parsing [%s:%d] : '%s' expects 'cookie' or 'request header' or 'response header'. parsing [%s:%d] : cookie 'rewrite' and 'indirect' modes are incompatible. parsing [%s:%d] : cookie 'rewrite', 'insert' and 'prefix' modes are incompatible. parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : '%s' expects a redirection type ('prefix' or 'location'). parsing [%s:%d]: keyword '%s' is deprecated, please use 'option redispatch' instead. parsing [%s:%d] : '%s' expects 'uri', 'realm', 'auth', 'scope' or 'enable', 'hide-version', 'show-node', 'show-desc'. parsing [%s:%d] : 'uri' needs an URI prefix. parsing [%s:%d] : 'realm' needs an realm name. parsing [%s:%d] : '%s' only supports 'disable-on-404'. parsing [%s:%d] : 'auth' needs a user:password account. parsing [%s:%d] : unexpected character '%c' in stats refresh interval. parsing [%s:%d] : 'scope' needs a proxy name. parsing [%s:%d]: '%s %s' invalid node name - should be a stringwith digits(0-9), letters(A-Z, a-z), hyphen(-) or underscode(_). parsing [%s:%d]: out of memory. parsing [%s:%d]: '%s' expects an option name. parsing [%s:%d] : '%s': unsupported HTTP code '%d'. parsing [%s:%d] : '%s': missing HTTP code. parsing [%s:%d]: character '%c' is not permitted in domain name '%s'. parsing [%s:%d] : '%s' only supports 'fail'. parsing [%s:%d] : '%s %s' requires either 'if' or 'unless' followed by a condition. parsing [%s:%d]: '%s' requires a parameter or 'desc' to be set in the global section. parsing [%s:%d] : unknown stats parameter '%s' (expects 'hide-version', 'uri', 'realm', 'auth' or 'enable'). parsing [%s:%d] : '%s' expects as argument. parsing [%s:%d] : character '%c' is not permitted in server name '%s'. parsing [%s:%d] : 'log' expects either and or 'global' as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : server %s has neither service port nor check port. Check has been disabled. parsing [%s:%d]: unable to enable checks and tracking at the same time! parsing [%s:%d]: '%s' has to be > 0. parsing [%s:%d]: 'track' expects [/] as argument. parsing [%s:%d] : unexpected character '%c' in 'slowstart' argument of server %s. parsing [%s:%d]: invalid value %d for argument '%s' of server %s. parsing [%s:%d]: unexpected character '%c' in 'downinter' argument of server %s. parsing [%s:%d]: unexpected character '%c' in 'fastinter' argument of server %s. parsing [%s:%d] : unexpected character '%c' in 'inter' argument of server %s. Maybe you want 'maxconn' instead ?parsing [%s:%d] : unexpected character '%c' in grace time. parsing [%s:%d] : '%s' expects a time in milliseconds. Maybe you want 'fullconn' instead ?parsing [%s:%d]: '%s' expects as argument. parsing [%s:%d] : '%s' supports 'rewrite', 'insert', 'prefix', 'indirect', 'nocache' and 'postonly', 'domain' options. parsing [%s:%d]: domain '%s' contains no embedded dots nor does not start with a dot. RFC forbids it, this configuration may not work properly. parsing [%s:%d] : '%s' expects an integer argument (dispatch counts for one). parsing [%s:%d] : error detected while parsing a '%s %s' condition. parsing [%s:%d] : unknown option '%s'. parsing [%s:%d] : '%s %s %s' expects
[/mask] as argument. parsing [%s:%d] : '%s %s %s' expects as argument. parsing [%s:%d] : '%s %s' only supports optional values: 'except' and 'header'. parsing [%s:%d]: negation is not supported for option '%s'. parsing [%s:%d] : '%s' expects 'code', 'prefix', 'location', 'set-cookie', 'clear-cookie', 'drop-query' or 'append-slash' (was '%s'). parsing [%s:%d] : '%s' expects and [:] as arguments. parsing [%s:%d] : '%s' expects and as arguments. parsing [%s:%d] : bad regular expression '%s'. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : invalid character or unterminated sequence in replacement string near '%c'. parsing [%s:%d] : '%s' expects
as an argument. parsing [%s:%d] : too many '%s'. Continuing. parsing [%s:%d] : '%s' expects as an argument. parsing [%s:%d] : status code %d not handled, error relocation will be ignored. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : custom error message file <%s> larger than %d bytes. Truncating. parsing [%s:%d] : error reading file <%s> for custom error message <%s>. parsing [%s:%d] : error opening file <%s> for custom error message <%s>. parsing [%s:%d] : <%s> expects and as arguments. parsing [%s:%d] : status code %d not handled, error customization will be ignored. parsing [%s:%d] : invalid source port range %d-%d. parsing [%s:%d] : weight of server %s is not within 0 and 256 (%d). parsing [%s:%d] : '%s' expects [:], 'client', or 'clientip' as argument. parsing [%s:%d] : '%s' expects [:[-]], and optional '%s' as argument. parsing [%s:%d] : server %s only supports options 'backup', 'cookie', 'redir', 'check', 'disabled' ,'track', 'id', 'inter', 'fastinter', 'downinter', 'rise', 'fall', 'addr', 'port', 'source', 'minconn', 'maxconn', 'maxqueue', 'slowstart' and 'weight'. parsing [%s:%d] : '%s' only allowed after a '%s' statement. parsing [%s:%d] : '%s' expects [:], and optionally '%s' , and '%s' . parsing [%s:%d] : '%s' only supports optional keywords '%s' and '%s'. parsing [%s:%d]: line too long, truncating at word %d, position %ld: <%s>. parsing [%s:%d]: negation currently supported only for options. parsing [%s:%d] : invalid or incomplete '\x' sequence in '%s'. parsing [%s:%d]: line too long, limit: %d. parsing [%s:%d] : unknown keyword '%s' out of section. config : missing timeouts for %s '%s'. | While not properly invalid, you will certainly encounter various problems | with such a configuration. To fix this, please ensure that all following | timeouts are set to a non-zero value: 'client', 'connect', 'server'. config : %s '%s' : server cannot have cookie or redirect prefix in non-HTTP mode. config : HTTP proxy %s has a cookie but no server list ! config : '%s' will be ignored for %s '%s' (requires 'option httpchk'). config : %s '%s' has no listen address. Please either specify a valid address on the line, or use the keyword. config : %s '%s' cannot use both transparent and balance mode. config : dispatch address of %s '%s' will be ignored in balance mode. Proxy '%s': loop detected for use_backend: '%s'. config : %s '%s' : fullconn is mandatory when minconn is set on a server. Proxy '%s': unable to find required use_backend: '%s'. config : %s '%s', server '%s': unable to use %s/%s fortracking: disable-on-404 option inconsistency. config : %s '%s', server '%s': unable to find required server '%s' for tracking. config : %s '%s', server '%s': unable to use %s/%s for tracking as it does not have checks enabled. config : servers will be ignored for %s '%s'. Proxy '%s': loop detected for default_backend: '%s'. Proxy '%s': unable to find required default_backend: '%s'. Proxy '%s': loop detected for setbe: '%s'. config : no line. Nothing to do ! config : %s '%s' cannot be in health mode as it has no frontend capability. config : log format ignored for %s '%s' since it has no log address. config : %s '%s', server '%s': unable to find required proxy '%s' for tracking. Proxy '%s': unable to find required setbe: '%s'. %s '%s' has no server available! %s %s has no server available! . %d active and %d backup servers left.%s %d sessions active, %d requeued, %d remaining in queue. . %d active and %d backup servers online.%s %d sessions requeued, %d total in queue. Load-balancing on %sServer %s/%s is disabledLoad-balancing on %sServer %s/%s is enabled again; name=%s/%s; node=%s; weight=%d/%d; scur=%d/%d; qcur=%dCannot bind to tproxy source address before connect() for %s '%s'. Aborting. Cannot bind to tproxy source address before connect() for server %s/%s. Aborting. Cannot bind to source address before connect() for %s '%s'. Aborting. Cannot bind to source address before connect() for server %s/%s. Aborting. Starting [%s:%s] check: out of memory. Backup %sServer %s/%s is DOWN Running on backup. via %s/%s%sServer %s/%s is UPDOWN %d/%dUP %d/%dNOLB %d/%dNOLBno check; throttle=%d%%HTTP/1.0pendconnsrc_portdstdst_portdst_connOK HTTP/1.0 200 OK HTTPTCP%08x:%s.accept(%04x)=%04x from [%s:%d] Connect from %s:%d to %s:%d (%s/%s) out of memory in event_accept(). accept(): cannot set the socket in non blocking mode. Giving up Proxy %s reached system memory limit at %d sockets. Please check system tunables. accept(): not enough free sockets. Raise -n argument. Giving up. Proxy %s reached process FD limit at %d. Please check 'ulimit-n' and restart. Proxy %s reached system FD limit at %d. Please check system tunables. clitimeoutcontimeoutsrvtimeoutrate-limittcpunknownconnectsessions%s '%s': must be 'sessions'Proxy %s started. Starting %s %s: %s Stopping %s %s in %d ms. Pausing %s %s. Enabling %s %s. %s timeout will be ignored because %s '%s' has no %s capabilityoverwriting %s timeout which was already specifiedunexpected character '%c' in %s timeout%s timeout expects an integer value (in milliseconds)undocumented 'timeout appsession' may not do what you think and will be removed in next versiontimeout '%s': must be 'client', 'server', 'connect', 'check', 'appsession', 'queue', 'http-request' or 'tarpit'overwriting %s %s which was already specified%s %s will be ignored because %s '%s' has no %s capability%s %s expects expects an integer value (in sessions/second)%s %s: unexpected character '%c' in integer value '%s'Refusing to use duplicated proxy '%s' with overlapping capabilities: %s/%s! Unable to use proxy '%s' with wrong mode, required: %s, has: %s. You may want to use 'mode %s'. Refusing to use duplicated server '%s' fould in proxy: %s! config : cookie will be ignored for %s '%s' (needs 'mode http'). config : server regular expressions will be ignored for %s '%s' (needs 'mode http'). config : client regular expressions will be ignored for %s '%s' (needs 'mode http'). config : monitor-uri will be ignored for %s '%s' (needs 'mode http'). config : Layer 7 hash not possible for %s '%s' (needs 'mode http'). Falling back to round robin. config : 'option httplog' not usable with %s '%s' (needs 'mode http'). Falling back to 'option tcplog'. Proxy %s stopped (FE: %lld conns, BE: %lld conns). %s %s failed to enter pause mode. Some proxies refused to pause, performing soft stop now. Port %d busy while trying to enable %s %s. -6Unknown command. Please enter one of the following commands only : show info : report information about the running process show stat : report counters for each proxy and server show errors : report last request and response errors for each proxy show sess : report the list of current sessions %s.%d.tmp%s.%d.bakshowstatname too long for UNIX socket (%s). Aborting. Invalid empty name for a UNIX socket. Aborting. error when trying to unlink previous UNIX socket (%s). Aborting. error when trying to preserve previous UNIX socket (%s). Aborting. cannot change UNIX socket ownership (%s). Aborting. socket(): not enough free sockets for UNIX listener (%s). Raise -n argument. Aborting. cannot make UNIX socket non-blocking. Aborting. cannot create socket for UNIX listener (%s). Aborting. cannot listen to socket for UNIX listener (%s). Aborting. cannot switch final and temporary sockets for UNIX listener (%s). Aborting. cannot bind socket for UNIX listener (%s). Aborting. out of memory in uxst_event_accept(). N1I3PD5RNIDVCONNECTDELETEGETHEADPOSTPUTTRACE >HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: text/html

200 OK

HAProxy: service ready. a1h!!!!!i&`y Vk%V$%e%$3%$\('&h'&C'&HTTP/1.0 401 Unauthorized Cache-Control: no-cache Connection: close Content-Type: text/html WWW-Authenticate: Basic realm="%s"

401 Unauthorized

You need a valid user and password to access this content. HTTP/1.0 303 See Other Cache-Control: no-cache Connection: close Location: HTTP/1.0 302 Found Cache-Control: no-cache Connection: close Location: HTTP/1.0 301 Moved Permantenly Cache-Control: no-cache Connection: close Location: HTTP/1.0 400 Bad request Cache-Control: no-cache Connection: close Content-Type: text/html

400 Bad request

Your browser sent an invalid request. HTTP/1.0 403 Forbidden Cache-Control: no-cache Connection: close Content-Type: text/html

403 Forbidden

Request forbidden by administrative rules. HTTP/1.0 408 Request Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

408 Request Time-out

Your browser didn't send a complete request in time. HTTP/1.0 500 Server Error Cache-Control: no-cache Connection: close Content-Type: text/html

500 Server Error

An internal server error occured. HTTP/1.0 502 Bad Gateway Cache-Control: no-cache Connection: close Content-Type: text/html

502 Bad Gateway

The server returned an invalid or incomplete response. HTTP/1.0 503 Service Unavailable Cache-Control: no-cache Connection: close Content-Type: text/html

503 Service Unavailable

No server is available to handle this request. HTTP/1.0 504 Gateway Time-out Cache-Control: no-cache Connection: close Content-Type: text/html

504 Gateway Time-out

The server didn't respond in time. Internal error: no message defined for HTTP return code %d. Aborting. %s:%d [%02d/%s/%04d:%02d:%02d:%02d.%03d] %s %s/%s %d/%ld/%ld/%ld/%s%ld %d %s%lld %s %s %c%c%c%c %d/%d/%d/%d/%s%u %ld/%ld%s HTTP capture : out of memory. Not enough memory process_cli():asession->sessid:malloc(). HTTP logging : out of memory. Not enough Memory process_srv():asession->sessid:malloc(). Not enough Memory process_srv():asession:calloc(). Not enough Memory process_srv():asession->serverid:malloc(). Blocking cacheable cookie in response from instance %s, server %s. ; Expires=Thu, 01-Jan-1970 00:00:01 GMTmethodreq_verresp_verstatusurlurl_begurl_endurl_suburl_dirurl_domurl_regurl_ipurl_portshdrshdr_regshdr_begshdr_endshdr_subshdr_dirshdr_domshdr_cntshdr_valshdr_ippathpath_regpath_begpath_endpath_subpath_dirpath_dom"#{|}"#requri;up;norefresh;csvAuthorization: Basic Transfer-EncodingchunkedPragmano-cacheCache-controlpublics-maxage=0no-storemax-age=0no-cache="set-cookieSet-CookieSet-Cookie2%08x:%s.%s[%04x:%04x]: ConnectionSet-Cookie: %s=%s; path=/srvrepsrvhdrCache-control: privateConnection: close: %d.%d.%d.%dclireqclihdr: %s /Expect100-continueContent-Lengthappsesssessidserveridappsession_task_init failed (null)appsession_refresh: cleaning up expired Session '%s' on Server %s nbsrvconnslotsfe_sess_ratebe_sess_ratefe_connbe_connavg_queuelocal address already in useCannot connect: %s. Cannot get a server socket. no free portsroundrobinleastconndepthurl_paramcheck_posthdr(use_domain_onlyCannot bind to tproxy source address before connect() for proxy %s. Aborting. Cannot bind to tproxy source address before connect() for proxy %s. Cannot set client socket to non blocking mode. Connect() failed for server %s/%s: %s. Cannot bind to tproxy source address before connect() for server %s/%s. socket(): not enough free sockets. Raise -n argument. Giving up. Cannot bind to source address before connect() for server %s/%s. Cannot bind to source address before connect() for proxy %s. Aborting. Cannot bind to source address before connect() for proxy %s. 'balance uri len' expects a positive integer (got '%s').'balance uri depth' expects a positive integer (got '%s').'balance uri' only accepts parameters 'len' and 'depth' (got '%s').'balance url_param' requires an URL parameter name.'balance hdr(name)' requires an http header field name.'balance' only supports 'roundrobin', 'leastconn', 'source', 'uri', 'url_param' and 'hdr(name)' options.'balance hdr(name)' only accepts 'use_domain_only' modifier.'balance url_param' only accepts check_post modifier.DN %d/%d ↑UP %d/%d ↓NOLB %d/%d ↓no checkMAINTDOWN,DOWN %d/%d,UP %d/%d,UP,NOLB %d/%d,NOLB,no check,MAINT,emptyOPENFULLSTOP activeY%d %% - %lld,%lld,%d,%d,%s,%d,%d,%d,,%lld,%s/%s,%u,,%u,,,,,

%s text/plaintext/html on unlimited MB Refresh: %d ,wx=%s,ax=%s] s0=[%d,%1xh,fd=%d,ex=%s] s1=[%d,%1xh,fd=%d,ex=%s] exp=%s%p: proto=%s run(nice=%d) src=%s:%d fe=%s be=%s srv=%s %05d%c 'stats socket' in global section expects a path to a UNIX socket'stats socket' already specified in global section'stats socket' only supports 'user', 'uid', 'group', 'gid', and 'mode'unknown group '%s' in 'global' section ('stats group')'stats' only supports 'socket', 'maxconn' and 'timeout' in 'global' sectionunexpected character '%c' in 'stats timeout' in 'global' sectionunknown user '%s' in 'global' section ('stats user')'stats socket' path would require truncationa positive value is expected for 'stats timeout' in 'global section'a positive value is expected for 'stats maxconn' in 'global section'# pxname,svname,qcur,qmax,scur,smax,slim,stot,bin,bout,dreq,dresp,ereq,econ,eresp,wretr,wredis,status,weight,act,bck,chkfail,chkdown,lastchg,downtime,qlimit,pid,iid,sid,throttle,lbtot,tracked,type,rate,rate_lim,rate_max,
%s%s
%s,BACKEND,%d,%d,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,,%lld,%lld,%lld,%lld,%s,%d,%d,%d,,%d,%d,%d,,%d,%d,0,,%lld,,%d,%u,,%u, %s,%s,%d,%d,%d,%d,%s,%lld,%lld,%lld,,%lld,,%lld,%lld,%lld,%lld,DOWN%s,FRONTEND,,,%d,%d,%d,%lld,%lld,%lld,%lld,%lld,%lld,,,,,%s,,,,,,,,,%d,%d,0,,,,%d,%u,%u,%u, HTTP/1.0 200 OK Cache-Control: no-cache Connection: close Content-Type: %s Statistics Report for HAProxy%s%s version 1.3.27, released 2015/02/01

HAProxy%s

Statistics Report for pid %d%s%s%s%s

> General process information

QueueSession rateSessionsBytesDeniedErrorsWarningsServer
CurMaxLimitCurMaxLimitCurMaxLimitTotalLbTotInOutReqRespReqConnRespRetrRedisStatusWghtActBckChkDwnDwntmeThrtle
Frontend%s%s%s%s%s%s%s%s%s%s%s%s%s
Backend%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%s %s%d%d%d %d%s
%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s %lld%lld%d%s%svia %s/%s%lld%lld%s

pid = %d (process #%d, nbproc = %d)
uptime = %dd %dh%02dm%02ds
system limits: memmax = %s%s; ulimit-n = %d
maxsock = %d; maxconn = %d; maxpipes = %d
current conns = %d; current pipes = %d/%d
Running tasks: %d/%d
 active UP  backup UP
active UP, going down backup UP, going down
active DOWN, going up backup DOWN, going up
active or backup DOWN  not checked
Note: UP with load-balancing disabled is reported as "NOLB".		Display option:External ressources:

  • Disable refresh
    Name: HAProxy Version: 1.3.27 Release_date: 2015/02/01 Nbproc: %d Process_num: %d Pid: %d Uptime: %dd %dh%02dm%02ds Uptime_sec: %d Memmax_MB: %d Ulimit-n: %d Maxsock: %d Maxconn: %d Maxpipes: %d CurrConns: %d PipesUsed: %d PipesFree: %d Tasks: %d Run_queue: %d node: %s description: %s rq[f=%06xh,l=%d,an=%02xh,rx=%s rp[f=%06xh,l=%d,an=%02xh,rx=%s as=%d ts=%02x age=%s calls=%d WARNING! update detected on this snapshot, dump interrupted. Please re-check! [%02d/%s/%04d:%02d:%02d:%02d.%03d] frontend %s (#%d): invalid request src %s, session #%d, backend %s (#%d), server %s (#%d) request length %d bytes, error at position %d: backend %s (#%d) : invalid response src %s, session #%d, frontend %s (#%d), server %s (#%d) response length %d bytes, error at position %d: zC@Mk0e To0%req_lenreq_ssl_vertcp-requestcannot do so_reuseaddrcannot bind socketcannot listen to socketinspect-delaycontentrejectresponse-onlylayer 7 (unexpected character '%c')cannot make socket non-blockingnot enough free sockets (raise '-n' parameter)cannot create listening socketcannot bind listener to devicecannot make listening socket transparentacl '%s' involves some %s criteria which will be ignored.'%s %s' expects a positive delay in milliseconds, in %s '%s'ignoring %s %s (was already defined) in %s '%s'missing argument for '%s' in %s '%s'unknown argument '%s' after '%s' in %s '%s''%s %s' expects 'accept' or 'reject', in %s '%s' (was '%s')%s %s is not allowed in 'defaults' sections'%s %s %s' only accepts 'if' or 'unless', in %s '%s' (was '%s')error detected in %s '%s' while parsing '%s' condition%08x:%s.closed[%04x:%04x] %08x:%s.clicls[%04x:%04x] %08x:%s.srvcls[%04x:%04x] Received unhandled signal %d. Signal has been disabled. Signal %d : signal queue is unexpectedly full. Failed to register signal %d : out of range [0..%d]. TRUEalways_trueFALSEalways_falseLOCALHOST127.0.0.1/8HTTP_1.0HTTP_1.1METH_CONNECTMETH_GETMETH_HEADMETH_OPTIONSMETH_POSTMETH_TRACEHTTP_URL_ABS^[^/:]*://HTTP_URL_SLASHHTTP_URL_STAR*HTTP_CONTENThdr_val(content-length)gtREQ_CONTENTWAIT_ENDwait_end||w$||w$||w$|WIw$|WI|w$|PI|w$|PI} }w$}PI }w$}PI}w$}PI$}w$)}PI.}w$4}IA}w$L}sIKw$[}oIi}w$k}x}}w$}dx}w$}}w$w$ccccccc!=====c66)6C6R69"9-9y99parsing acl '%s' : matching '%s' for pattern '%s' is likely a mistake and probably not what you want. Maybe you need to remove the extraneous space before '('. If you are really sure this is not an error, please insert '--' between the match and the pattern to make this warning message disappear. Dumping pools usage. [SHARED] - Pool %s (%d bytes) : %d allocated (%u bytes), %d used, %d users%s Total: %d pools, %lu bytes allocated, %lu used. /sbin/modprobe-s-k--tcp_splicet      ׃ɃdP?1 ՂȂmatch failedbad argumentbad back referencefailed to get memoryexpression too bigbad range inside []unbalanced ()empty expressionbad escape sequencebad classcollation error - not relevantunbalanced []unbalanced {}? * + invalidpattern errorinvalid repeat counts in {}internal errorunknown error code at offset %s%s%-6dlllklkllllk:;<=>?@[\]^_` ~xrlf`ZTNHB<70xdigitwordspacepunctprintgraphdigitcntrlblankasciialnumupperloweralpha@`  @ unknown property name after \P or \pmalformed \P or \p sequencesupport for \P, \p, and \X has not been compiledinvalid UTF-8 stringtwo named groups have the same namesyntax error after (?Punrecognized character after (?Precursive call could loop indefinitelyclosing ) for (?C expectednumber after (?C is > 255PCRE does not support \L, \l, \N, \U, or \u\C not allowed in lookbehind assertioninvalid condition (?(0)character value in \x{...} sequence is too largespare errorthis version of PCRE is not compiled with PCRE_UTF8 supportPOSIX collating elements are not supportedunknown POSIX class name(?R or (?digits must be followed by )assertion expected after (?(conditional group contains more than two branchesmalformed number after (?(lookbehind assertion is not fixed lengthunrecognized character after (?<internal error: code overflowunmatched parenthesesfailed to get memoryregular expression too largeparentheses nested too deeplymissing ) after commentunknown option bit(s) seterroffset passed as NULLreference to non-existent subpatternmissing )POSIX named classes are supported only within a classunrecognized character after (?internal error: unexpected repeatoperand of unlimited repeat could match the empty stringnothing to repeatrange out of order in character classinvalid escape sequence in character classmissing terminating ] for character classnumber too big in {} quantifiernumbers out of order in {} quantifierunrecognized character follows \\c at end of pattern\ at end of patternno error llllllllll-n-n-n-n-n-n-n-n-n-n-n-n-n-n-n-n-n-nl-nl-n-n-n-n-n-nl-n-n-n-n-n-n-n-n-n-n-n-n-nn-n-n-n-n-n-n-n-nl-n-n-n-n-n-n-n-nl-n-nmooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo`ppppppppppppppp+qppppppp+q+q+q+q+q+q+q+q+qp+q+q+q+q+q+q+q+q+q+q+q+q+q+q+q+q+qp+q+q+q+q+q+q+q+qpp+q+q+qp`p`p`p`pppppp.p.pp+q+qp.p+q+q%q%q+q+qpprrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrararrrrrrrrrrrrrrrxrxrv                                   ;w   v~~  Zw                .~                           w w                            }vzzE{'{{z3----------$ BQ*͔͔͔͔ʔJJJҜסJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJ™^JJJJJJJJJJJJJJJJJJJJJJJJJJJJJ̘`ߟߟߟߟߟߟߟߟߟߟߟߟrrrrrrrrrr`ߟڞ``ߟߟߟߟߟߟߟߟߟߟߟߟߟߟߟߟߟlX̠̠̠M̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠D̠̠<̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠̠$̠̠̠̠̠,̠̠̠̠4ʳhh8^ǵɴ   `Ooֺ~QQ/......־RR&         Ƭ,,۰)EQOJduRtD|W!! ߢ٢עâ     ypg\UOF=92*# ߡ!١"С#͡ʡǡġ $   %& '}(r)f*`+X,VSPMJGDA;-96..&/# 0 123456ݠ7ؠ8Р9Ǡ:;<ZsZpZlZYiUgariticTifinaghTibetanThaiThaanaTeluguTamilTai_LeTagbanwaTagalogSyriacSyloti_NagriSoSmSkSinhalaShavianScSRunicPsPoPiPfPePdPcPOsmanyaOriyaOld_PersianOld_ItalicOghamNoNlNew_Tai_LueNdNMyanmarMongolianMnMeMcMalayalamMLuLtLoLmLlLinear_BLimbuLatinLaoL&LKhmerKharoshthiKatakanaKannadaInheritedHiraganaHebrewHanunooHangulHanGurmukhiGujaratiGreekGothicGlagoliticGeorgianEthiopicDevanagariDeseretCyrillicCypriotCsCopticCommonCoCnCherokeeCfCcCanadian_AboriginalCBuhidBugineseBrailleBopomofoBengaliArmenianArabicAnyd  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~x;*4+`zR| ( (H| Px@+0D`S[e$  Dh( ` ԏ8o\oo4 *:JZjzʓړ *:JZjzʔڔ *:JZjzʕڕ *:JZjzʖږ *:JZjzʗڗ *:JZjz, ' '.39>CHOT[_dintx|@A$@42@90P3J$9P3N$@4`2@W$@42n&k&v&&&unix_streamnl{  ?@@ API0oooWIPpp._IPpq.hI@4`q2oI3q.sI3q/{I3q0I3q0I3q2I3q2I3q.I9rP3I@4r2K3s.I3s.I3s/I3s0I3s0I3s2I3s2I@4t2I@4u2J9PwP3I3t.I3t.I3t/I3t0I3t0I3t2I3t2I@4u2I@4@v2J9wP3J3w. J3w.J3w/J3w0(J3w01J3w2:J3w2xA4BBCDXE0F_L@42eL@42oL@4`2|L@42L@42L@42L@42L@42 #QQ#Q$QQQQQRRRR"Rdx@42lx62xx0tcpv6  {tcpv4{``|P.-p.|P.0.p.}P..p.֍`@Y e@NJa@҉f@ `G ‡@$цe@ttQed0fd0fP<_Q9_6Z=2FGT` w!"#%&123-4F5^6w89;=>? @ A7BOCeD|EFGHIN/QGRgS~TUVX[^e-hGlaqzruvyz } 6 Q m F  X # 4 < C? F[ S Z, ^I a - 7  bV  -K#) >TH~KLUZL^abI?5O7h89:I)AXa i0lVPkRobj,E"Z#p$%&'(-1=B2GILaQwWchmstz*F@RY^p $=VoW( ' n &  !12!7J!J!Q!!!!""L#b##: ####$%>4u4444445,5O5z55555162%64<6;S6Bo6C6D6I6M6N6O7T:7[V7ar7b7d7h7n7o8q878O8h8!:Y::&<?<f<=$.=D=====>k>>>>s?c@.AAA8B\BBBDCC1D\HDDDCEEE F$"FX,8F(TFoFGFFԸ5F G%#GyIkIJ{JJKPKxKK(L3M!OMM6M{NNNO>OOO$PQSe5TMTtTT7TT U5U#Vk9VwV V?XX+X,X-XYB^Y)B}YlZZgF5Z ZZ Z-[[[6[*\&\&b\)\,\-\\ ] %] D] a]~]]]]]^9^X^|^^^^^_?_____!_"_#`&$`/[`$~`` ````` a a4aJa`avaaaa3b8Mbb8bb=c.c&-ic9-$-c$CgDD$ c$J gcIDK$"c$R0gcQDS$"d$pTgdoDpDs DuDv*Dx,Dz:D{<)d@o<$<4d$gDDD#D2D@DOD[DbDkOdnd@{d@@VVk$kd$gDDD!D(D7$;d$8hDD $d$Thdd DD DDDD+D/d@d@d@/$/e$hdd #eDDDDDDD*D1d@d@.e@d@1$19e dhlibtcpsplice.c/users/willy/download/layer7switch-0.1.1/userland/libtcpsplice/gcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);12;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);12;0;void:t(0,19)=(0,19)/usr/include/stdio.h/usr/include/features.h/usr/include/sys/cdefs.h/usr/include/gnu/stubs.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stddef.hsize_t:t(5,1)=(0,4)/usr/include/bits/types.h__u_char:t(6,1)=(0,11)__u_short:t(6,2)=(0,9)__u_int:t(6,3)=(0,4)__u_long:t(6,4)=(0,5)__u_quad_t:t(6,5)=(0,7)__quad_t:t(6,6)=(0,6)__int8_t:t(6,7)=(0,10)__uint8_t:t(6,8)=(0,11)__int16_t:t(6,9)=(0,8)__uint16_t:t(6,10)=(0,9)__int32_t:t(6,11)=(0,1)__uint32_t:t(6,12)=(0,4)__int64_t:t(6,13)=(0,6)__uint64_t:t(6,14)=(0,7)__qaddr_t:t(6,15)=(6,16)=*(6,6)__dev_t:t(6,17)=(6,5)__uid_t:t(6,18)=(6,3)__gid_t:t(6,19)=(6,3)__ino_t:t(6,20)=(6,4)__mode_t:t(6,21)=(6,3)__nlink_t:t(6,22)=(6,3)__off_t:t(6,23)=(0,3)__loff_t:t(6,24)=(6,6)__pid_t:t(6,25)=(0,1)__ssize_t:t(6,26)=(0,1)__rlim_t:t(6,27)=(6,4)__rlim64_t:t(6,28)=(6,5)__id_t:t(6,29)=(6,3)__fsid_t:t(6,30)=(6,31)=s8__val:(6,32)=ar(0,1);0;1;(0,1),0,64;;__daddr_t:t(6,33)=(0,1)__caddr_t:t(6,34)=(6,35)=*(0,2)__time_t:t(6,36)=(0,3)__useconds_t:t(6,37)=(0,4)__suseconds_t:t(6,38)=(0,3)__swblk_t:t(6,39)=(0,3)__clock_t:t(6,40)=(0,3)__clockid_t:t(6,41)=(0,1)__timer_t:t(6,42)=(0,1)__key_t:t(6,43)=(0,1)__ipc_pid_t:t(6,44)=(0,9)__blksize_t:t(6,45)=(0,3)__blkcnt_t:t(6,46)=(0,3)__blkcnt64_t:t(6,47)=(6,6)__fsblkcnt_t:t(6,48)=(6,4)__fsblkcnt64_t:t(6,49)=(6,5)__fsfilcnt_t:t(6,50)=(6,4)__fsfilcnt64_t:t(6,51)=(6,5)__ino64_t:t(6,52)=(6,5)__off64_t:t(6,53)=(6,24)__t_scalar_t:t(6,54)=(0,3)__t_uscalar_t:t(6,55)=(0,5)__intptr_t:t(6,56)=(0,1)__socklen_t:t(6,57)=(0,4)/usr/include/bits/pthreadtypes.h/usr/include/bits/sched.h__sched_param:T(9,1)=s4__sched_priority:(0,1),0,32;;_pthread_fastlock:T(8,1)=s8__status:(0,3),0,32;__spinlock:(0,1),32,32;;_pthread_descr:t(8,2)=(8,3)=*(8,4)=xs_pthread_descr_struct:__pthread_attr_s:T(8,5)=s36__detachstate:(0,1),0,32;__schedpolicy:(0,1),32,32;__schedparam:(9,1),64,32;__inheritsched:(0,1),96,32;__scope:(0,1),128,32;__guardsize:(5,1),160,32;__stackaddr_set:(0,1),192,32;__stackaddr:(8,6)=*(0,19),224,32;__stacksize:(5,1),256,32;;pthread_attr_t:t(8,7)=(8,5)pthread_cond_t:t(8,8)=(8,9)=s12__c_lock:(8,1),0,64;__c_waiting:(8,2),64,32;;pthread_condattr_t:t(8,10)=(8,11)=s4__dummy:(0,1),0,32;;pthread_key_t:t(8,12)=(0,4)pthread_mutex_t:t(8,13)=(8,14)=s24__m_reserved:(0,1),0,32;__m_count:(0,1),32,32;__m_owner:(8,2),64,32;__m_kind:(0,1),96,32;__m_lock:(8,1),128,64;;pthread_mutexattr_t:t(8,15)=(8,16)=s4__mutexkind:(0,1),0,32;;pthread_once_t:t(8,17)=(0,1)pthread_t:t(8,18)=(0,5)FILE:t(1,1)=(1,2)=xs_IO_FILE:__FILE:t(1,3)=(1,2)/usr/include/libio.h/usr/include/_G_config.hwchar_t:t(12,1)=(0,3)wint_t:t(12,2)=(0,4)/usr/include/wchar.h/usr/include/bits/wchar.h__mbstate_t:t(13,1)=(13,2)=s8__count:(0,1),0,32;__value:(13,3)=u4__wch:(12,2),0,32;__wchb:(13,4)=ar(0,1);0;3;(0,2),0,32;;,32,32;;_G_fpos_t:t(11,1)=(11,2)=s12__pos:(6,23),0,32;__state:(13,1),32,64;;_G_fpos64_t:t(11,3)=(11,4)=s16__pos:(6,53),0,64;__state:(13,1),64,64;;/usr/include/gconv.h :T(16,1)=e__GCONV_OK:0,__GCONV_NOCONV:1,__GCONV_NODB:2,__GCONV_NOMEM:3,__GCONV_EMPTY_INPUT:4,__GCONV_FULL_OUTPUT:5,__GCONV_ILLEGAL_INPUT:6,__GCONV_INCOMPLETE_INPUT:7,__GCONV_ILLEGAL_DESCRIPTOR:8,__GCONV_INTERNAL_ERROR:9,; :T(16,2)=e__GCONV_IS_LAST:1,__GCONV_IGNORE_ERRORS:2,;__gconv_fct:t(16,3)=(16,4)=*(16,5)=f(0,1)__gconv_init_fct:t(16,6)=(16,7)=*(16,8)=f(0,1)__gconv_end_fct:t(16,9)=(16,10)=*(16,11)=f(0,19)__gconv_trans_fct:t(16,12)=(16,13)=*(16,14)=f(0,1)__gconv_trans_context_fct:t(16,15)=(16,16)=*(16,17)=f(0,1)__gconv_trans_query_fct:t(16,18)=(16,19)=*(16,20)=f(0,1)__gconv_trans_init_fct:t(16,21)=(16,22)=*(16,23)=f(0,1)__gconv_trans_end_fct:t(16,24)=(16,25)=*(16,26)=f(0,19)__gconv_trans_data:T(16,27)=s20__trans_fct:(16,12),0,32;__trans_context_fct:(16,15),32,32;__trans_end_fct:(16,24),64,32;__data:(8,6),96,32;__next:(16,28)=*(16,27),128,32;;__gconv_step:T(16,29)=s56__shlib_handle:(16,30)=*(16,31)=xs__gconv_loaded_object:,0,32;__modname:(16,32)=*(0,2),32,32;__counter:(0,1),64,32;__from_name:(6,35),96,32;__to_name:(6,35),128,32;__fct:(16,3),160,32;__init_fct:(16,6),192,32;__end_fct:(16,9),224,32;__min_needed_from:(0,1),256,32;__max_needed_from:(0,1),288,32;__min_needed_to:(0,1),320,32;__max_needed_to:(0,1),352,32;__stateful:(0,1),384,32;__data:(8,6),416,32;;__gconv_step_data:T(16,33)=s36__outbuf:(16,34)=*(0,11),0,32;__outbufend:(16,34),32,32;__flags:(0,1),64,32;__invocation_counter:(0,1),96,32;__internal_use:(0,1),128,32;__statep:(16,35)=*(13,1),160,32;__state:(13,1),192,64;__trans:(16,28),256,32;;__gconv_info:T(16,36)=s8__nsteps:(5,1),0,32;__steps:(16,37)=*(16,29),32,32;__data:(16,38)=ar(0,1);0;-1;(16,33),64,0;;__gconv_t:t(16,39)=(16,40)=*(16,36)_G_iconv_t:t(11,5)=(11,6)=u44__cd:(16,36),0,64;__combined:(11,7)=s44__cd:(16,36),0,64;__data:(16,33),64,288;;,0,352;;_G_int16_t:t(11,8)=(0,8)_G_int32_t:t(11,9)=(0,1)_G_uint16_t:t(11,10)=(0,9)_G_uint32_t:t(11,11)=(0,4)/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/stdarg.h__gnuc_va_list:t(20,1)=(8,6)_IO_lock_t:t(10,1)=(0,19)_IO_marker:T(10,2)=s12_next:(10,3)=*(10,2),0,32;_sbuf:(10,4)=*(1,2),32,32;_pos:(0,1),64,32;;__codecvt_result:T(10,5)=e__codecvt_ok:0,__codecvt_partial:1,__codecvt_error:2,__codecvt_noconv:3,;_IO_FILE:T(1,2)=s148_flags:(0,1),0,32;_IO_read_ptr:(6,35),32,32;_IO_read_end:(6,35),64,32;_IO_read_base:(6,35),96,32;_IO_write_base:(6,35),128,32;_IO_write_ptr:(6,35),160,32;_IO_write_end:(6,35),192,32;_IO_buf_base:(6,35),224,32;_IO_buf_end:(6,35),256,32;_IO_save_base:(6,35),288,32;_IO_backup_base:(6,35),320,32;_IO_save_end:(6,35),352,32;_markers:(10,3),384,32;_chain:(10,4),416,32;_fileno:(0,1),448,32;_blksize:(0,1),480,32;_old_offset:(6,23),512,32;_cur_column:(0,9),544,16;_vtable_offset:(0,10),560,8;_shortbuf:(10,6)=ar(0,1);0;0;(0,2),568,8;_lock:(10,7)=*(10,1),576,32;_offset:(6,53),608,64;__pad1:(8,6),672,32;__pad2:(8,6),704,32;_mode:(0,1),736,32;_unused2:(10,8)=ar(0,1);0;51;(0,2),768,416;;_IO_FILE:t(10,9)=(1,2)__io_read_fn:t(10,10)=(10,11)=f(6,26)__io_write_fn:t(10,12)=(10,13)=f(6,26)__io_seek_fn:t(10,14)=(10,15)=f(0,1)__io_close_fn:t(10,16)=(10,17)=f(0,1)fpos_t:t(1,4)=(11,1)/usr/include/bits/stdio_lim.h/usr/include/bits/stdio.h/usr/include/stdlib.hdiv_t:t(23,1)=(23,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(23,3)=(23,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;/usr/include/sys/types.hu_char:t(25,1)=(6,1)u_short:t(25,2)=(6,2)u_int:t(25,3)=(6,3)u_long:t(25,4)=(6,4)quad_t:t(25,5)=(6,6)u_quad_t:t(25,6)=(6,5)fsid_t:t(25,7)=(6,30)loff_t:t(25,8)=(6,24)ino_t:t(25,9)=(6,20)dev_t:t(25,10)=(6,17)gid_t:t(25,11)=(6,19)mode_t:t(25,12)=(6,21)nlink_t:t(25,13)=(6,22)uid_t:t(25,14)=(6,18)off_t:t(25,15)=(6,23)pid_t:t(25,16)=(6,25)id_t:t(25,17)=(6,29)ssize_t:t(25,18)=(6,26)daddr_t:t(25,19)=(6,33)caddr_t:t(25,20)=(6,34)key_t:t(25,21)=(6,43)/usr/include/time.htime_t:t(26,1)=(6,36)clockid_t:t(26,2)=(6,41)timer_t:t(26,3)=(6,42)ulong:t(25,22)=(0,5)ushort:t(25,23)=(0,9)uint:t(25,24)=(0,4)int8_t:t(25,25)=(0,10)int16_t:t(25,26)=(0,8)int32_t:t(25,27)=(0,1)int64_t:t(25,28)=(0,6)u_int8_t:t(25,29)=(0,11)u_int16_t:t(25,30)=(0,9)u_int32_t:t(25,31)=(0,4)u_int64_t:t(25,32)=(0,7)register_t:t(25,33)=(0,1)/usr/include/endian.h/usr/include/bits/endian.h/usr/include/sys/select.h/usr/include/bits/select.h/usr/include/bits/sigset.h__sig_atomic_t:t(32,1)=(0,1)__sigset_t:t(32,2)=(32,3)=s128__val:(32,4)=ar(0,1);0;31;(0,5),0,1024;;sigset_t:t(30,1)=(32,2)timespec:T(33,1)=s8tv_sec:(6,36),0,32;tv_nsec:(0,3),32,32;;/usr/include/bits/time.htimeval:T(34,1)=s8tv_sec:(6,36),0,32;tv_usec:(6,38),32,32;;suseconds_t:t(30,2)=(6,38)__fd_mask:t(30,3)=(0,3)fd_set:t(30,4)=(30,5)=s128__fds_bits:(30,6)=ar(0,1);0;31;(30,3),0,1024;;fd_mask:t(30,7)=(30,3)/usr/include/sys/sysmacros.hblkcnt_t:t(25,34)=(6,46)fsblkcnt_t:t(25,35)=(6,48)fsfilcnt_t:t(25,36)=(6,50)random_data:T(23,5)=s28fptr:(23,6)=*(25,27),0,32;rptr:(23,6),32,32;state:(23,6),64,32;rand_type:(0,1),96,32;rand_deg:(0,1),128,32;rand_sep:(0,1),160,32;end_ptr:(23,6),192,32;;drand48_data:T(23,7)=s24__x:(23,8)=ar(0,1);0;2;(0,9),0,48;__old_x:(23,8),48,48;__c:(0,9),96,16;__init:(0,9),112,16;__a:(0,7),128,64;;/usr/include/alloca.h__compar_fn_t:t(23,9)=(23,10)=*(23,11)=f(0,1)/usr/include/unistd.h/usr/include/bits/posix_opt.hintptr_t:t(38,1)=(6,56)socklen_t:t(38,2)=(6,57)/usr/include/bits/confname.h :T(41,1)=e_PC_LINK_MAX:0,_PC_MAX_CANON:1,_PC_MAX_INPUT:2,_PC_NAME_MAX:3,_PC_PATH_MAX:4,_PC_PIPE_BUF:5,_PC_CHOWN_RESTRICTED:6,_PC_NO_TRUNC:7,_PC_VDISABLE:8,_PC_SYNC_IO:9,_PC_ASYNC_IO:10,_PC_PRIO_IO:11,_PC_SOCK_MAXBUF:12,_PC_FILESIZEBITS:13,_PC_REC_INCR_XFER_SIZE:14,_PC_REC_MAX_XFER_SIZE:15,_PC_REC_MIN_XFER_SIZE:16,_PC_REC_XFER_ALIGN:17,_PC_ALLOC_SIZE_MIN:18,_PC_SYMLINK_MAX:19,; :T(41,2)=e_SC_ARG_MAX:0,_SC_CHILD_MAX:1,_SC_CLK_TCK:2,_SC_NGROUPS_MAX:3,_SC_OPEN_MAX:4,_SC_STREAM_MAX:5,_SC_TZNAME_MAX:6,_SC_JOB_CONTROL:7,_SC_SAVED_IDS:8,_SC_REALTIME_SIGNALS:9,_SC_PRIORITY_SCHEDULING:10,_SC_TIMERS:11,_SC_ASYNCHRONOUS_IO:12,_SC_PRIORITIZED_IO:13,_SC_SYNCHRONIZED_IO:14,_SC_FSYNC:15,_SC_MAPPED_FILES:16,_SC_MEMLOCK:17,_SC_MEMLOCK_RANGE:18,_SC_MEMORY_PROTECTION:19,_SC_MESSAGE_PASSING:20,_SC_SEMAPHORES:21,_SC_SHARED_MEMORY_OBJECTS:22,_SC_AIO_LISTIO_MAX:23,_SC_AIO_MAX:24,_SC_AIO_PRIO_DELTA_MAX:25,_SC_DELAYTIMER_MAX:26,_SC_MQ_OPEN_MAX:27,_SC_MQ_PRIO_MAX:28,_SC_VERSION:29,_SC_PAGESIZE:30,_SC_RTSIG_MAX:31,_SC_SEM_NSEMS_MAX:32,_SC_SEM_VALUE_MAX:33,_SC_SIGQUEUE_MAX:34,_SC_TIMER_MAX:35,_SC_BC_BASE_MAX:36,_SC_BC_DIM_MAX:37,_SC_BC_SCALE_MAX:38,_SC_BC_STRING_MAX:39,_SC_COLL_WEIGHTS_MAX:40,_SC_EQUIV_CLASS_MAX:41,_SC_EXPR_NEST_MAX:42,_SC_LINE_MAX:43,_SC_RE_DUP_MAX:44,_SC_CHARCLASS_NAME_MAX:45,_SC_2_VERSION:46,_SC_2_C_BIND:47,_SC_2_C_DEV:48,_SC_2_FORT_DEV:49,_SC_2_FORT_RUN:50,_SC_2_SW_DEV:51,_SC_2_LOCALEDEF:52,_SC_PII:53,_SC_PII_XTI:54,_SC_PII_SOCKET:55,_SC_PII_INTERNET:56,_SC_PII_OSI:57,_SC_POLL:58,_SC_SELECT:59,_SC_UIO_MAXIOV:60,_SC_IOV_MAX:60,_SC_PII_INTERNET_STREAM:61,_SC_PII_INTERNET_DGRAM:62,_SC_PII_OSI_COTS:63,_SC_PII_OSI_CLTS:64,_SC_PII_OSI_M:65,_SC_T_IOV_MAX:66,_SC_THREADS:67,_SC_THREAD_SAFE_FUNCTIONS:68,_SC_GETGR_R_SIZE_MAX:69,_SC_GETPW_R_SIZE_MAX:70,_SC_LOGIN_NAME_MAX:71,_SC_TTY_NAME_MAX:72,_SC_THREAD_DESTRUCTOR_ITERATIONS:73,_SC_THREAD_KEYS_MAX:74,_SC_THREAD_STACK_MIN:75,_SC_THREAD_THREADS_MAX:76,_SC_THREAD_ATTR_STACKADDR:77,_SC_THREAD_ATTR_STACKSIZE:78,_SC_THREAD_PRIORITY_SCHEDULING:79,_SC_THREAD_PRIO_INHERIT:80,_SC_THREAD_PRIO_PROTECT:81,_SC_THREAD_PROCESS_SHARED:82,_SC_NPROCESSORS_CONF:83,_SC_NPROCESSORS_ONLN:84,_SC_PHYS_PAGES:85,_SC_AVPHYS_PAGES:86,_SC_ATEXIT_MAX:87,_SC_PASS_MAX:88,_SC_XOPEN_VERSION:89,_SC_XOPEN_XCU_VERSION:90,_SC_XOPEN_UNIX:91,_SC_XOPEN_CRYPT:92,_SC_XOPEN_ENH_I18N:93,_SC_XOPEN_SHM:94,_SC_2_CHAR_TERM:95,_SC_2_C_VERSION:96,_SC_2_UPE:97,_SC_XOPEN_XPG2:98,_SC_XOPEN_XPG3:99,_SC_XOPEN_XPG4:100,_SC_CHAR_BIT:101,_SC_CHAR_MAX:102,_SC_CHAR_MIN:103,_SC_INT_MAX:104,_SC_INT_MIN:105,_SC_LONG_BIT:106,_SC_WORD_BIT:107,_SC_MB_LEN_MAX:108,_SC_NZERO:109,_SC_SSIZE_MAX:110,_SC_SCHAR_MAX:111,_SC_SCHAR_MIN:112,_SC_SHRT_MAX:113,_SC_SHRT_MIN:114,_SC_UCHAR_MAX:115,_SC_UINT_MAX:116,_SC_ULONG_MAX:117,_SC_USHRT_MAX:118,_SC_NL_ARGMAX:119,_SC_NL_LANGMAX:120,_SC_NL_MSGMAX:121,_SC_NL_NMAX:122,_SC_NL_SETMAX:123,_SC_NL_TEXTMAX:124,_SC_XBS5_ILP32_OFF32:125,_SC_XBS5_ILP32_OFFBIG:126,_SC_XBS5_LP64_OFF64:127,_SC_XBS5_LPBIG_OFFBIG:128,_SC_XOPEN_LEGACY:129,_SC_XOPEN_REALTIME:130,_SC_XOPEN_REALTIME_THREADS:131,_SC_ADVISORY_INFO:132,_SC_BARRIERS:133,_SC_BASE:134,_SC_C_LANG_SUPPORT:135,_SC_C_LANG_SUPPORT_R:136,_SC_CLOCK_SELECTION:137,_SC_CPUTIME:138,_SC_THREAD_CPUTIME:139,_SC_DEVICE_IO:140,_SC_DEVICE_SPECIFIC:141,_SC_DEVICE_SPECIFIC_R:142,_SC_FD_MGMT:143,_SC_FIFO:144,_SC_PIPE:145,_SC_FILE_ATTRIBUTES:146,_SC_FILE_LOCKING:147,_SC_FILE_SYSTEM:148,_SC_MONOTONIC_CLOCK:149,_SC_MULTI_PROCESS:150,_SC_SINGLE_PROCESS:151,_SC_NETWORKING:152,_SC_READER_WRITER_LOCKS:153,_SC_SPIN_LOCKS:154,_SC_REGEXP:155,_SC_REGEX_VERSION:156,_SC_SHELL:157,_SC_SIGNALS:158,_SC_SPAWN:159,_SC_SPORADIC_SERVER:160,_SC_THREAD_SPORADIC_SERVER:161,_SC_SYSTEM_DATABASE:162,_SC_SYSTEM_DATABASE_R:163,_SC_TIMEOUTS:164,_SC_TYPED_MEMORY_OBJECTS:165,_SC_USER_GROUPS:166,_SC_USER_GROUPS_R:167,_SC_2_PBS:168,_SC_2_PBS_ACCOUNTING:169,_SC_2_PBS_LOCATE:170,_SC_2_PBS_MESSAGE:171,_SC_2_PBS_TRACK:172,_SC_SYMLOOP_MAX:173,_SC_STREAMS:174,_SC_2_PBS_CHECKPOINT:175,_SC_V6_ILP32_OFF32:176,_SC_V6_ILP32_OFFBIG:177,_SC_V6_LP64_OFF64:178,_SC_V6_LPBIG_OFFBIG:179,_SC_HOST_NAME_MAX:180,_SC_TRACE:181,_SC_TRACE_EVENT_FILTER:182,_SC_TRACE_INHERIT:183,_SC_TRACE_LOG:184,; :T(41,3)=e_CS_PATH:0,_CS_V6_WIDTH_RESTRICTED_ENVS:1,;/usr/include/getopt.h/usr/include/string.h/usr/include/bits/string.h/usr/include/bits/string2.h/usr/include/errno.h/usr/include/bits/errno.h/usr/src/linux/include/linux/errno.h/usr/src/linux/include/asm/errno.h/usr/src/linux/include/asm-generic/errno.h/usr/src/linux/include/asm-generic/errno-base.h/usr/include/netinet/in.h/usr/include/stdint.h/usr/include/bits/wordsize.huint8_t:t(54,1)=(0,11)uint16_t:t(54,2)=(0,9)uint32_t:t(54,3)=(0,4)uint64_t:t(54,4)=(0,7)int_least8_t:t(54,5)=(0,10)int_least16_t:t(54,6)=(0,8)int_least32_t:t(54,7)=(0,1)int_least64_t:t(54,8)=(0,6)uint_least8_t:t(54,9)=(0,11)uint_least16_t:t(54,10)=(0,9)uint_least32_t:t(54,11)=(0,4)uint_least64_t:t(54,12)=(0,7)int_fast8_t:t(54,13)=(0,10)int_fast16_t:t(54,14)=(0,1)int_fast32_t:t(54,15)=(0,1)int_fast64_t:t(54,16)=(0,6)uint_fast8_t:t(54,17)=(0,11)uint_fast16_t:t(54,18)=(0,4)uint_fast32_t:t(54,19)=(0,4)uint_fast64_t:t(54,20)=(0,7)uintptr_t:t(54,21)=(0,4)intmax_t:t(54,22)=(0,6)uintmax_t:t(54,23)=(0,7) :T(53,1)=eIPPROTO_IP:0,IPPROTO_HOPOPTS:0,IPPROTO_ICMP:1,IPPROTO_IGMP:2,IPPROTO_IPIP:4,IPPROTO_TCP:6,IPPROTO_EGP:8,IPPROTO_PUP:12,IPPROTO_UDP:17,IPPROTO_IDP:22,IPPROTO_TP:29,IPPROTO_IPV6:41,IPPROTO_ROUTING:43,IPPROTO_FRAGMENT:44,IPPROTO_RSVP:46,IPPROTO_GRE:47,IPPROTO_ESP:50,IPPROTO_AH:51,IPPROTO_ICMPV6:58,IPPROTO_NONE:59,IPPROTO_DSTOPTS:60,IPPROTO_MTP:92,IPPROTO_ENCAP:98,IPPROTO_PIM:103,IPPROTO_COMP:108,IPPROTO_RAW:255,IPPROTO_MAX:256,;in_port_t:t(53,2)=(54,2) :T(53,3)=eIPPORT_ECHO:7,IPPORT_DISCARD:9,IPPORT_SYSTAT:11,IPPORT_DAYTIME:13,IPPORT_NETSTAT:15,IPPORT_FTP:21,IPPORT_TELNET:23,IPPORT_SMTP:25,IPPORT_TIMESERVER:37,IPPORT_NAMESERVER:42,IPPORT_WHOIS:43,IPPORT_MTP:57,IPPORT_TFTP:69,IPPORT_RJE:77,IPPORT_FINGER:79,IPPORT_TTYLINK:87,IPPORT_SUPDUP:95,IPPORT_EXECSERVER:512,IPPORT_LOGINSERVER:513,IPPORT_CMDSERVER:514,IPPORT_EFSSERVER:520,IPPORT_BIFFUDP:512,IPPORT_WHOSERVER:513,IPPORT_ROUTESERVER:520,IPPORT_RESERVED:1024,IPPORT_USERRESERVED:5000,;in_addr_t:t(53,4)=(54,3)in_addr:T(53,5)=s4s_addr:(53,4),0,32;;in6_addr:T(53,6)=s16in6_u:(53,7)=u16u6_addr8:(53,8)=ar(0,1);0;15;(54,1),0,128;u6_addr16:(53,9)=ar(0,1);0;7;(54,2),0,128;u6_addr32:(53,10)=ar(0,1);0;3;(54,3),0,128;;,0,128;;/usr/include/bits/socket.h/usr/include/limits.h/usr/lib/gcc-lib/i386-pc-linux-gnu/2.95.3/include/limits.h/usr/include/bits/posix1_lim.h/usr/include/bits/local_lim.h/usr/src/linux/include/linux/limits.h/usr/include/bits/posix2_lim.h__socket_type:T(56,1)=eSOCK_STREAM:1,SOCK_DGRAM:2,SOCK_RAW:3,SOCK_RDM:4,SOCK_SEQPACKET:5,SOCK_PACKET:10,;/usr/include/bits/sockaddr.hsa_family_t:t(64,1)=(0,9)sockaddr:T(56,2)=s16sa_family:(64,1),0,16;sa_data:(56,3)=ar(0,1);0;13;(0,2),16,112;;sockaddr_storage:T(56,4)=s128ss_family:(64,1),0,16;__ss_align:(6,12),32,32;__ss_padding:(56,5)=ar(0,1);0;119;(0,2),64,960;; :T(56,6)=eMSG_OOB:1,MSG_PEEK:2,MSG_DONTROUTE:4,MSG_CTRUNC:8,MSG_PROXY:16,MSG_TRUNC:32,MSG_DONTWAIT:64,MSG_EOR:128,MSG_WAITALL:256,MSG_FIN:512,MSG_SYN:1024,MSG_CONFIRM:2048,MSG_RST:4096,MSG_ERRQUEUE:8192,MSG_NOSIGNAL:16384,MSG_MORE:32768,;msghdr:T(56,7)=s28msg_name:(8,6),0,32;msg_namelen:(38,2),32,32;msg_iov:(56,8)=*(56,9)=xsiovec:,64,32;msg_iovlen:(0,1),96,32;msg_control:(8,6),128,32;msg_controllen:(38,2),160,32;msg_flags:(0,1),192,32;;cmsghdr:T(56,10)=s12cmsg_len:(5,1),0,32;cmsg_level:(0,1),32,32;cmsg_type:(0,1),64,32;__cmsg_data:(56,11)=ar(0,1);0;-1;(0,11),96,0;; :T(56,12)=eSCM_RIGHTS:1,SCM_CREDENTIALS:2,__SCM_CONNECT:3,;ucred:T(56,13)=s12pid:(25,16),0,32;uid:(25,14),32,32;gid:(25,11),64,32;;/usr/src/linux/include/asm/socket.h/usr/src/linux/include/asm/sockios.hlinger:T(56,14)=s8l_onoff:(0,1),0,32;l_linger:(0,1),32,32;;sockaddr_in:T(53,11)=s16sin_family:(64,1),0,16;sin_port:(53,2),16,16;sin_addr:(53,5),32,32;sin_zero:(53,12)=ar(0,1);0;7;(0,11),64,64;;sockaddr_in6:T(53,13)=s28sin6_family:(64,1),0,16;sin6_port:(53,2),16,16;sin6_flowinfo:(54,3),32,32;sin6_addr:(53,6),64,128;sin6_scope_id:(54,3),192,32;;ipv6_mreq:T(53,14)=s20ipv6mr_multiaddr:(53,6),0,128;ipv6mr_interface:(0,4),128,32;;/usr/include/bits/in.hip_opts:T(67,1)=s44ip_dst:(53,5),0,32;ip_opts:(67,2)=ar(0,1);0;39;(0,2),32,320;;ip_mreq:T(67,3)=s8imr_multiaddr:(53,5),0,32;imr_interface:(53,5),32,32;;ip_mreqn:T(67,4)=s12imr_multiaddr:(53,5),0,32;imr_address:(53,5),32,32;imr_ifindex:(0,1),64,32;;in_pktinfo:T(67,5)=s12ipi_ifindex:(0,1),0,32;ipi_spec_dst:(53,5),32,32;ipi_addr:(53,5),64,32;;/usr/include/bits/byteswap.hin6_pktinfo:T(53,15)=s20ipi6_addr:(53,6),0,128;ipi6_ifindex:(0,4),128,32;;/usr/include/sys/wait.h/usr/include/signal.hsig_atomic_t:t(70,1)=(32,1)/usr/include/bits/signum.h__sighandler_t:t(70,2)=(70,3)=*(70,4)=f(0,19)sig_t:t(70,5)=(70,2)/usr/include/bits/siginfo.hsigval:T(74,1)=u4sival_int:(0,1),0,32;sival_ptr:(8,6),0,32;;sigval_t:t(74,2)=(74,1)siginfo:T(74,3)=s128si_signo:(0,1),0,32;si_errno:(0,1),32,32;si_code:(0,1),64,32;_sifields:(74,4)=u116_pad:(74,5)=ar(0,1);0;28;(0,1),0,928;_kill:(74,6)=s8si_pid:(6,25),0,32;si_uid:(6,18),32,32;;,0,64;_timer:(74,7)=s8_timer1:(0,4),0,32;_timer2:(0,4),32,32;;,0,64;_rt:(74,8)=s12si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_sigval:(74,2),64,32;;,0,96;_sigchld:(74,9)=s20si_pid:(6,25),0,32;si_uid:(6,18),32,32;si_status:(0,1),64,32;si_utime:(6,40),96,32;si_stime:(6,40),128,32;;,0,160;_sigfault:(74,10)=s4si_addr:(8,6),0,32;;,0,32;_sigpoll:(74,11)=s8si_band:(0,3),0,32;si_fd:(0,1),32,32;;,0,64;;,96,928;;siginfo_t:t(74,12)=(74,3) :T(74,13)=eSI_ASYNCNL:-6,SI_SIGIO:-5,SI_ASYNCIO:-4,SI_MESGQ:-3,SI_TIMER:-2,SI_QUEUE:-1,SI_USER:0,SI_KERNEL:128,; :T(74,14)=eILL_ILLOPC:1,ILL_ILLOPN:2,ILL_ILLADR:3,ILL_ILLTRP:4,ILL_PRVOPC:5,ILL_PRVREG:6,ILL_COPROC:7,ILL_BADSTK:8,; :T(74,15)=eFPE_INTDIV:1,FPE_INTOVF:2,FPE_FLTDIV:3,FPE_FLTOVF:4,FPE_FLTUND:5,FPE_FLTRES:6,FPE_FLTINV:7,FPE_FLTSUB:8,; :T(74,16)=eSEGV_MAPERR:1,SEGV_ACCERR:2,; :T(74,17)=eBUS_ADRALN:1,BUS_ADRERR:2,BUS_OBJERR:3,; :T(74,18)=eTRAP_BRKPT:1,TRAP_TRACE:2,; :T(74,19)=eCLD_EXITED:1,CLD_KILLED:2,CLD_DUMPED:3,CLD_TRAPPED:4,CLD_STOPPED:5,CLD_CONTINUED:6,; :T(74,20)=ePOLL_IN:1,POLL_OUT:2,POLL_MSG:3,POLL_ERR:4,POLL_PRI:5,POLL_HUP:6,;sigevent:T(74,21)=s64sigev_value:(74,2),0,32;sigev_signo:(0,1),32,32;sigev_notify:(0,1),64,32;_sigev_un:(74,22)=u52_pad:(74,23)=ar(0,1);0;12;(0,1),0,416;_sigev_thread:(74,24)=s8_function:(74,25)=*(74,26)=f(0,19),0,32;_attribute:(74,27)=*(8,5),32,32;;,0,64;;,96,416;;sigevent_t:t(74,28)=(74,21) :T(74,29)=eSIGEV_SIGNAL:0,SIGEV_NONE:1,SIGEV_THREAD:2,;/usr/include/bits/sigaction.hsigaction:T(76,1)=s140__sigaction_handler:(76,2)=u4sa_handler:(70,2),0,32;sa_sigaction:(76,3)=*(76,4)=f(0,19),0,32;;,0,32;sa_mask:(32,2),32,1024;sa_flags:(0,1),1056,32;sa_restorer:(76,5)=*(76,6)=f(0,19),1088,32;;sigvec:T(70,6)=s12sv_handler:(70,2),0,32;sv_mask:(0,1),32,32;sv_flags:(0,1),64,32;;/usr/include/bits/sigcontext.h/usr/src/linux/include/asm/sigcontext.h/usr/src/linux/include/linux/compiler.h_fpreg:T(78,1)=s10significand:(78,2)=ar(0,1);0;3;(0,9),0,64;exponent:(0,9),64,16;;_fpxreg:T(78,3)=s16significand:(78,2),0,64;exponent:(0,9),64,16;padding:(23,8),80,48;;_xmmreg:T(78,4)=s16element:(78,5)=ar(0,1);0;3;(0,5),0,128;;_fpstate:T(78,6)=s624cw:(0,5),0,32;sw:(0,5),32,32;tag:(0,5),64,32;ipoff:(0,5),96,32;cssel:(0,5),128,32;dataoff:(0,5),160,32;datasel:(0,5),192,32;_st:(78,7)=ar(0,1);0;7;(78,1),224,640;status:(0,9),864,16;magic:(0,9),880,16;_fxsr_env:(78,8)=ar(0,1);0;5;(0,5),896,192;mxcsr:(0,5),1088,32;reserved:(0,5),1120,32;_fxsr_st:(78,9)=ar(0,1);0;7;(78,3),1152,1024;_xmm:(78,10)=ar(0,1);0;7;(78,4),2176,1024;padding:(78,11)=ar(0,1);0;55;(0,5),3200,1792;;sigcontext:T(78,12)=s88gs:(0,9),0,16;__gsh:(0,9),16,16;fs:(0,9),32,16;__fsh:(0,9),48,16;es:(0,9),64,16;__esh:(0,9),80,16;ds:(0,9),96,16;__dsh:(0,9),112,16;edi:(0,5),128,32;esi:(0,5),160,32;ebp:(0,5),192,32;esp:(0,5),224,32;ebx:(0,5),256,32;edx:(0,5),288,32;ecx:(0,5),320,32;eax:(0,5),352,32;trapno:(0,5),384,32;err:(0,5),416,32;eip:(0,5),448,32;cs:(0,9),480,16;__csh:(0,9),496,16;eflags:(0,5),512,32;esp_at_signal:(0,5),544,32;ss:(0,9),576,16;__ssh:(0,9),592,16;fpstate:(78,13)=*(78,6),608,32;oldmask:(0,5),640,32;cr2:(0,5),672,32;;/usr/include/bits/sigstack.hsigstack:T(80,1)=s8ss_sp:(8,6),0,32;ss_onstack:(0,1),32,32;; :T(80,2)=eSS_ONSTACK:1,SS_DISABLE:2,;sigaltstack:T(80,3)=s12ss_sp:(8,6),0,32;ss_flags:(0,1),32,32;ss_size:(5,1),64,32;;stack_t:t(80,4)=(80,3)/usr/include/bits/sigthread.h/usr/include/sys/resource.h/usr/include/bits/resource.h__rlimit_resource:T(83,1)=eRLIMIT_CPU:0,RLIMIT_FSIZE:1,RLIMIT_DATA:2,RLIMIT_STACK:3,RLIMIT_CORE:4,RLIMIT_RSS:5,RLIMIT_NOFILE:7,RLIMIT_OFILE:7,RLIMIT_AS:9,RLIMIT_NPROC:6,RLIMIT_MEMLOCK:8,RLIMIT_LOCKS:10,RLIMIT_NLIMITS:11,RLIM_NLIMITS:11,;rlim_t:t(83,2)=(6,27)rlimit:T(83,3)=s8rlim_cur:(83,2),0,32;rlim_max:(83,2),32,32;;__rusage_who:T(83,4)=eRUSAGE_SELF:0,RUSAGE_CHILDREN:-1,RUSAGE_BOTH:-2,;rusage:T(83,5)=s72ru_utime:(34,1),0,64;ru_stime:(34,1),64,64;ru_maxrss:(0,3),128,32;ru_ixrss:(0,3),160,32;ru_idrss:(0,3),192,32;ru_isrss:(0,3),224,32;ru_minflt:(0,3),256,32;ru_majflt:(0,3),288,32;ru_nswap:(0,3),320,32;ru_inblock:(0,3),352,32;ru_oublock:(0,3),384,32;ru_msgsnd:(0,3),416,32;ru_msgrcv:(0,3),448,32;ru_nsignals:(0,3),480,32;ru_nvcsw:(0,3),512,32;ru_nivcsw:(0,3),544,32;;__priority_which:T(83,6)=ePRIO_PROCESS:0,PRIO_PGRP:1,PRIO_USER:2,;__rlimit_resource_t:t(82,1)=(0,1)__rusage_who_t:t(82,2)=(0,1)__priority_which_t:t(82,3)=(0,1)/usr/include/bits/waitflags.h__WAIT_STATUS:t(69,1)=(69,2)=u4__uptr:(69,3)=*(69,4)=xuwait:,0,32;__iptr:(69,5)=*(0,1),0,32;;/usr/include/bits/waitstatus.hwait:T(69,4)=u4w_status:(0,1),0,32;__wait_terminated:(86,1)=s4__w_termsig:(0,4),0,7;__w_coredump:(0,4),7,1;__w_retcode:(0,4),8,8;:(0,4),16,16;;,0,32;__wait_stopped:(86,2)=s4__w_stopval:(0,4),0,8;__w_stopsig:(0,4),8,8;:(0,4),16,16;;,0,32;; :T(69,6)=eP_ALL:0,P_PID:1,P_PGID:2,;idtype_t:t(69,7)=(69,6)/usr/include/sys/socket.h/usr/include/sys/uio.h/usr/include/bits/uio.hiovec:T(56,9)=s8iov_base:(8,6),0,32;iov_len:(5,1),32,32;;osockaddr:T(89,1)=s16sa_family:(0,9),0,16;sa_data:(89,2)=ar(0,1);0;13;(0,11),16,112;; :T(89,3)=eSHUT_RD:0,SHUT_WR:1,SHUT_RDWR:2,;/usr/src/linux/include/linux/types.h/usr/src/linux/include/linux/posix_types.h/usr/src/linux/include/linux/stddef.h__kernel_fd_set:t(94,1)=(94,2)=s128fds_bits:(32,4),0,1024;;__kernel_sighandler_t:t(94,3)=(70,3)__kernel_key_t:t(94,4)=(0,1)__kernel_mqd_t:t(94,5)=(0,1)/usr/src/linux/include/asm/posix_types.h__kernel_ino_t:t(96,1)=(0,5)__kernel_mode_t:t(96,2)=(0,9)__kernel_nlink_t:t(96,3)=(0,9)__kernel_off_t:t(96,4)=(0,3)__kernel_pid_t:t(96,5)=(0,1)__kernel_ipc_pid_t:t(96,6)=(0,9)__kernel_uid_t:t(96,7)=(0,9)__kernel_gid_t:t(96,8)=(0,9)__kernel_size_t:t(96,9)=(0,4)__kernel_ssize_t:t(96,10)=(0,1)__kernel_ptrdiff_t:t(96,11)=(0,1)__kernel_time_t:t(96,12)=(0,3)__kernel_suseconds_t:t(96,13)=(0,3)__kernel_clock_t:t(96,14)=(0,3)__kernel_timer_t:t(96,15)=(0,1)__kernel_clockid_t:t(96,16)=(0,1)__kernel_daddr_t:t(96,17)=(0,1)__kernel_caddr_t:t(96,18)=(6,35)__kernel_uid16_t:t(96,19)=(0,9)__kernel_gid16_t:t(96,20)=(0,9)__kernel_uid32_t:t(96,21)=(0,4)__kernel_gid32_t:t(96,22)=(0,4)__kernel_old_uid_t:t(96,23)=(0,9)__kernel_old_gid_t:t(96,24)=(0,9)__kernel_old_dev_t:t(96,25)=(0,9)__kernel_loff_t:t(96,26)=(0,6)__kernel_fsid_t:t(96,27)=(96,28)=s8__val:(6,32),0,64;;/usr/src/linux/include/asm/types.humode_t:t(97,1)=(0,9)__s8:t(97,2)=(0,10)__u8:t(97,3)=(0,11)__s16:t(97,4)=(0,8)__u16:t(97,5)=(0,9)__s32:t(97,6)=(0,1)__u32:t(97,7)=(0,4)__s64:t(97,8)=(0,6)__u64:t(97,9)=(0,7)__le16:t(93,1)=(97,5)__be16:t(93,2)=(97,5)__le32:t(93,3)=(97,7)__be32:t(93,4)=(97,7)__le64:t(93,5)=(97,9)__be64:t(93,6)=(97,9)ustat:T(93,7)=s20f_tfree:(96,17),0,32;f_tinode:(96,1),32,32;f_fname:(93,8)=ar(0,1);0;5;(0,2),64,48;f_fpack:(93,8),112,48;;../../kernel/tcp_splice.h_tcp_splice_user:T(98,1)=s12s1:(0,1),0,32;s2:(0,1),32,32;n:(0,1),64,32;;tcp_splice_user_t:t(98,2)=(98,1)_tcp_splice_getinfo:T(98,3)=s8version:(0,4),0,32;size:(0,4),32,32;;tcp_splice_getinfo_t:t(98,4)=(98,3)libtcpsplice.hsockfd:S(0,1)krule:S(0,20)=*(98,2)tcp_splice_init:f(0,1)len:(38,2)tcp_splice_close:f(0,19)tcp_splice_getinfo:F(0,1)vod_version:F(0,1)tcp_splice_cmd_splice_init:f(0,1)user:p(0,20)tcp_splice_cmd_splice:f(0,1)tcp_splice_talk:f(0,19)cmd:p(0,1)cmd:r(0,1)modprobe_tcp_splice:f(0,1)argv:(0,21)=ar(0,1);0;5;(6,35)child:r(0,1)status:(0,1)tcp_splice_start:F(0,1)tcp_splice_stop:F(0,19)tcp_splice_initfd:F(0,1)sd1:p(0,1)sd2:p(0,1)sd1:r(0,1)sd2:r(0,1)__s:r(8,6)tcp_splice_splicefd:F(0,1)len:p(0,1)len:r(0,1)tcp_splice_info:G(98,4)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.3 20010315 (release)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 2.95.4 20010319 (prerelease)GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 3.4.6GCC: (GNU) 2.95.4 20010319 (prerelease)P|690:PsIйOy@;c@` v 0 j4lHp&]  {5pxe`"8 b-/@ 8w N%`&l+-_'@DNPGWPH^]Ibe`NmNS[q ' v@0|6+display_version+display_build_opts+usage ,sig_soft_stop3,sig_pauseZ,sig_listen,sig_dump_state,dump,init/deinitm2run_poll_loop2main4global4progname4pid5relative_pid#5trash55zeroG5oneY5nolingerp5stopping5hostname|6UTappsession_hash_fappsession_hash_initappsession_hash_insertappsession_hash_lookupappsession_hash_remove appsession_hash_destroy)9%a2base64base64tab8:HI enable_listenern disable_listener enable_all_listeners disable_all_listeners unbind_listener( unbind_all_listeners^ delete_listener protocol_register protocol_unregister protocol_bind_all)protocol_unbind_all_protocol_enable_allprotocol_disable_allIstats_check_init_uri_authBstats_set_uristats_set_realmstats_set_flagZstats_set_nodestats_set_desc"stats_set_refreshdstats_add_auth,stats_add_scope_O3}%ultoa_r%strlcpy2&ulltoh_r&limit_r&str2sun1'ishexX'invalid_char'invalid_domainchar'str2sa7)str2sa_range*str2net,url2ipw-str2uic-url2sa.encode_string&/str2ui/strl2ui&0strl2uic0strl2ic31strl2irc1strl2llrc1parse_time_err2my_strndup3itoa_str3hextab$ init_bufferbuffer_writeZbuffer_write_chunkbuffer_replace0 buffer_replace2 buffer_insert_line2 chunk_printfW buffer_dump pool2_buffer-L'Alert'Warning5(qfprintfz(get_log_level(get_log_facility&)send_logX+tcp_sess_log-log_facilities8-log_levelsZ-monthname|-sess_term_cond-sess_fin_statec+$__task_queueF%__task_wakeup%wake_expired_tasks'process_runnable_tasks)init_task*nb_tasks +run_queue+run_queue_cur.+nb_tasks_cur@+niced_tasksR+pool2_taskd+last_timerN _tv_ms_cmp_tv_ms_addf_tv_ms_cmp2_tv_ms_le2X_tv_ms_remain/ _tv_ms_remain2 _tv_ms_elapsed _tv_add _tv_add_ifset- _tv_remain _tv_remain2 _tv_isle _tv_isgt tv_update_datehuman_timecurr_sec_mscurr_sec_ms_scalednow_msnowdatestart_date 1fd_deletedisable_pollerinit_pollers deinit_pollersD list_pollers fork_poller cur_poller nbpollers pollers+ fdtabC maxfdU totalconng actconnro Z get_pipe kill_pipe put_pipe pool2_pipe8 pipes_liveJ pipes_used\ pipes_freeR d'$exp_replace%check_replace_string.&chain_regex&pmatchj4oU/warnifnotcap0warnif_rule_after_block`0warnif_rule_after_reqxxx0warnif_rule_after_reqadd1warnif_rule_after_redirecth1warnif_rule_after_use_backend1warnif_misplaced_block2warnif_misplaced_reqxxxl2warnif_misplaced_reqadd2cfg_parse_global:init_default_instance:cfg_parse_listenRgreadcfgfile jcheck_config_validitylcfg_register_keywordsmcfg_unregister_keywordsmcfg_maxpconnncfg_maxconnnsslv3_client_hello_pkt0p%$srv_downtime$srv_getinter/l4-process_chky2start_checksH_($srv_dynamic_maxconn %init_pendconn %pendconn_freeX%pendconn_get_next_sess&process_srv_queueU'pendconn_add(pool2_pendconn0&7+get_frt_addrS,event_accept]3g(proxy_cap_str(proxy_mode_str,findproxy_mode-findproxy.findserver.proxy_cfg_ensure_no_http4/start_proxies/soft_stop]0pause_proxy0stop_proxy0maintain_proxies*2pause_proxies]2listen_proxiesa3proxys3next_pxid3listeners8'uxst_add_listener*uxst_event_accepte-unix_sock_parse_requestA0uxst_req_analyser_statsi1uxst_process_sessionT8unix_sock_usage_msgk8unix_sock_usage yk&/init_proto_http/http_header_add_tail0http_header_add_tail20http_header_match21find_hdr_value_endU1http_find_header2h2http_find_header3error_message4perform_http_redirect5http_return_srv_error5http_sess_logB8capture_headers=9http_parse_stsline$:http_parse_reqline;http_msg_analyzer@=http_capture_bad_message=stats_check_uri_authg?http_process_tarpit@http_process_request_bodyAcheck_response_for_cacheability|Bproduce_contentBapply_filter_to_req_headers"Dapply_filter_to_req_lineEapply_filters_to_requestmEmanage_client_side_appsessionxFfind_cookie_value_endFdel_hdr_valueGmanage_client_side_cookiesIapply_filter_to_resp_headers Kapply_filter_to_sts_lineKapply_filters_to_responseYLmanage_server_side_cookieslOget_srv_from_appsessionPdebug_hdrPprocess_responseoThttp_process_requestIhpool2_capturehpool2_requrihhttp_is_ctlhhttp_is_sephhttp_is_lwshhttp_is_sphtihttp_is_crlf.ihttp_is_tokenFihttp_is_ver_tokeniHTTP_200ihttp_200_chunkiHTTP_301iHTTP_302jHTTP_303jHTTP_401_fmt6jhttp_err_codesnjhttp_err_chunksjhdr_encode_mapjurl_encode_mapjhttp_methods6ksess_cookieNksess_set_cookie50(splice)stream_sock_shutr))stream_sock_readj+stream_sock_shutw+stream_sock_write,stream_sock_data_finish-stream_sock_chk_rcv.stream_sock_chk_snde,&appsession_task_init'appsession_init@(appsession_refresh<)match_str)destroy)appsession_cleanup~+pool2_appsess+apools+have_appsessionI"P&,recalc_server_map-init_server_mapv0fwrr_init_server_groups6fwlc_init_server_tree_7get_server_ph7get_server_ph_post 9get_server_hh9assign_serverAassign_server_addressjBassign_server_and_queueBconnect_serverEsrv_redispatch_connectFbe_downtime Gbackend_parse_balancew'$stream_int_check_timeouts"%stream_int_report_errorF%stream_int_return%stream_int_retnclose 5B-print_csv_header-stats_dump_proxy.stats_dump_http/stats_dump_rawk0stats_dump_raw_to_buffer0stats_dump_sess_to_buffer1stats_dump_errors_to_buffer/@ 7,tcpv4_bind_socket).tcp_bind_listener/tcpv4_add_listenerF/tcpv6_add_listenerm/tcp_inspect_request%8w68'sess_change_serverm'session_free(init_session(session_process_counters)sess_update_st_con_tcp)sess_update_st_cer*sess_establish^+sess_update_stream_intl-sess_set_term_flags-process_sessiont4default_srv_error5pool2_session5sessionsNAhdr_idx_add&.%signal_inits%signal_handler%signal_register%__signal_process_queue&signal_queue_len&signal_state&signal_queue&blocked_sig`<9+acl_parse_nothing+acl_fetch_nothing+acl_match_nothing$,acl_match_stre,acl_match_reg,acl_match_beg -acl_match_endL-acl_match_sub.acl_match_dir.acl_match_dom.acl_match_int9/acl_match_ip/acl_parse_str/acl_parse_regc0acl_parse_intS2acl_parse_dotted_ver?4acl_parse_ip4acl_register_keywords4acl_unregister_keywords4find_acl_by_nameV5find_acl_kwW6parse_acl_expr87prune_acl7parse_acl8find_acl_default8prune_acl_condF9parse_acl_cond_:acl_exec_condo;cond_find_require<filt_cap<default_acl_listr''$create_pool-%pool_gc2%pool_refill_alloc%pool_flush2&pool_destroy2<&dump_poolsINread_freq_ctrifreq_ctr_remainnext_event_delay.Wfeb_deleteeb_insert_dupc][;eb32_inserteb32i_inserteb32_lookupeb32i_lookupeb32_lookup_ge)be'-check_cttproxy_version'OO__udivdi3v`O__umoddi3x6 P0y$ 07i  "0{ #[2-y &tk 5int 60 >Em ?ER AE3 C Di; GP7ro S UH  09 &-<5 &-@'#!' #' #b ' #  '#'#A'# '#z'# '#$'#(+ '#,M'#00'$#4.'#8X'#<'#@'">#D '#{#FH'$*#Gb'(:#H'1#L'7/#Td'8/#X':#\"'<@#` / ' ' '#  '$# B '#< :  P 3oBTGQqFz #D #E# #F# $[ >   # #  + R # J # t +# ; wgy 6 7#w 8#2>40YgG ro  b# ڰ# }# n ܓ# " # 7 =%kC%t %v# %x#hnh#ph#C"  - C#ref!h#0]4!w !x# !yC# !z0# !{0# '!|0# r!}0# B:!~0# @!0# -!0#$ u!0#( @ c bc# ss @ H#s#s# bit#u32"0* +y#key,#r H0wq1#rq2# 3#0 4#4 50#8 6#< 7/#@ 8#Dr)  D# # # [# C#: D# #*8)J )K0# * )L0# {)M/#fd)N# @)O0#exp)P0# [6)Q# 6)R# G6)S# 6)T#$ib)UJ #(ob)UJ #, x )V0#0 )W/#4J # )U @"}0#rex"~#wex"#rto"# wto"#cto"#l"0#r"#w"# lr"#$ >"0#( "0#, "0#0 "0#4 H"#8 )"A #< "7#@ "7#A "b#D <"#L "#P "M #T "S #X y 21"tstr"u#len"v#  J  A p "z *C# L*C# *# !*#fe* #be* # *# @*#$ Z *0#( D*#,req*J #0rep*J #4si*"#8 *# "%*# *#srv*V# p*V# Q *V# > *"#txn*# *# * # *"# 3*"# # *Â# *Ă# ,*ؔ"# *0#y  G d ] Tn  # ! # k auid ^f#gid _P#  `[# bux a  ! Lfd M# N# h O# -@ P# Q#  R# $ S#  T0#  U#  VC# 7* W# B X# 5' Y# ` Z/# [0#  b # * c# T Q u m#  n# S o#  p# q# r#  s#$ !6 t#( 87 u#,  v#0  w#4 { x#8 @ y#< h zC#@ e {#H  |C#L    FCfA#bBJ #.(?cbC# {D/# E7#evF7# G # H# I# J$#$ % $ J B:#get#put# u# # C<_ ``/# Aa##setb##clrc## WBd## Ae##remf5#clog5# 66hR# :ih#$ XCjz#( v%kh#, Hlh#0 um#4 n#8  5)LL*;hLXzLn a ^/# _%# k`%#ae+ ,# - # .# /#  =P h# O#II=5-8len-90#cr-:0#-;0#b -Cv-D# B:-E# -F# I*-G# 4-H# U0,    D ,,l,#m_l,#u,#u_l,# v,#v_l,#,l,#v_l,#c,#c_l,# r,#r_l,#,rq,;st,D, P ,0#col,0#sov,0#eoh,0# sol,#eol,#som,0#  ,ߔ#sl,# ,b#8cap,#@J, 4,0# b,# ,P #req,#rsp,#\uri,# ,# ,# OJ,# @,0#@G  &0# f 0# 0# g VAI JV# K# * L# M# N# O# B P# 5(R # S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< XC#@ !Y#H -@[#L p\#\ g@^#l `#| oa# b$# @dV# dV# e# o f# wg# h# i# ;i# 2$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hwV# yt# yt# jz0# {q# }t# }t# ~t# ~t# t# .J# 0# t# t# t# Qt# U# 5(tDR # # O# # h# r# # # B$#,aclC#0 C#8 C#@ C#H >C#P ?%#XsrvV#d e #h ? #l h μ%#p K# Z # Ҕ# # Ԕ# 0# ֔# gה# [# ٔ# R ڔ# # ܔ# ݔ# # G # R# 7# .'# # /# C# 5'&#id# ,# C# t# 4 # # 0# i0# 0# 0# J# 0# +J# 0# t# t# t# $0# 0# `0# # z#### #8##0#j0#  q# t# t# t# t#  t# t#) t#t#Qt##cap#p#g@##o# #m ##u ##J{#{#### # #g# #B #p !#"###Z##$7(#]%7(#&# '#O(#q)=(# )=(#*#w +#,#-M(#= .#/# 00# 10#F2x$#:2x$#H\H ; + + C# +! #srv+"V# !D* *# *|# *|# /*|# *# *#  *#$ &*[#( } *[#, *[#0 *t#4 Q*t#<!"*px*Ƕ #sv*V# *ɂ# D*ɂ# @*0# iid*˔# J*˔#sid*˔#8" * "*n#"*iid*є#px*Ҷ #buf*0#sid*0# ptr*Ք#bol*֔#"*!(*̪!!*!"!*8" "  " "" "J"]#acl$*$+C#u$,#;D$-C#  $.#$/0###aD$>$?C#g$@C#pol$A#$B0#/$C##p7!-@4un5d in6#p2u7##x$x , H#t0H#t1H# : #  # # D#$ #($ |#len0#pos0# sid0#srvV#oe #src#bufS #%be !u9%  !0# .C#l% srvl%# # #V%Xact##bck##,%actH#bckH#& # Q # # # # # 8 # V#map9%# r%#, Vȗ%# T ɷ&# 8ʷ&# e:˷&# /̷&# ͷ&#&V&6'  # 4# (:# <# A# +# \# !#'.( 7(# &)# *# +# ,+# 7,# @-# -.)# /)# 0'#$6'7(! $  7(# u # Z #len # \ !# F "#' M( ](P #(;$9 $u:(@56C#E7(#be;](# c#T)x(CDC#EE(#JF# G#%H#I#@J0#K# L#$)   )# # #T))  )# # G#)*.S C.O# .P# h.Q# .R# + .;uid.<#gid.=# .># $.?# ,.@#  .A# !.B# a.C# .D# |.E#$ .F#( <.G#, .H#0 .I#4 ,.I#8 J.J#< .J#@ .K#D .K#H .L#L  .L#P m .M##T u .M## .S)# .T # Y.U#% PnU&+{pU'+(+)+C*__cB+ ,(U,u+3, U-sig.Z, U-sig.,  )U/sig., 0RU/sig0p V10sVS.,\?`pU/sig>..:pU2V2+W0iS3p3'l4tmp3h3d5-3S6- 0__s/W5-`0ret'W5-0curV P3 WV3WS7,..cq(.'.cq(.(/(/7`..(.'.(.(/(/7../5(.'./5(.(/(/'.NT(.'.NT(.(/(/8.n9m8/ -9+9x+9,.r11U0p W0p0 P0h7(S3E7(V0sVV3cVp0lP3S3E(S3/ (V0expS3P0acl]#S3]#V3Jr1S3B r1V0rdrx1S3Cx1V0uap'V0ua'l3L")S0iS5u0:\h50:\h50:\h50:\h50:\h71~1(1'1(1'1(1'1;1P7811;;1Q'2r(2' 2}(12'1}(1((<1"*t<1*t<1*t=1]>\1=2*tǂ< 2 ~*t}<;2 v*tu?m2 իU/sigV0pS@2 ]U3tA2BsBC3s'` U22+ 0errV3}S3'h33\543 0w|`5g380px S0retP3 V53X0ret>P1x3j!P1D[&3DJ &3DL&3D(L33 D(M3D4DD  D q*D.v'4FDwD xD .\ e4E D/QT4F5(O D0;D0<D1;0Gnow1<|D1>|DZ %H s*H5nIpido HXpDh.]HS  H& tIonepHk5h ;H5  5 H5 5 D5 2#D 3$D4#Dj 5DD Q0DR0D U0D VDW1Jl J[m=( JJJnHQH '0y$ 07i 2-kint7rn#p#) D}#}#h#E# #:<P #N# H H< 0CU ptr}Q h0S 'hPU[%S&NP i(hQ 4ٳU[3Vp 3HS idx50P ~<~7U[;RD;}W idx=0P!>HS&C%C% J@U[Ipp IHW idxK0P!LHSp&R%R%\S['U[ZW i\0V!]HS\g) M00OyF0MUinQ!?VoutS/4intr @7 < D ùP0y7i "%2-y&^kint6%>:m?:RA:3CDS7rH %9 -5 -@ s#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. s#8X s#< #@ "3#D #e#FH $#Gb (#H 1#L 7#Td 8#X :s#\" <#`    #  # B s#    3-n-#p-#o BT G Q$[3  _# #   R_# Jz# t#  w    b  #  m   # # # bit s#u32"%* +##key,m# H0wq1x#rq2x# 3s#0 4s#4 5%#8 62#< 7#@ 8s#D,,,*8J K%# * L%# {M#fdNs# @O%#expP%# [6Q# 6R# G6S# 6T#$ibUg#(obUg#, x V%#0 W#48g# U @}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )#< ,#@ ,#A L#D <#L #P #T #X~~gp m  ] auid^I#gid_3# `># buxa !LfdMs# Ns# hOs# -@P# Q # Rs# $Ss# T%# U # V# 7*W # BX2# 5'Y # `Z# [%# b# *c# TQ um # ns# Sos# ps# q_# rT# ss#$ !6t #( 87u #, v/ #0 w/ #4 {x/ #8 @y/ #< hz#@ e{s#H |#L ss s  / s  V  Cf A #b Bg# .( ?cb C # { D# E,#ev F,# G #  HT#  Is# J #$ 5 j   C< _ ` `# A a #set b #clr c # WB d # A e #rem f #clo g # 66 h # : i1 #$ XC jC #( v% k1 #, H l1 #0 u m#4  ns#8 s s s      s  1 s ! C  7 n 'PU ! S /ӶU !. S >sU = P !? S \Ls ]U K P !M S( *Zs`U !Y S^ jsU i P !k S Lx=U !w Q !\|- @cU  P pU  R"v!\-) sӸU  S#errsV_s#U  S#errsVrs0sU  S#errsV7sùU  S#errsV$[ $J $ q $. vV $ ws )% $Qй0ly$ 07inti 2-k7r  #>#}# #>#G}#.('7(>#&)}#*}#+}# ,+}#7,>#@->#-.#/# 0#$< йU  <V uS 7 4O 2  '%%%}Pp '*%*}P@U  ?<uri?}S uASB}V 7C> S Q\ |U  [< [} u]S^}V ls jgZuU  < >P uɝRv<U  u<W uu}P uwSkx}V  "]@̼U  <W ,}P uS-}V  dмU  < >P uR&\U  < f} uםW}V |%> >-SB&p Qa 7U  &% %U <}VuWH }V{ S pout'%#0?&%%390y$ #07o Bi "02-y&tk2B5int60>Pm?PRAP3CDi7roS UH 02I40Y1G <xo bR#q "7 $Po BT G QqFz %D%E#%F#J 7  J G#  A J$$[I_ +#_# o R+#J#t#  w+#G#n ]#" # B d r\ s#L t # u# v#  w #6Tn  +#!#  k 9 -L5 - @# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .#8 X#< #@ "I#D #{#F H$#G b(#H 1#L 7/#T d8/#X :#\ "<#`/ # #B #Y  R  3 b#  E  # # # bit#u32"0y*+#key,E#n#p#y" - y#ref!#H H0wq1P#rq2P# 3#04#450#86^#< 7/#@8#DXXXH]4$w $xL#$yy#$z0#  ${0#'$|0#r$}0#B:$~0#@$0# -$0#$u$#(  *8J K0#* L0#{M/#fdN# @O0#expP0#[6Q#6R#G6S# 6T#$ibU< #(obU< #,x V0#0W/#4 < # U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)3 #< B#@B#Ab#D<#L #P ? #TE #Xk 21tstru#lenv#| | <  3 p zy#Ly# X# !#fe#be## @#$Z 0#(D#,req< #0rep< #4si!#8 o#"%o##srv^#p^#Q ^#> !#txn# # #!#3!## Í#č#,؜!#0#k  9 V ] auid^#gid_#`# buxaV  !LfdM# N#hO#-@Po#  Q#R#$S# T0#U#Vy#7*W#BX^#5'Y#`Z/# [0#b # *c# TQum#n#So#p# q+# r # s#$!6t#(87u#,v#0w#4{x#8@y#<hzy#@e{#H|y#L     CfA#bB< #z.(?cbCz#{D/# EB#evFB# Gd#H #I#  J#$   JB:#get#put#u# # p 7-@ 46un 5jin 6$p 2u 7#w) D###[# y#:$d  "a"^/#"_%#k"`%#"a e!+!, #!-#!.#!/#  EP #W#QQwE5(8len(90#cr(:0#(;0#b (Cv(D#B:(E#(F#I*(G#4(H# ]8'           D ' 'l'#m_l'#u'#u_l'# v'#v_l'# 'l'#v_l'#c'#c_l'# r'#r_l'#'rq'Cst'D'P '0#col'0#sov'0#eoh'0# sol'#eol'#som'0# 'ߟ#sl'#  'b#8cap' #@R'4'8#b'# 'B #req'#rsp'#\uri'# '#'#OJ'#@'0#@G &0#f 0#0# 1!^AIJ^# K#* L#M# N# O#B P#5(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<Xy#@!YX#H-@[#Lp\#\g@^#l`#|oa# b#@d^#d^#e#o f#wg#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guP# v#hw^#yt#yt#jz0# {#}t#}t#~t#~t#t#.R# 0#t# t#t#Qt#U#5(tDR # ]#O]# # h#r###B##,acly#0y#8y#@y#H>y#P?###Xsrv^#de #h? #lh ##pK#Z #ҟ##ԟ#0#֟#gן#[# ٟ#R ڟ##ܟ#ݟ##G #R#7#.K%##/#y#5'$#id#,#y#t#4 ##0#i0#0#0# R#0#+R# 0#t#t# t#$0#0#`0#]#z]# ]# ]# # # 8# # 0# j0#  #  t#  t#  t#  t#  t#  t# ) t# t# Qt# #cap# p# g@# # o# # m  # u  # J{# {# # # #  # # g#  # B # p ! # " # ## Z## $W%# ]%W%# &# '# O(# q)]%# )]%# *# w +# ,# -m%# = .# /# 00# 10# F2"# :2"#Hd ; && y#&!| #srv&"^# D ## # /###  #$&[#(} [#,[#0t#4Qt#< )!pxǾ#sv^#ɍ#Dɍ# @0# iid˟#J˟#sid˟# @! "Τ# !iidџ#pxҾ#buf0#sid0# ptr՟#bol֟#!(̲ )!@! !  !| !!| !J"x ,#t0#t1#:### D#$ #(##len0#pos0# sid0#srv^#oe#srco#bufE ###beu H# !0#.y# {# srv{## # #^ #Xact "#bck "#, #act#bck# $#Q # ## ##8 # ^#mapH## ā##,VȦ##T $#8$#e:$#/$#$#$^$ E% #4#(:#<# A#+#\#!#.E%! Q% m% }%B "%<U#n;[Q$# ; $B:;%pos=S"&, OU#dst+R#src+S$B:+Q&-V"&PPgU#nObVW$# O$B:O&m+QS& Rp"&rpU#nq[R$# q $B:q#altqP"+'|+'U#str{S%su}j`&~P'(__s/j"X'"U#sR"'x0tU$uQ"'U$uQ"((U#strS%saж%ret(W%cP&#ӟV)outs*g((__s/P(0I B(__u((__cՂ+((,=,(-(,=, ),),$).(Y_%__vIP'%he1)P&(/(n0m/1) -0+0x+ 0,"*Y(U#strW#lowP$P%sa%ret(p1cS2l2V3out(*(*4__s/5*606I6 B4__u*4__c**1sep V+s*(IX,(-(IX, ),),$)-(X\,(-(X\, ),),$).*1__v!IP'1he1)P)7,;4CU8str39-@3, 9O3,:f:d1c6V1s6W2p7S1len8[P*+04__s>/5+>6>06>I6 >B4__u>,4__c>*+,H4__s?/5,?6?06?I6 ?B4__u?,4__c?*c,`1errId-(, );)P,$).~,1heW1)P'+4__vN0]++7a-nP:U9-@mV8dstm,P2 ol2oh1choQ1tmppa-p1tppq-W1cpqd-@0?s(i0(j07./pWU8url9T 9-@(2S1cpV1retR2Q20p'@D4__vI7/V`U9m+Q9  9s8map/9zV'2R!/ 7r/E0'U8s-r/;/Q<=/R>/C0?sڣ(i07/800YU8s8lenP-/13;0S;0Q<=0R>&060?s?len(i0700`U8s8lenP-0df;0S;0Q<=0V=0R@0A00BsBlen4i04j04k0731U8sS8lenQ1iV1jR4k71+U8s*V8len*S8ret*P1i,Q1j-R71f[(U8sZ8lenZ 8retZ1P1i\tVW1j]lt72"0U9 S8ret2P9020V2~0W2x0p2*0l2.0d'p1j0R072d9U8srcW8nP1lenS1retVC1 K33 IC L 3&3 C M 3C[ E3CJ E3C.ve3Cw 3 D"x3@5  3 E3$ 3 p ~{@0y+06ri%7i 2-y&vkint3CDk76H H9 -r5 -@#! # #b  #  ##A# #z# #$#(+ #,M#00#4.#8X#<#@"V#D #}#FH$#Gb(#H1#L7#Td8#X:#\"<#`x 6   #  # B # 6  6 3n#p#]4w x}# y# zH# {H# '|H# r}H# B:~H# @H# -H#$ u#( 6  $[ V   # # 6 *8J KH# * LH# {M#fdN# @OH#expPH# [6Q# 6R# G6S# 6T#$ibUE#(obUE#, x VH#0 W#4E# U @}H#rex~#wex#rto# wto#cto#lH#r#w# lr#$ >H#( H#, H#0 H#4 H#8 )#< O#@ O#A d#D <#L #P #T #Xt21tstru#lenv#Ep t  6] Cf A#b BE#f.( ?cb Cf# { D# EO#ev FO# Gv#  H#  I# J#$ v  |@kU&pFUbuf%ESmsg%r len%Vmax'%2C2 buf EObufOU EP:UbufDES 21DVmaxFi%2pCK0 k@UbjESposj endjstrjr!lWlenm $ UbESpos endWstrrlen!p AUbEVpos strrlen!WW 4.UchkV B:Sfmtr"#=$retP% U0{Uo pbEW -Stol&[ &J  &. v & w 6' & Q & ;H(  ; -y9>0y$ 07i "02-y&ikint60>Em?ERAE3CD^~7roS UH 0oBTGQqF uz !D !E# !F#+iu9 - /5 - @~# ! #  # b  # # # A# # z# #$ #( + #, M~#0 0#4 .~#8 X~#< #@ ">#D #p#F H$#G b(#H 1#L 7#T d8#X :~#\ "<#`5   ~  ~#  # B ~#G@3Vtm,w /x~# y~# rz~# z{~# >|~# R}~# 6~~# j~# ~# #$ /#([ >    a# #  R a# J # t #w2>40YG  3o  b # x a# # n # " x#7 b#   # # # bit~#u32"0 ?* +#key, # dnd#pd#? "  - ?#ref!d#  H0wq1#rq2# 3~#0 4~#4 50#8 6$#< 7#@ 8~#D ]4w x:# y?# z0# {0# '|0# r}0# B:~0# @0# -0#$ u#( *8#J #K0# * #L0# {#M#fd#N~# @#O0#exp#P0# [6#Q# 6#R# G6#S# 6#T#$ib#U #(ob#U #, x #V0#0 #W#4 # #U @ }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H ~#8 ) #< 7#@  7#A W#D < #L #P   #T #X 1 21 tstr u#len v~#B B  H  p  z "?# L"?# "# !"#fe"!#be"!# "~# @"~#$ Z "0#( D"#,req" #0rep" #4si"##8 "# "%"# "3#srv"-# p"-# Q "-# > "##txn"# "~# "!# "## 3"## # "w# "w# ,"k## "0#1    ] E Tn  a# !E #U k auid ^6#gid _ #  `+# bux aU ! Lfd M~# N~# h O~# -@ P# Q#  R~# $ S~#  T0#  U#  V?# 7* W# B X$# 5' Y# ` Z# [0#  b # * c#  T Q u m#  n~# S o~#  p~# qa# rV#  s~#$ !6 t#( 87 u#,  v#0  w#4 { x#8 @ y#< h z?#@ e {~#H  |?#L  ~~~~CfA#bB # y.(?cbCy# {D# E7#evF7# G# HV# I~# J#$l  J B:~#get~#put~# u~# X# ~p7-@4lun5 in63 .p2u7#o'S C'O~# 'P~# h'Q~# 'R~#  ';uid'<~#gid'=~# '>~# $'?~# ,'@~#  'A~# !'B~# a'C~# 'D~# |'E~#$ 'F~#( <'G#, 'H#0 'I#4 ,'I#8 J'J~#< 'J~#@ 'K~#D 'K~#H 'L~#L  'L~#P m 'M#T u 'M# 'S.# 'T # Y'U~# @)  D# # ~# P# ?#:* a ^# _%# k`%#aQ e+ ,# -# .~# //#   P d#  #@ e5&8len&90#cr&:0#&;0# b &Cv&D# B:&Ew# &Fw# I*&Gw# 4&Hw# & %!!!! ! !!!! ! D %¼c%l%~#m_l%~#u%~#u_l%~# v%~#v_l%~#%l%~#v_l%~#c%~#c_l%~# r%~#r_l%~#%rq% st%c }D% P %0#col%0#sov%0#eoh%0# sol%#eol%#som%0#  %~#sl%# %W#8cap%}#@ !% 4%# b%e# % #req%#rsp%#\uri%# %# %# OJ%~# @%0# X@G  &0# f 0# 0#g"-A I  J-# K~# * L~#  M~#  N~# O# B P# 5( R!#  S~#  T~#$ 5 T~#( $ U0#, 6 U0#0 t V~#4 4 V~#8 ' W~#<  X?#@ ! Y#H -@ [3#L p \3#\ g@ ^3#l  `~#| o a# b# @ d-#  d-#  e# o f3# w gw#  h~#  i~# ; i~# 2$ j~# j~# R j~#  k~#  l~# F m~#id o#  p0# b p0# q0#  r0# u s0# ? t0# V t0# g u# v!# h w-#  yi# yi# j z0# {A#  }i#  }i#  ~i#  ~i#  i# . !# 0#  i# i#  i# Q i# U ~#g!5(tD R  # # O # ~# h ~# r ~#  ~#  3# B $#,acl ?#0  ?#8  ?#@  ?#H > ?#P ? $#Xsrv -#d e ~#h ? ~#l h Κ%#p K # Z #  ~#  #  ~#  0#  ~# g ~# [ # ~# R ~#  #  ~#  ~#  # G # R ~# 7 ~# . '#  # / ~#  ?# 5' &#id # , #  ?# t ~# 4 ~#  ~#  0# i 0#  0#  0# !#  0# + !# 0#  i#  i# i# $ 0#  0# ` 0#  # z #  #  #  # ~# 8 #  ~# 0# j 0# A#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p 3# g@ 3#  ~# o #  !# m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p !#  "#  #~# Z #~#  $&'# ] %&'#  &K#  'K# O (K# q ),'# ),'#  *~# w +#  ,~#  -<'# = .~#  /~#  00# 10# F 2V$# : 2V$#H3 !; $ $ ?# $!B #srv$"-# "D" "~# "L# "L# /"L# "# "#  "#$ &"P#( } "P#, "P#0 "i#4 Q"i#<""px"Ǎ!#sv"-# "w# D"w# @"0# iid"~# J"~#sid"~## " ""j#k#"iid"~#px"ҍ!#buf"0#sid"0# ptr"~#bol"~##"("́""""##!#B ##B #J V$x ,  #t0 #t1 # : !#  !#  ~# D ~#$  ~#($  L#len 0#pos 0# sid 0#srv -#oe !#src #buf #$ be !u % ! 0# . ?#J% srv J%# ~# ~#-u%X act ##bck ##,% act Ɛ#bck ǐ#&  ~# Q ~# ~#  ~#  ~#  ~# 8 ~# -#map %#  P%#, V u%# T ɕ&# 8 ʕ&# e: ˕&# / ̕&#  ͕&#&-&'  ~# 4 ~# (: ~# < ~# A ~# + ~# \ ~# ! ~#.'!  '<' L' #'>U$fmt=/%&?'tm@H(')'D)'P*'"+now!'+tm!' A#5(bSU$fmtR/%&T'tmUH('+)'D)'P#t(gU$outft(S$fmtf/ %&h,(v~U$levu/V-w~S.&&z%&z%,&)~5U$fac/V-~S.(&&%&%# +|@KU$p!V/~ /p./S%-~-~-&- +-j-~~-~P-a~-'+----~W-r~-ZS0*-0+P- ~R-S1*20+V22~P(;+m3L+.K'tm(')')'P+*+*+6+ 4X+~50+6S,E@P>U7s?B S8pnA8feB!V8beC!~9D!2E~W2E~~8errE~~2F~8tmG~:",')'~)'P1<,>I;__vj>.;__vi><[t(pid'Z~<& '_-/?"- 8-/?,(-Z-/ ?1J-|-5?6- l-?7- l-+3"@0ny$ 07i "02-y&ik27int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz "D"E#"F#    b#  p  x### bit#u32"0'*+#key,#LnL#pL#'{" - '#ref!L#]4!w !x#!y'#!z0#  !{0#'!|0#r!}0#B:!~0#@!0# -!0#$u!#( * 02>40Y5G @|o bV#$[> ##  R#J#t#  wWڇ#K#n a#" W# g7 9 -r5 -@ #! # #b #  # #A # #z #  #$ #(+ #,M C#00 I#4. #8X #< #@ ">#D #p#FH $O#Gb (_#H 1#L 7#Td 8#X :#\" <e#` C  C# I#B # r _  u 3 H0wq1#rq2# 3#04#450#86#< 7#@8#Du*8 J K0#* L0#{ M#fd N# @ O0#exp P0#[6 Q#6 R#G6 S# 6 T#$ib U; #(ob U; #,x V0#0 W#4 ; #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) 2 #< 7#@ 7#A W#D< #L #P  > #T D #Xj 21 tstr u#len v#{ { ;  2 p  z '#L '# # ! #fe #be # # @ #$Z 0#(D #,req ; #0rep ; #4si #8 #"% # #srv a#p a#Q a#> #txn # # # #3 !## Â# Ă#, ؟ # 0#j  8 U ]~ Tn  #!~ # k auid^1#gid_#`&# buxa  !LfdM# N#hO#-@P#  Q #R#$S# T0#U #V'#7*W #BX#5'Y #`Z# [0#b # *c# TQum #n#So#p# q# r|# s#$!6t #(87u #,v#0w#4{x#8@y#<hz'#@e{#H|'#L       7 Cf A #b B; #.( ?cb C#{ D# E7#ev F7# G# H|# I#  J#$    JB:#get#put#u# #t) D###P# '#:!{ a^#_%#k`%#ae+,#-#.#/*# BP L#T#NNtB5%8len%90#cr%:0#%;0#b %Cv%D#B:%E#%F#I*%G#4%H# Z5$    D $$l$#m_l$#u$#u_l$# v$#v_l$#$l$#v_l$#c$#c_l$# r$#r_l$# $rq$@st$D$P $0#col$0#sov$0#eoh$0# sol$#eol$#som$0# $߉#sl$#  $W#8cap$#@U$4$5#b$# $A #req$ #rsp$ #\uri$# $#$#OJ$#@$0#@G &0#f 0#0# 5 aAIJa# K#* L#M# N# O#B P#5(R#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X'#@!Y#H-@[#Lp\#\g@^#l`#|oa# b#@da#da#e#o f#wg#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v#hwa#yi#yi#jz0# {<#}i#}i#~i#~i#i#.U# 0#i# i#i#Qi#U#5(tDR  # a#Oa# # h#r###BI"#,acl'#0'#8'#@'#H>'#P?g"#Xsrva#de #h? #lh ##pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉##G #R#7#.$##/#'#5'$#id#,#'#t#4 ##0#i0#0#0# U#0#+U# 0#i#i# i#$0#0#`0#a#za#a#a## #8##0#j0#  <# i# i# i# i#  i# i#) i#i#Qi## cap#p#g@##o##m 7!#u 7!#Jp#p#### # #g# #B #p !#"###Z##$$#]%$#&# '#O(#q)$# )$#*#w +#,#-$#= .#/# 00# 10#F2!#:2!#Hgx; ## '##!{ #srv#"a# D  # G# G# / G# # #  #$& P#(} P#, P#0 i#4Q i#<,  px #sv a# ɂ#D ɂ# @ 0# iid ˉ#J ˉ#sid ˉ#C " R#  iid щ#px #buf 0#sid 0# ptr Չ#bol ։#  !( ̵! , ! C   {  !{  J7!p7!-@4un5U in6P!p2u7!#!x ,x#t0x#t1x#:### D#$ #(I"G#len0#pos0# sid0#srva#oe#src#bufD #g"be!u" !0#.'#" srv"# # #a"XactP!#bckP!#,#actx#bckx###Q # ## ##8 # a#map"# "#,V"#T  $#8 $#e: $#/ $# $# $a#$ #4#(:#<# A#+#\#!#.$! $ $ $A " %<T@U# SS$ %Sh%%$'%S\%4%&'% v'tu(@%])\@%*%0dU+t/S,-5P"&{pU#z V- |W.eb}@%S/%&%&0&P/&&% '$'%*'$='0O'P%['/t&h'%y'$'%'12'P$='0O'P%['/& %%%$'%%4%/&'%%'0'P$'b%'%'&&*_'t1^'t2^&'7@%) 637'67'4 53h'7'4m+4oG0&'C@%)B@%3'T7'4S7'5tU&'yk)j'nowj&'h'tg'fg0"F)BU# .tS.eb@%V-0W-‰p/(h':%y'$':%'1:2'P$='(70O'P%['/(F):@%W)$'%:@04%P/(a)%n)/)z)%)%)$& % '$' %*'$=' 0O'P%['&a)'t(z)>) &)'t1't26t*IPU7*Vj5__s8*909>9 75__ut*5__cw,05__s8Z*909>9 75__uz*5__cw),*:[*g:J *:. v*7: w *; :&Q*:';0#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3"*8J K%#* L%#{M# fdNh# @O%# expP%#[6Q4#6R4#G6S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U@ }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    -h;Utv1,Qtv2,Shtv1tv2`p`@Utv`S- mshQ$6hUtv15Qtv25R#htv1tv2-Ah`Utv1@Vtv2@W- ?KX*htv1)tv2)(K:`Utv1JVtv2JSl{  H!" '[:tv1Ztv2Z/ J:tv1Itv2I"retK: U:Utv1TWtv2TS   #!"  a: ZUtv1`Stv2`R+G  h$" Pb i``Utvh`V-hRinchPb nt    w`tvv`%-vincv YrhUtvq`S-qVincqQ    - Xhtv`%-inc {`TUtv1zRtv2zPtvz`V     `tv1tv2tv`U L``Utv1Stv2Rtv`QA U mg s   u      K`tv1tv2tv` {o`tvn` hUtv1Qtv2R    htv1tv2k h@Utv1Qtv2Rk '|   htv1tv2&u@UghSh 'A0'p'h(()b bt   Euauhtv1tv2x`tvx`6UthSaQ)rv8)p͓p)cnthl ' *[4F*J 4*.vT*wh x+ * Qg,%< ,%< ,% < -now; ,< ,<   -! 0y$ 07i 2-y &^kint3 C DS7rH  09 -a5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Xs#<z#@">#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`g   #  # B s#s  l  3[ >   # # + 2>*8 J K0# * L0# { M#fd Ns# @ O0#exp P0# [6 Q# 6 R# G6 S# 6 T#$ib Ue#(ob Ue#, x V0#0  W#46e#  U @ }0#rex ~s#wex s#rto s# wto s#cto s#l 0#r #w # lr #$ > 0#(  0#,  0#0 0#4 H s#8 ) #< 7#@  7#A L#D < #L #P  #T #X||ep k  ]ssCfA#bBe#].(?cbC]# {D# E7#evF7# Gm# H# Is# J#$ m  J B:s#gets#puts# us# "#sC<_ ``# Aa#setb#clrc# WBd# Ae#remf#clog# 66h# :i #$ XCj#( v%k #, Hl #0 uma#4 ns#8ss ss s 1+ql& Ufd%sWq3?~QSJ/`.#.s;4:U3ap5sV &8% 8%! xAs@UpBsQbpCV"D vZU#bp\p]sV$ lsUoutk pmsS%I*nsh%nsW%$ospbppl&s!U'[ 'J  ( > (bsD   (} @< (.= H(s> ( s$< ( s <  ) 'Qy k -6000y7i  "%2-kint 6% >:m ?:R A:h7r % oBTGQz $  n $# p $# ]4w x# y# z%# {%# '|%# r}%# B:~%# @%# -%#$ u#(  23 4%YG  o  b#[3 T   # T#d  R # Jo# t#w   # # n # " #, )Tn  # !)#9k ap7 -@4+un5in6 zp2 u79# b#z ### bith#u32"% 1* +# key,#  H0 wq1# rq2# 3h#0 4h#4 5%#8 6#< 7#@ 8h#D1 a uid ^# gid _#  `#  bux a  ! L fd Mh# Nh# h Oh# -@ Pd# Q#  Rh# $ Sh#  T%#  U#  V# 7* W# B X# 5' Y$# ` Z# [%#  b# * c#  T Q u m*#  nh# S oh#  ph# q # r#  sh#$ !6 t#( 87 u#,  vJ#0  wJ#4 { xJ#8 @ yJ#< h z#@ e {h#H  |#Lhhh:Jh:S COh# Ph# hQh# Rh#  ; uidh# $?h# ,@h#  Ah# !Bh# aCh# Dh# |Eh#$ Fh#( <G#, H#0 I#4 ,I#8 JJh#< Jh#@ Kh#D Kh#H Lh#L  Lh#P m Ma#T u Ma# SP# T# YUh# T   h# <!h# "h# #T #   &T 0Uret'T (p__p5S IFUpHT S VPUpUT R dU !" X#2 X*#T T#hP#hL`' 30Ly$ 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz !D!E#!F#|  a^#_%#k`%#ae jh#fi#Aj?e+,?#-E#.#/v# K 2>40YPG [o bq#$[> ##  R#J#t# - wrڢ#f#n |#" r# 7 9 - 5 - @# ! #  # b  # # # A# # z# #$ #( + #, Md#0 0j#4 .#8 X#< #@ ">#D #p#F H$p#G b(#H 1#L 7#T d8#X :#\ "<#`d d# j#B #-  &  3 b#    # # # bit#u32"0M*+#key,#r n r#p r#M" - M#ref !r# H0wq1$#rq2$# 3#04#450#862#< 7#@8#D,,,]4 w x # yM# z0#  {0#' |0#r }0#B: ~0#@ 0# - 0#$u #(  *8 J K0#* L0#{ M#fd N# @ O0#exp P0#[6 Q#6 R#G6 S# 6 T#$ib U #(ob U #,x V0#0 W#4 #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8)  #< 7#@ 7#A W#D< #L #P   #T  #X? 21 tstr u#len v#P P  V  p  z M#L M# ,# ! #fe =#be =# # @ #$Z 0#(D #,req  #0rep  #4si E!#8 #"% # -#srv #p #Q #> U!#txn 3# # # g!#3 ~!## w# w#, !# 0#?   * ]S Tn  #!S # c k auid^1#gid_#`&# buxac  !LfdM# N#hO#-@P#  Q#R#$S# T0#U#VM#7*W#BX2#5'Yp#`Z# [0#b # *c# TQum#n#So#p# q# r# s#$!6t#(87u#,v#0w#4{x#8@y#<hzM#@e{#H|M#L      Cf A#b B #.( ?cb C#{ D# E7#ev F7# G# H# I#  J#$    JB:#get#put#u# #p7-@4un5* in6-1p2u7#) D###P# M#:18P r##5$8len$90#cr$:0#$;0#fb $Cv$Df#B:$Ew#$Fw#I*$Gw#4$Hw# #           D #l #l##m_l##u##u_l## v##v_l## j#l##v_l##c##c_l## r##r_l###rq#st#-D#P #0#col#0#sov#0#eoh#0# sol##eol##som#0# #߉#sl#j#  #W#8cap#-#@#4##b## # #req##rsp##\uri## ####OJ##@#0#@G &0#f 0#0# P!AIJ# K#* L#M# N# O#B P#5(R=#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<XM#@!Y,#H-@[-#Lp\-#\g@^-#l`#|oa# b#@d#d#e#o f-#wgw#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu$# vC#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#=5(tDR # |#O|# # h#r##-#B"#,aclM#0M#8M#@M#H>M#P?"#Xsrv#de #h? #lh J##pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉#ޕ#G #R#7#.$##/#M#5'K$#id#,#M#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#|#z|# |# |# # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p-# g@-# # o# =# m # u # Jp# p# # # #  # # g#  # B # p !?# "?# ## Z## $$# ]%$# &# '# O(# q)$# )$# *# w +# ,# -$# = .# /# 00# 10# F2"# :2"#H; "" M#"!P #srv""# 1 D  # G# G# / G# # #  #$& P#(} P#, P#0 i#4Q i#<  px =#sv # w#D w# @ 0# iid ˉ#J ˉ#sid ˉ# " x# ! iid щ#px =#buf 0#sid 0# ptr Չ#bol ։#E! ( 1  Ϩ  ׿ U! Ig!P [!~!P m!J"x ,#t0#t1#:C#C## D#$ #("G#len0#pos0# sid0#srv#oe=#src#buf #"be=u " !0#.M# " srv"# # # %#Xact‹!#bckË!#, J#actƞ#bckǞ# 9$#Q # ## ##8 # #map"# ##,V%##T E$#8E$#e:E$#/E$#E$#E$9$ $ #4#(:#<# A#+#\#!#.$! $ $ $ "%U#dstQ$X0 #src#strvS$%%p%W&%B'len&R'num&P(%a67R%<67P&%)*<*)*A% ".&l`v}U#str_vS'erravV"&0vU$b&S$ER$R$vV+exp?*'errvP?,1K&& >,L&& ~,M& & -&> ,[',J ',. v2', w V'. ,%QE'oP80y$ 07i  "0{ #[2! %m-y &k 5int 60 =b >Em ?E! @PR AE BE3 C Dt7ro S U l> qH  09 *-s5 *-@+#!+ #+ #b + #  +#+#A+# +#z+# +#$+#(+ +#,M+`#00+f#4.+#8X+#<+#@+">#D +##FH+$l#Gb+(|#H+1P#L+7f#Td+8f#X+:#\"+<#`  7 f +` + +`#  +f# B +#)s | "  3oBTGQqF$z $D $E$# $F/#2>40YG .o  b#$[[ >m  9# m# }   R9# J# t#  w  9# # n # "  # 7 rr \s# Lt# u# v# w#D. %3 %4# a%5# %6# %7# X %8# %9# !%:#,', !'-# + '.# !'/# '0# QC!X)% *!)&# )'># !))# )-# P).# )/# })0# "!)1# d)2>#( Y)4#, V)8:#0 Q!);E#4 !)?$#8 ")@[#< )A$#@ ")B[#D  )C$#H Y)D[#L ")F[#P c)G[#Tt bt#  Q Y### bit#u32 "0 *  +#key ,#- n -#p -#\"  - #ref !-# H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7f#@  8#D\ ]4"w "x# "y# "z0# "{0# '"|0# r"}0# B:"~0# @"0# -"0#$ u" #(   j *8-J -K0# * -L0# {-Mf#fd-N# @-O0#exp-P0# [6-Q| # 6-R| # G6-S| # 6-T| #$ib-U #(ob-U #, x -V0#0 -Wf#4v v  j  # -U @#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$ >#0#( #0#, #0#0 #0#4 H##8 )# #< #7#@ #7#A #m#D <#v #L #v #P # #T # #X  21#tstr#u#len#v#     p #z .# L.# .# !.^#fe.J!#be.J!# .# @.#$ Z .0#( D.#,req. #0rep. #4si.R##8 .}# "%.}# .#srv.# p.# Q .# > .b##txn.@# .# .!# .t## 3.‹## # .Í# .č# ,.(## .0#   ]Tn  9# !#  kQ auid^#gid_# `#d buxak !LfdM# N# hO# -@P}# QX# R# $S# T0# U^# V# 7*Wt# BX# 5'Yz# `Zf# [0# bQ# *c#X TQ um# n# So# p# q9# r.# s#$ !6tt#( 87ut#, v#0 w#4 {x#8 @y#< hz#@ e{#H |#Lkdtd  XCfAt#bB #B.(?cbCB# {Df# E7#evF7# Gr# H.# I# J#$ R  J B:#get#put# u# #R )  D# # # [# #:G a ^f# _%# k`%#ae+ ,# -# .# /# R GP -# #(518len190#cr1:0#1;0#yb 1Cv1Dy# B:1E# 1F# I*1G# 41H# 0    D 0&0l0#m_l0#u0#u_l0# v0#v_l0#}0l0#v_l0#c0#c_l0# r0#r_l0#0rq0st0&@D0 P 00#col00#sov00#eoh00# sol0#eol0#som00#  0ߟ#sl0}# 0m#8cap0#@0 40# b0(# 0 #req0#rsp0#\uri0# 0# 0# OJ0# @00#@G  &0# f 0# 0# $ AI J# K# * L# M# N# O# B P# 5(RJ!# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X#@ !Y#H -@[#L p\#\ g@^#l `#| oa# b# @d# d# e# o f# wg# h# i# ;i# 2$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# vP!# hw# y# y# jz0# {# }# }# ~# ~# # .# 0# # # # Q# U#$J!5(tDR ^# # O# # h# r# # # B%#,acl#0 #8 #@ #H >#P ?%#Xsrv#d e #h ? #l h V&#p K# Z # ҟ# # ԟ# 0# ֟# gן# [# ٟ# R ڟ# # ܟ# ݟ# ި# G # R# 7# .i(# # /# # 5'W'#id# ,# # t# 4 # # 0# i0# 0# 0# # 0# +# 0# # # # $0# 0# `0# # z#### #8##0#j0#  # # # # #  # #) ##Q##cap#p#g@##o#J!#m ~$#u ~$#J##### # #g# #B #p !#"###Z##$(#]%(#&# '#O(#q)(# )(#*#w +#,#-(#= .#/# 00# 10#F2%#:2%#HY!; / / # /! #srv/"# >"D. .# .# .# /.# .# .#  .#$ &.[#( } .[#, .[#0 .#4 Q.#<".px.J!#sv.# .ɍ# D.ɍ# @.0# iid.˟# J.˟#sid.˟#" . ".3#(#.iid.џ#px.J!#buf.0#sid.0# ptr.՟#bol.֟#R#.!(.>"!.ϵ"!." b# V!t# h## v z#GJ"#acl(*(+#u(,#;D(-#  (.#(/0##V$aD(>(?#g(@#pol(A#(B0#/(C#~$p7!-@4Dun5 in6$p2u7V$#%x , Y#t0Y#t1Y# :P!# P!# # D#$ #(% #len0#pos0# sid0#srv#oeJ!#src}#buf #%beJ!!u%  !0# .#& srv&# # #1&Xact—$#bck×$#,V&actY#bckY#E' # Q # # # # # 8 # #map%#  &#, V1&# T Q'# 8Q'# e:Q'# /Q'# Q'#Q'E''  # 4# (:# <# A# +# \# !#i(.( 7(# &)# *# +# ,+# 7,# @-# -.*# /*+# 0i(#$'(! $ !(# u!# Z!#len! # \!!# F!"#o( (  ( #);$9J!$u:S)@56#E7S)#be;(# #)C >?#E@S)#*x(CD#EES)#JF# G#%H#I#@J0#K# L#$P* &$ &%#kw&&# &-y*#y*J!J!P**&5 &6#kw&7*# ** *   *# # #**+  *+# # G#*q+4S C4O# 4P# h4Q# 4R# , 4;uid4<#gid4=# 4># $4?# ,4@#  4A# !4B# a4C# 4D# |4E#$ 4F#( <4G#, 4H#0 4I#4 ,4I#8 J4J#< 4J#@ 4K#D 4K#H 4L#L  4L#P m 4M~$#T u 4M~$# 4S0+# 4Td# Y4U#4-!U uV#valW0#capX0# 'Y0# %.!^U&str~'4^V(l^P(cP)~)`S).~)#S(endW*G +.(ss}~,.}-__sf.4../ /0//*//6//B/.h../ /0//*//6//B/.../ /0//*//6//B/,.(__v>P1(__v>P+.-__sf2(heO/P3/n4m3O/ -4+4x+4,5/ U65(J!V7capQ66/7arg68msg S0/@I//90/3:5(2J!5`0a  U65(J!P6 6/7arg50-U65(,J!P6, 6/,7arg,51 :GU65(9J!P69 6/97arg95h1$"GPU65(FJ!P6F 6/F7argF51TU65(SJ!P6S 6/S7argS52_KU65(^J!6^W6/^V7arg^S5l2Q"hPU65(gJ!6gW6/gV7arggS52pU65(oJ!6oW6/oV7argoS5p:  U66:! 6?7inv;~/ /0//>/*//6//B/+5(;I"p:P+6H8kwlv:S=\8rcP,M6=&%=%1=;P.6./ /0//*//6//B/+6;|:P,6=&%=%,6GT=&%=%, 77D=&%=%.?7.ds/ /0/ds/*//6//B/,e7}=&%=%.7./ /0//*//6//B/,7%=&%=%.7.AP/ /0/AP/*//6//B/,8Zg=&%%=%%.M8./ /0//*//6//B/,s8=&2%=2%,8=&?%=?%+88i@V8len@S8dAS,8=&V%=V%+98iWV8cXQ,79=&n%=n%,9=&{%={%1={;{P+9;|~$~;}S;}V;}W,9@M=&%=%.:.r/ /0/r/*//6//B/+6: 8sk:R+M:88sk:R1q=&%=%x* >:  &U+:X?__sf0:$/:@:9:5(8J!5f0U66:! 6?7inv;kJ!h;!S8errP8rc}8val 0~;!~=&n%=n%,E>=&%=%,k>=&%=%,>=&%=%1=;P+>;IJ!R0.DP/ /0/DP/*//6//B/,G?#=&%=%1#=;P,m?=J=&%=%+?08iV8lenS8dS,?=&%=%,?=&%=%,@/<=&%=%,5@y=&%=%++AH;}8set0}+t@h8uP,@ =&%=%1 =;P,A4=&%=%14=;P1<I=&%=%,uA=&%=%1=;P,A=&%=%,A=&l%=l%+B;mS. Bflo/f0/lo/*//6//B/,2Bbu=&%=%,XB=&%=%,~B 3=&%=%1Lg=&%=%,B=&%;%Q,B=& %= %,C=&%=%+C8polQ;ES)Q,C=& %= %1= ; P1=&"%="%,C=&6%=6%+D8pol7};E8S)V;J9fS;:S;J;};<};!=}; >};!?};@@0}1u=&J%=J%.D.MO/ /0/MO/*//6//B/,DN!a!=&%=%,E ""=&%=%,E!"/$8polS;ES)V=Jf,Eq""=&%=%1q""=;P,E""=&%=%2 8acl#P;uR,F/$<$=&%=%,FD$%8polQ;ES)S=Jf,F$$=&%=%1$$=;P,F$$=&%=%288acl1#P;u2R,F%%=&@%=@%,G&&=&%=%+GP=,PG7&O&=&%=%,vGp&&=&%=%,G&&=&%=%1&&=&%=%,G '3'=&%=%.H.''/ /0/''/*//6//B/,?H((=&%=%,eH((=&%=%+H?hdr(,H((=&%=%1((;R;P0.q)t)/ /0/q)t)/*//6//B/,I**=&%=%,CI*)*=&%=%+I?hdr(,IL*q*=&%=%1L*q*;R;P0.**/ /0/**/*//6//B/+J;}1,,=&%=%,7J--=&%=%,]J..=&"%="%,Ja.p.=&%%=%%,J..=&V%=V%,J"/5/=&b%=b%,Jf/s/=&%=%,K{//=&%=%,AK//=&%=%,K01=&K%=K%101=K;KP,K11=&U%=U%,K$212=&%=%,K92F2=&%=%,#L22=&%=%+L8polS;ES)Q,L22=&%=%122=;P122=&%=%,L33=&%=%,M44=&%=%,'MV4c4=&_%=_%,MMk4x4=&m%=m%,sM-5:5=&w%=w%+M8;`0~,M66=&%=%,M'646=&%=%,M<6I6=&%=%,%Nf6 78iV8cS,KNX7e7=&%=%+NP;,W2p8iS8lenV8dV,N89=&(%=(%,NU9h9=&n%=n%,O99=&+%=+%,'O9 :=&z%=z%.[O.#:;:/ /0/#:;:/*//6//B/,Oz::=&.%=.%,OT;g;=&%=%,O;<=d!N; OV,O<<=&%=%,P<<=& %= %,AP"=/==& %= %,gP7=D==& %= %,PL=Y==&$ %=$ %,Pa=n==&/ %=/ %,P??=&> %=> %,P#??@8sk? :Q,Q?@L@=&V %=V %,@QT@a@=&a %=a %+Q;b }; c P; d W;[!e };!f }8skg :V,Q1ASA=&A %=A %11ASA=A ;A P+R;B ~$~;C S,:RnA{A=&E %=E %1A D;P V;P W+vR8sku :R28skk :R,R DD=& %= %,RD,D=& %= %,R4DAD=& %= %,#SEDQD=& %= %+;S ; #S.oS.EE/ /0/EE/*//6//B/,SEE8__v >P,S{FF=& %= %1{FF= ; P+T ;I P0.FF/ /0/FF/*//6//B/,9TGG8__v >P+yT@ 8l' ^P2X ;#* P1GG?__v- >,THH?__v, >,THI=& %= %,TII=& %= %,U#I6I=& %= %.9U.TIcI/ /0/TIcI/*//6//B/,_UJ"J=& %= %,U*J=J=& %= %,UEJXJ=& %= %,U`JsJ=&+ %=+ %,U{JJ=&< %=< %,VJJ=&F %=F %,CVJJ=&J %=J %,iVKK=&N %=N %,VKK=&Z %=Z %,VLL=&^ %=^ %,VL2L=&b %=b %,W:LML=&f %=f %,'WULhL=&x %=x %.[W.LL/ /0/LL/*//6//B/+sWp 8err P+W 8sk= :R,WpMM=& %= %+W 8errh P,WMM=& %= %,XCNVN=& %= %+X ;& ~; ~8sk :R+X 8i Q0fN OA gV2 Bg,X[OnO=& %= %1OO=& %= %.X.OP/ /0/OP/*//6//B/+Y0 8err, P+-YH 8err P.aY.>Q\Q/ /0/>Q\Q/*//6//B/.Y.SS/ /0/SS/*//6//B/.Y.TT/ /0/TT/*//6//B/.Y.UU/ /0/UU/*//6//B/,GZ?V]V=&%=%1?V]V=;P,mZeVxV=&%=%,ZVV=&%=%,ZWW=& %= %,ZW)W=&+%=+%,[1W>W=&6%=6%,+[FWSW=&O%=O%,Q[[WhW=&%=%+[` ;}+[ ='%;P1WX=&%=%+\ ;P}+[ ='Y%;YP1@YOY=&_%=_%,7\Z-Z=&%=%,]\ZZ=&j%=j%,\\\='?%;?P+\ ;5  S+\ ;5 V,\^_='%;P,]`'`=&B%=B%,)]+`=`=&B%=B%+A] ;5 CV,i]``='J%;JP,]aa=&+ %=+ %+] ;, #S,]bb=&E %=E %+]8 ;F #S, ^cc=&_ %=_ %+#^X ;` #S,I^dd=&y %=y %+a^x ;z #S,^ee=& %= %+^ ; #S,^ff=& %= %+^ ; #S,_hh=& %= %+_ ; #S,A_Zigi=& %= %+Y_ ; #S,_jj=& %= %+_ ; #S,_kk=& %= %+_0 ; #S,_(m5m=&8 %=8 %+`H ;9 #S,9`lnyn=&R %=R %+Q`` ;S #S,w`oo=&l %=l %+`x ;m #S,`pq=& %= %,`)r6r=& %= %,a:rFr=& %= %+a ; #S,?ass=& %= %+Wa ; #S,}att=& %= %+a ; #S,auu=& %= %+a ; #S,aYwfw=&%=%,bnwx;#S,;bxx=&<%=<%,Wbxz;=#S,}bzz=&[%=[%,b*{7{=&r%=r%,b;{G{=&s%=s%,bK{W{=&t%=t%+sc =i"u; uV8errvS.Tc.{{/ /0/{{/*//6//B/2 =&%=%,c||=&%=%+c0 8kwlv:S=\,c}}=&%=%+dH ;i"P; S8fdV8err};C!,~.Sd g~~/3gA?gP0.0G/ /0/0G/*//6//B/.d.̂/ /0/̂/*//6//B/+d` ?wO 0.Ԃ/ /0/Ԃ/*//6//B/.0e./ /0//*//6//B/,Ve˃ރ=& %= %,|eUh=& %= %,e=& %= %+ex 8sk :R+(f ; }8sk :Q,f*=& %= %1HV=& %= %,Nf=& %= %,tf%=& %= %178sk :QCf "Ddst"fDsrc"f f 3f>i4h))Y)9 g!>En=-ret?3LgB!f4"e4?"eLg,5iL U6;H!io8f im;:! m;t m; m+Ki 8argS8invm8endW;?im;/V,hh֍=&%=%1֍=;P,h&=&%=%,h^o=&%=%,hs=&%;%S,i=&%=%,(i=&%=%1=&%=%+ei ;B 0m,it=&%=%1@;aC7Q;<C7P,i@J=*D1MQ=*E ih j @FlU;y p;kJ!l;!W;hJ//0/m//HmޞU7kwlv:PH@mmU7kwlv:P2=\-I[*iIJ *iI1,Kgmmm >I,Lmm I,MmI.vmIw mJ I2QmI  K5(OJ!KPLL`I3;0Mnow3<I 4Xq+Ih4]I4^  sn I 5n cnI55I5I 6Q0I6R0I 6U0I 6VI6Wn n ~Ly!;o n oo  ,)]3o  o Hoo ) yYo 8o)d)1!)l!*l%b!X0}"y$ 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0o BT G QqFez DE#F#k 2L40 YpG {o  b #$[L ##  =R#J#t=# M w  # ۆ#n ܜ#" # E 9 -@5 - @># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 X>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#`  # #B >#M  F  3   b #  9    #  #  # bit >#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H 0wq 1D#rq 2D# 3>#0 4>#4 50#8 6R#< 7#@ 8>#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#B:~0#@0# -0#$u#(  *8J K0#* L0#{M#fdN># @O0#expP0#[6Q#6R#G6S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U@}0#rex~>#wex>#rto># wto>#cto>#l0#r#w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P 3 #T9 #X_ 21tstru#lenv>#p p 0 v ' p z m#L m# L# ! #fe #be # ># @ >#$Z 0#(D #,req 0 #0rep 0 #4si #8 #"% # M#srv V#p V#Q V#> #txn # ># # #3 ## Å# ą#, ؔ # 0#_  - J ]s Tn  #!s # k auid^&#gid_#`# buxa  !LfdM># N>#hO>#-@P#  Q #R>#$S># T0#U #Vm#7*W #BXR#5'Y #`Z# [0#b # *c# TQum #n>#So>#p># q# r# s>#$!6t #(87u #,v#0w#4{x#8@y#<hzm#@e{>#H|m#L   >> > >  ,CfA #bB0 #.(?cbC#{D# EE#evFE# G#H#I>#  J#$    JB:>#get>#put>#u># #i) D##>#^# m#:X a^#_%#k`%#aze+,#-#.>#/e#   7P #I#CCi75#8len#90#cr#:0##;0#b #Cv#D#B:#E##F#I*#G#4#H# O*"    D ""l">#m_l">#u">#u_l"># v">#v_l">#"l">#v_l">#c">#c_l"># r">#r_l">#"rq"5st"D"P "0#col"0#sov"0#eoh"0# sol"#eol"#som"0# ">#sl"#  "e#8cap"#@J"4"*#b"# "6 #req"#rsp"#\uri"# "#"#OJ">#@"0#@G &0#f 0#0# p VAIJV# K>#* L>#M># N># O#B P#5(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xm#@!YL#H-@[M#Lp\M#\g@^M#l`>#|oa# b#@dV#dV#e#o fM#wg#h>#i>#;i>#2$j># j>#Rj>#k>#l>#Fm>#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#5(tDR  # #O# ># h>#r>#>#M#B>"#,aclm#0m#8m#@m#H>m#P?\"#XsrvV#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#.$##/>#m#5'$#id#,#m#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pM# g@M# ># o# # m ,!# u ,!# J~# ~# ># ># >#  ># ># g>#  ># B ># p !# "# #># Z#># $$# ]%$# &t# 't# O(t# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H\; !! m#!!p #srv!"V# D  ># <# <# / <# 7# 7#  7#$& ^#(} ^#, ^#0 w#4Q w#<!  px Ƕ#sv V# Ʌ#D Ʌ# @ 0# iid >#J >#sid >#8 " Θ#  iid >#px Ҷ#buf 0#sid 0# ptr >#bol >#  !( ̪! ! ! 8   p   p  J,!p7!-@4un5J in6ME!p2u7!#!x ,#t0#t1#:##># D>#$ >#(>"<#len0#pos0# sid0#srvV#oe#src#buf9 #\"be!u" !0#.m#" srv"# ># >#V"XactE!#bckE!#,#actƾ#bckǾ##>#Q ># >#># >#>#8 ># V#map"# ĺ"#,V"#T ##8##e:##/#####V#~$ >#4>#(:>#<># A>#+>#\>#!>#.~$! $ $ $6 "$p">:U#sVQ"%">@U#sVR$[%$J %$.v1%,$w> U%% $$QD%&now%<<4E#]d0N$y$ "07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez %D%E#%F#9 *-p5 *- @+~# !+ # + # b + # +# +# A+# +# z+# +#$ +#( + +#, M+R#0 0+X#4 .+~#8 X+~#< +#@ +">#D +#p#F H+$^#G b+(n#H +1#L +7#T d+8#X +:~#\ "+<t#`   +R ++R# +X#B +~#p n   3[ >   # #    R #J #t #  wFy 6  7~# w 8~#2>40YFG Qo bg#ڏ#\#n r#" # 7  b#  e  # # # bit~#u32"0*+#key,e#n#p#" - #ref!#h H0wq1p#rq2p# 3~#04~#450#86~#< 7#@8~#Dxxxh]4#w #x##y##z0#  #{0#'#|0#r#}0#B:#~0#@#0# -#0#$u##( - *8'J 'K0#* 'L0#{'M#fd'N~# @'O0#exp'P0#[6'Q #6'R #G6'S # 6'T #$ib'U\ #(ob'U\ #,x 'V0#0'W#4-\ # 'U@$}0#rex$~~#wex$~#rto$~# wto$~#cto$~#l$0#r$#w$# lr$#$>$0#($0#,$0#0 $0#4H$~#8)$S #< $7#@$7#A$W#D<$#L $#P $_ #T$e #X 21$tstr$u#len$v~#  \  S p $z&#L&# &x# !& #fe&#be&#&~# @&~#$Z &0#(D&#,req&\ #0rep&\ #4si&'#8 &#"%&#&#srv&v"#p&v"#Q &v"#> &'#txn&# &~#&%#&'#3&'## &w#&w#,&؎'#&0#  Y v ] Tn  #! # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#-@ P#  Q # R~#$ S~#  T0# U # V#7* W#B X~#5' Y #` Z# [0# b # * c# T Qu m# n~#S o~# p~# q# r#  s~#$!6 t#(87 u#, v1#0 w1#4{ x1#8@ y1#<h z#@e {~#H |#L  ~~ ~ ! 1~ !XCfA#bB\ #.(?cbC#{D# E7#evF7# G#H#I~#  J<#$ 7 < JB:~#get~#put~#u~# j#!C<_``#Aa;#setb;#clrc;# WBd;#Ae;#remfM#clogM#66hj# :i#$XCj#(v%k#,Hl#0um#4n~#86~6~ ~!M6Add~BS~dpdp7-@4un5v in6p2u7#.SC.O~#.P~#h.Q~# .R~#  .;uid.<~#gid.=~#.>~#$.?~# ,.@~# .A~#!.B~#a.C~#.D~# |.E~#$ .F~#(<.G#,.H#0.I#4,.I#8J.J~#<.J~#@.K~#D.K~#H.L~#L .L~#Pm .M#Tu .M#.S# .T #Y.U~#5)8len)90#cr):0#);0#(b )Cv)D(#B:)Ew#)Fw#I*)Gw#4)Hw# s(           D (.(l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#,(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#I(rq(~st(D(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (~#sl(,#  (W#8cap(#@(4(s#b(# (b #req(I#rsp(I#\uri(# (#(#OJ(~#@(0#) D##~#P# #:* !a!^#!_%#k!`%#!aze + ,z# -# .~# /# 5 *P ##J35(tD  # r#O r# ~# h ~#r ~# ~# #B {##,acl #0 #8 #@ #H> #P? ##Xsrv v"#de ~#h? ~#lh A$#pK #Z # ~# # ~# 0# ~#g ~#[ # ~#R ~# # ~# ~# ދ#G #R ~#7 ~#. %# #/ ~# #5' B%#id #, # #t ~#4 ~# ~# 0#i 0# 0# 0# 3# 0#+ 3# 0# i# i# i#$ 0# 0#` 0# r#z r#  r#  r#  # ~# 8 #  ~# 0# j 0# 1#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  ~#cap ~# p # g@ #  ~# o #  # m # u # J p#  p#  ~#  ~#  ~#  ~# ~# g ~#  ~# B ~# p !z#  "z#  #~# Z #~#  $%# ] %%#  &#  '# O (# q )%# )%#  *~# w +#  ,~#  -%# = .~#  /~#  00# 10# F 2"# : 2"#Hj@G &0#f 0#0# yF!;  #! #srv"v"# v"A"Jv"# K~#* L~#M~# N~# O#B P#5(R#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Yx#H-@[#Lp\#\g@^#l`~#|oa# b<#@dv"#dv"#e#o f#wgw#h~#i~#;i~#2$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gup# v|"#hwv"#yi#yi#jz0# {1#}i#}i#~i#~i#i#.3# 0#i# i#i#Qi#U~#"x ,  #t0 #t1 #: |"# |"# ~# D ~#$  ~#({#  <#len 0#pos 0# sid 0#srv v"#oe #src #buf e ## be u # ! 0#. ## srv ## ~# ~#v"$X act ‚"#bck Â"#,A$ act #bck #0%  ~#Q ~# ~# ~#  ~# ~#8 ~# v"#map ##  ##,V $#T <%#8 <%#e: <%#/ <%# <%#<%v"0%%  ~#4 ~#(: ~#< ~# A ~#+ ~#\ ~#! ~#.%! % % %b &D& &~#&<# &<# /&<#&#&#  &#$&&P#(} &P#,&P#0&i#4Q&i#<'&px&#sv&v"#&w#D&w# @&0# iid&~#J&~#sid&~#2' &"&#'&iid&~#px&#buf&0#sid&0# ptr&~#bol&~#'&(&̤&&'&2' '- y' '' '"D(E#2 U#be1S$0(D(%U(&D(%U('a(/3(5(2)( $>~U#s=v"P*pc?'R+"?'V+ #?'W+j#@~p,+C S&(`c-(S%)' )hx.tgx.fg0))#[~-U#sZv"V+j#\~W,/b 0pc'$p))Ӡ-)P&(-(S%)')+#G'.pxG)) "*$v0U#suv"V*srvwv"S*msgxb h+j#y~d, +#|~`+"}~S"i*"6U#sv"V*srvv"S*msgb h+j#~W"*r#@U#sv"S*srvv"S*msgb h+j#~W1+# U2s v"S3srv"v"S3msg#b h4j#$~W5,>$~YU2fd~W6#6#6<#6"3txV3sv"S$+(%(%)7+83ret~P4w Q4~8oy9a#~8ov:__v0$6,,%,-,,`;,P;,P;,;,7e,3sa86A:__v>&-%-%-&)--:-P%E-<,"I~=sHv"># H9"#J~98$K~9?L~9"M, - ')-g$W~.nowV~(5'V~'Q-#L~.nowK~(5'K~5-#~`U2fd~6#A3len~R3txh3sv"d&(;A%(%)?1"PxU2tOx4#Q~3sRv"W3saSX3fdT~V3rvU~V6$$`.1-1P-1R$|.1)%1%1$.1l-1Q-2$.1%1-1P$.)--:-P%E-$.)-ΰ-:-S-E-P$/1%1-1P$6/)--:-P%E-$T/1-%1-1V7/9[$(~$/)--?-:-S%E-$/)-?N-:-P%E-& 2`v%2%(2@/:__v>704v$323ret~4@~8P4#~3srcH$c092%J28;U2@0!3__v>P&1E-1Q-2704v$32S3ret~P4@~&D(;M-U(P$1a2tw%n2$!1)--:-P-E-P@q1"R9[$~$X1)-"1-:-S%E-& 21G%2%(2$1D(Rd-U(P$11%1%1&)--:-P%E-'1yk~(j~.nowj~A 2J/(`.<(#.~'32V#u~.t1t~.t2t~'a2#~(`<0ret~Ay2"T.fdS~B_3#~dU3pxp3sv"S:tx4a$~l4/$~h4}$~d$+3_3̹Cp3,Cp373;z3V&3%3$K3)- -:-W-E-P&3s%3'3"x0txD0__p'37x.txA3>( xE[*3eEJ *3E qBE.v3XEw~ 4F E,Q4E-;0Gnow-<<E-=<E .XE.^e Gone.`6E.a4 H5( OE Q0ER0E U0E VEW4p[('g p0$y$ 07inti  "02-y &wk 60 >Sm ?SR AS3 C7 Dl7ro S7 U7H  0oBTGQqFez DE#F#  n # p #e" - e# ref !#R]4w xR#ye#z0#  {0#'|0#r}0#B:~0#@0# -0#$uX#( h n 2L40YsG ~o b#$[ L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 %-C5 %- @&># !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&#0 0&#4 .&>#8 X&>#< &#@ &"L#D &#~#F H&$#G b&(#H &1#L &7#T d&8#X &:>#\ "&<#`& &&# &#B &>#J  C  3 b#  6  # # # bit>#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj*8"J "K0#* "L0#{"M# fd"N># @"O0# exp"P0#[6"Q#6"R#G6"S# 6"T#$ ib"U0 #( ob"U0 #,x "V0#0"W#40 # "U@}0# rex~># wex># rto># wto># cto># l0# r# w# lr#$>0#(0#,0#0 0#4H>#8)' #< E#@E#Ae#D<#L #P 3 #T9 #X_ 21t stru# lenv>#p p 0 v ' p z!e#L!e# !# !! # fe!# be!#!># @!>#$Z !0#(D!#, req!0 #0 rep!0 #4 si! #8 ! #"%! #!P# srv!V#p!V#Q !V#> ! # txn!# !>#!#! #3! ## !Å#!ą#,!ؔ #!0#_  - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#-@P #  Q #R>#$S># T0#U #Ve#7*W #BX#5'Y #`Z# [0#b # *c# TQum #n>#So>#p># q# r# s>#$!6t #(87u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    JB:># get># put>#u># #i) D##>#^# e#: a^#_%#k`%#aze+,#-#.>#/h#   7P #I#CCi75$8len$90#cr$:0#$;0#b $C v$D#B:$E#$F#I*$G#4$H# O*#    D ## l#># m_l#># u#># u_l#># v#># v_l#>## l#># v_l#># c#># c_l#># r#># r_l#>##rq#5st#D#P #0# col#0# sov#0# eoh#0# sol## eol## som#0# #># sl##  #e#8 cap##@J#4#*#b## #6 # req## rsp##\ uri## ####OJ#>#@#0#@G &0#f 0#0# s VAIJV# K>#* L>#M># N># O#B P#5(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H-@[P#Lp\P#\g@^P#l`>#|oa# b#@dV#dV#e#o fP#wg#h>#i>#;i>#2$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hwV#yw#yw#jz0# {1#}w#}w#~w#~w#w#.J# 0#w# w#w#Qw#U>#5(tDR  # #O# ># h>#r>#>#P#B>"#, acle#0e#8e#@e#H>e#P?\"#X srvV#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>##G #R>#7>#.$##/>#e#5'$# id#,#e#t>#4 >#>#0#i0#0#0# J#0#+J# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pP# g@P# ># o# # m ,!# u ,!# J~# ~# ># ># >#  ># ># g>#  ># B ># p !# "# #># Z#># $$# ]%$# &t# 't# O(t# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H\;   e# !p # srv "V# D! !>#!<# !<# /!<#!7#!7#  !7#$&!^#(} !^#,!^#0!w#4Q!w#<! ! px!Ƕ# sv!V#!Ʌ#D!Ʌ# @!0# iid!>#J!># sid!>#8 !"!ΐ# ! iid!># px!Ҷ# buf!0# sid!0# ptr!># bol!># !!(!̪!!! !!8   p   p  J,!p7!-@4un5J in6PE!p2 u7!#!x ,# t0# t1#:##># D>#$ >#(>"<# len0# pos0# sid0# srvV# oe# src # buf9 #\"be!u" !0#.e#"  srv"# ># >#V"X actE!# bckE!#,# actƻ# bckǻ##>#Q ># >#># >#>#8 ># V# map"# ĺ"#,V"#T ##8##e:##/#####V#~$ >#4>#(:>#<># A>#+>#\>#!>#.~$! $ $ $6 "$$'0pU#s&$S$max(0V%&8$60% '$>8U(X%$@U#p Q%FS&\"'&$bp ǽU#srvaVV#pxa $psc Q)ppc *dp S*K(eVP+%'&ڼ,8&+%B&,S&+ &i&-z&S,&.&i-&p-&S/B&$= 0s=$/^&+#G 0pxG^&d& \/&$0>1 />1>8/>/&>0tv1&0tv2&& <(1' %Cн/U#sBVV$pDp*$E>W%"*Mp P.1'"-B'S,K'/U'h0tg0fg0"'$ 0 U2p S)p 3($__pQ4[%'4J %'4.v',4w> '5 4'Q'6now<<75 t0? 4 Q04R04 U04 Vt4WX(A6)~m0%y$ #07i "02-y&ikint60>Em?ERAE3CD^7roS UH 0oBTGQqFez %D%E#%F#9 +-p5 +- @,~# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,j#0 0,p#4 .,~#8 X,~#< ,#@ ,">#D ,#p#F H,$v#G b,(#H ,1#L ,7#T d,8#X ,:~#\ ",<#`    ,  ,j ,,j# ,p#B ,~#3p,3$[> ## "R#J#t"#2w^y6 7~# w8~#2>40Y^G io b#ڧ#t#n ܊#" #7 b#--}  # -# -# bit~#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D 5]4$w $x#$y#$z0#  ${0#'$|0#r$}0#B:$~0#@$0# -$0#$u$5#(E *8&J &K0#* &L0#{&M#fd&N~# @&O0#exp&P0#[6&Q%#6&R%#G6&S%# 6&T%#$ib&Ut #(ob&Ut #,x &V0#0&W#4  Et # &U@ }0#rex ~~#wex ~#rto ~# wto ~#cto ~#l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H ~#8) k #< 7#@ 7#A W#D< #L #P  w #T } #X+ 21 tstr u#len v~#  t  k p  z #L # # ! #fe P"#be P"# ~# @ ~#$Z 0#(D #,req t #0rep t #4si X$#8 #"% # #srv #p #Q #> h$#txn }# ~# "# z$#3 ‘$## w# w#, .$# 0#  q  ] Tn  # ! # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#-@P#  Q#R~#$S~# T0#U#V#7*W#BX#5'Y##`Z# [0#b # *c# TQum)#n~#So~#p~# q# r# s~#$!6t#(87u#,vI#0wI#4{xI#8@yI#<hz#@e{~#H|#L  ~ ~ ~9I~ 9pCfA#bBt #.(?cbC#{D# E7#evF7# G#H#I~#  JT#$OT JB:~#get~#put~#u~# #9C<_``#AaS#setbS#clrcS# WBdS#AeS#remfe#cloge#66h# :i#$XCj#(v%k#,Hl#0um#4n~#8N~ N ~ ~9 e NY | | ~Zk~ |  |p7-@4un5 in6p2u7#2-SC-O~#-P~#h-Q~# -R~#  -;uid-<~#gid-=~#->~#$-?~# ,-@~# -A~#!-B~#a-C~#-D~# |-E~#$ -F~#(<-G#,-H#0-I#4,-I#8J-J~#<-J~#@-K~#D-K~#H-L~#L -L~#Pm -M#Tu -M#-S# -T #Y-U~#) D##~#P# #:G "a"^#"_%#k"`%#"ae!+!,#!-#!.~#!/# R GP ##   @G &0#f 0#0#_5)8len)90#cr):0#);0#b )Cv)D#B:)Ew#)Fw#I*)Gw#4)Hw#  (           D (¶](l(~#m_l(~#u(~#u_l(~# v(~#v_l(~#(l(~#v_l(~#c(~#c_l(~# r(~#r_l(~#(rq(st(]wD(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (~#sl(#  (W#8cap(w#@(4(#b(_# (z #req(#rsp(#\uri(# (#(#OJ(~#@(0#*^!AIJ# K~#* L~#M~# N~# O#B P#5(RP"#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<X#@!Y#H-@[#Lp\#\g@^#l`~#|oa# bT#@d#d#e#o f#wgw#h~#i~#;i~#2$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vV"#hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#*P"5(tDR # #O# ~# h~#r~#~##B%#,acl#0#8#@#H>#P?%#Xsrv#de ~#h? ~#lh V&#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#ި#G #R~#7~#.'##/~##5'W'#id#,##t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# p# g@# ~# o# P"# m # u # Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !# "# #~# Z#~# $'# ]%'# &# '# O(# q)'# )'# *~# w +# ,~# -'# = .~# /~# 00# 10# F2%# :2%#H"; '' #'! #srv'"# D#D  ~# <# <# / <# # #  #$& P#(} P#, P#0 i#4Q i#<# px P"#sv # w#D w# @ 0# iid ~#J ~#sid ~## " #.$ iid ~#px P"#buf 0#sid 0# ptr ~#bol ~#X$ ( D# ϻ# #h$E\" z$ n$ $ $%x ,#t0#t1#:V"#V"#~# D~#$ ~#(%<#len0#pos0# sid0#srv#oeP"#src#buf} #%beP"u% !0#.#& srv&# ~# ~#1&Xact—$#bck×$#,V&act#bck#E'~#Q ~# ~#~# ~#~#8 ~# #map%#  &#,V1&#T Q'#8Q'#e:Q'#/Q'#Q'# Q' E'' ~#4~#(:~#<~# A~#+~#\~#!~#.'! '' (z f(&*dow*~#h1*~#m1*~#h2*~ #m2*~#(*min*i#max*i#%*~#%*~#(*-@*ϊ#O*Њ#)*i*~`*f(+%*ѭ(&*(/)*ptr*str*reg*/)G)%,**Ʊ#val*(#ptr*)#%*# len*~#$@*~#() *p*i*~ll*id*)a*)J)5*r%0*i*~#ptr*#len*~#@*~# ctx*)#*%*kw*# **# %*O+# C*j+# *0# &* ~#*~  * #5)**~ P"  ~ * I+*I+!C* *!#kw*"+#arg*%+# W&*&~# %*'#)*j+~ I+ *U++_&* *#kw*+#+5*!"+*%#str*$5*$,%0}U%s/ S&Z1p',(',P)1,);,*G,&.~+fd.~+sa.G,,{%.M,-W11*A~(U%fdA~.lB}.pCP"W/sD .txnEW1}/tF.cfdG~}&&H~}0&0[%0|&0%0&00%}0&]0&G1I/H&-@Q~&l%R}1p-p.__poV2-]1}3n143n145x1}2-1)12-1)12-1)12.1(1R)11,.6pnL2~6snL2}1s.6len^~P7$6pnn2}7>I8__vu>1.6__p{R2.2)!22.-2FM):21.06__pR2.2)!22.F2)S22/^2)o2)x2'2>)2'1AG(1S)19|/2`6pnd)~7L`8__vk>1/X6__pQ9/ 8__s1/p6__p$Q9/IY8__s'1/6__p-Q2 02(2P7329>0(6msgz }9\0.u6msgz }9w0u.maxK~P908__vW>108__vV>106pn<)~6sn<)~908__vG>48__vF>212)29,1:\2C12)2'2)2}*1"/t;/__p*17+t<1k&F+feEP"*1x1+tvx1<<1%1+ctr01+inc002-<-2%/+buf.t pxP">l4 R>l7>dir~?;D*?v%I+Q=4& ~U>px P">l4  P>l7 >dir ~?;D *?v% I+R938__v>78__v>=w4=%~\U>pxP">l4 S>l7>dir~?;D*?v%I+V=5K%,~`U>px*P">l4* S>l7*>dir*~?;D+*?v%+I+V95{8__v3>78__v1>=5&=~U>px;P">l4; P>l7;>dir;~?;D<*?v%<I+P@&SUA[+5eAJ +5A qZA.v5pAw~A x~A -\~6BA.Q6A;0Cnow<<A=<A -X2A-^} Cone-`NA-a|6 2A $Aj /A, /A Q0AR0A U0A VAW6D%Dp+37-v 0#(y$ 07i  "02-y &ikint 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFez  D E# F# [ > p##  Rp#J#t#  w 2>40YG Mo b'#p##n 2#" # 7 9 !-@5 !- @"~# !" # " # b " # "# "# A"# "# z"# "#$ "#( + "#, M"#0 0"#4 ."~#8 X"~#< "#@ "">#D "#p#F H"$#G b"(#H "1#L "7#T d"8#X ":~#\ ""<#` " ""# "#B "~#M  F  3 b#  9  # # # bit~#u32"0m*+#key,9# n #p #m" - m#ref !#< H 0wq 1D#rq 2D# 3~#0 4~#4 50#8 6R#< 7#@ 8~#DLLL<]4w x@#ym#z0#  {0#'|0#r}0#B:~0#@0# -0#$u#(  *8#J #K0#* #L0#{#M#fd#N~# @#O0#exp#P0#[6#Q#6#R#G6#S# 6#T#$ib#U0 #(ob#U0 #,x #V0#0#W#40 # #U@}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P 3 #T9 #X_ 21tstru#lenv~#p p 0 v ' p z$m#L$m# $L# !$ #fe$ #be$ #$~# @$~#$Z $0#(D$#,req$0 #0rep$0 #4si$"#8 $#"%$#$M#srv$#p$#Q $#> $$"#txn$# $~#$O #$6"#3$M"## $w#$w#,$!#$0#_  - J ]s Tn  p#!s # k auid^&#gid_#`# buxa  !LfdM~# N~#hO~#-@P#  Q #R~#$S~# T0#U #Vm#7*W #BXR#5'Y #`Z# [0#b # *c# TQum #n~#So~#p~# qp# re# s~#$!6t #(87u #,v#0w#4{x#8@y#<hzm#@e{~#H|m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#He#I~#  J#$   { JB:~#get~#put~#u~# #C<_``#Aa#setb#clrc# WBd#Ae#remf!#clog!#66h># :iT#$XCjf#(v%kT#,HlT#0um#4n~#8 ~ ~ ~! 88~'T~8Df8Z) D##~#P# m#:lX a^#_%#k`%#aSe+,S#-Y#.~#/# _ P ##5'8len'90#cr':0#';0#5b 'Cv'D5#B:'Ew#'Fw#I*'Gw#4'Hw# &    D &;&l&~#m_l&~#u&~#u_l&~# v&~#v_l&~#9&l&~#v_l&~#c&~#c_l&~# r&~#r_l&~#V&rq&st&D&P &0#col&0#sov&0#eoh&0# sol&#eol&#som&0# &~#sl&9#  &W#8cap&#@&4&#b&# &6 #req&V#rsp&V#\uri&# &#&#OJ&~#@&0#@G &0#f 0#0#  AIJ# K~#* L~#M~# N~# O#B P#5(R #S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H-@[M#Lp\M#\g@^M#l`~#|oa# b#@d#d#e#o fM#wgw#h~#i~#;i~#2$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v #hw#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~# 5(tDR  # 2#O2# ~# h~#r~#~#M#B##,aclm#0m#8m#@m#H>m#P?##Xsrv#de ~#h? ~#lh Z$#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~#d#G #R~#7~#.%##/~#m#5'[%#id#,#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#2#z2# 2# 2# # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# pM# g@M# ~# o#  # m "# u "# Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !S# "S# #~# Z#~# $%# ]%%# &# '# O(# q)%# )%# *~# w +# ,~# -%# = .~# /~# 00# 10# F2## :2##HO ; %% m#%!p #srv%"# !D$ $~#$<# $<# /$<#$#$#  $#$&$P#(} $P#,$P#0$i#4Q$i#<w!$px$ #sv$Ȭ#$w#D$w# @$0# iid$~#J$~#sid$~#! $"$Θ#!$iid$~#px$ #buf$0#sid$0# ptr$~#bol$~#"$!($!!$w!!$׎! $"  6"p *"M"p <"J"p7!-@4{un5J in6M"p2u7Z"##x ,#t0#t1#: # #~# D~#$ ~#(#<#len0#pos0# sid0#srv#oe #src#buf9 ##be !u# !0#.m# $ srv $# ~# ~#5$Xact›"#bckÛ"#,Z$actƾ#bckǾ#I%~#Q ~# ~#~# ~#~#8 ~# #map## $#,V5$#T U%#8U%#e:U%#/U%#U%#U%I%% ~#4~#(:~#<~# A~#+~#\~#!~#.%! % % &6 B& +$+%~#kw+&# +-k&#k&~~  ~B&&+5+6m#kw+7&# & & &(SC(O~#(P~#h(Q~# (R~# g( (;uid(<~#gid(=~#(>~#$(?~# ,(@~# (A~#!(B~#a(C~#(D~# |(E~#$ (F~#(<(G#,(H#0(I#4,(I#8J(J~#<(J~#@(K~#D(K~#H(L~#L (L~#Pm (M"#Tu (M"#(S&# (T #Y(U~#"(H'2 WU#cap1~R"('B`U$B~R%C+)'Y~U$?W$W~ $5(W $'X #errX$ X~&5'Z0p&[~l'cap[~W'res\P&u\S'tv] h'td^ V())&c%)c%*))&g%)g%*))&g%)g%+*C+DJ,T+*&*)&l%)l%*J*)&p%)p%*n*DQ)&t%)t%**Ua)&t%)t%**er)&y%)y%**v)&y%)y%**)&~%)~%*"+%)&%)%-)7)&%)%.`+/3/5(2 %,'~ U$?S$~ $5( $' #err$ ~&~l0cap~'resp)u'tv,W0td,'val0V(B,)&%)%*f,)&%)%+,,!,,1,P,,2C+,T+03,'3P414x142~"-' U$u$~ #cap~W&k S&I p*^-H])&%)%+u-C+,T+2C+,T+5.( TU6u7cap~V8k S8I W-19&%9%5x.'(`U7px(x.W6u( 8I(*S8I*V-9&0%90%~. 54/x'H~|U6kG S+.C+DP,T++.C+p|,T++.C+,T++ /C+,T++ /C+ ,T+2C+CI,T+5/V't~U6d's~8ku V8 !v S8'w~W:errw~~8(x~~:msgy/~+/C+,T+2C+,T+ / c;50  U:p S2501F0P1Q0P.]0#L~__v>->__v>?'U@[!2@J !2@ q@.v#3,@w~@ (\~ T3A @)QC3B5((  B)~0@*;0Cnow*<<@ (X&Bh'~4? @(b~8'q&4800*y$ 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz "D"E#"F#9 (-{5 (- @)# !) # ) # b ) # )# )# A)# )# z)# )#$ )#( + )#, M)]#0 0)c#4 .)#8 X)#< )#@ )">#D )#p#F H)$i#G b)(y#H )1#L )7#T d)8#X ):#\ ")<#`  )] ))]# )c#B )#&{ y   3 $[ >   # #   R #J #t # % wNTn  #!N# ^ k2>40Y^G io b#ښ#t#n ܊#" # 7  b# -- }  # -# -# bit#u32"0*+3#key,}# n #p #" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D5]4!w !x#!y#!z0#  !{0#'!|0#r!}0#B:!~0#@!0# -!0#$u!5#( E *8#J #K0#* #L0#{#M#fd#N# @#O0#exp#P0#[6#Q%#6#R%#G6#S%# 6#T%#$ib#Ut #(ob#Ut #,x #V0#0#W#4Et # #U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8)k #< 7#@7#AW#D<#L #P w #T} #X+ 21tstru#lenv#  t  k p z#L# # ! #fe"#be"## @#$Z 0#(D#,reqt #0rept #4si$#8 #"%##srv#p#Q #> /$#txnD# #Z"#A$#3X$## w#w#,##0#  q ] auid^1#gid_#`&# buxa  !LfdM# N#hO#-@P#  Q #R#$S# T0#U #V#7*W #BX#5'Y #`Z# [0#b # *c# TQum #n#So#p# q# r# s#$!6t #(87u #,v#0w#4{x#8@y#<hz#@e{#H|#L       7CfA #bBt #.(?cbC#{D# E7#evF7# G#H#I#  J#$   JB:#get#put#u# #C<_``#Aa#setb#clrc# WBd#Ae#remf,#clog,#66hI# :i_#$XCjq#(v%k_#,Hl_#0um#4n#8 , CC!2_COqCep7-@4un5%in6p2u7w#*SC*O#*P#h*Q# *R# w *;uid*<#gid*=#*>#$*?# ,*@# *A#!*B#a*C#*D# |*E#$ *F#(<*G#,*H#0*I#4,*I#8J*J#<*J#@*K#D*K#H*L#L *L#Pm *M#Tu *M#*S# *T #Y*U#) D###P# #:w a^#_%#k`%#a^e+,^#-d#.#/# j P ##@G &0#f 0#0#&5&8len&90#cr&:0#&;0#wb &Cv&Dw#B:&Ew#&Fw#I*&Gw#4&Hw# %           D %}$%l%#m_l%#u%#u_l%# v%#v_l%#{%l%#v_l%#c%#c_l%# r%#r_l%#%rq%st%$>D%P %0#col%0#sov%0#eoh%0# sol%#eol%#som%0# %߉#sl%{#  %W#8cap%>#@%4%#b%&# %z #req%#rsp%#\uri%# %#%#OJ%#@%0# ^!AIJ# K#* L#M# N# O#B P#5(R"#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H-@[#Lp\#\g@^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v"#hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#"5(tDR  # #O# # h#r###BW%#,acl#0#8#@#H>#P?u%#Xsrv#de #h? #lh &#pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉#o#G #R#7#.'##/##5''#id#,##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# g@# # o# "# m # u # Jp# p# # # #  # # g#  # B # p !^# "^# ## Z## $'# ]%'# &# '# O(# q)'# )'# *# w +# ,# -'# = .# /# 00# 10# F2$# :2$#HZ"; $$ #$! #srv$"#  #D #G# G# /G###  #$&P#(} P#,P#0i#4Qi#<#px"#svȷ#w#Dw# @0# iidˉ#Jˉ#sidˉ## "##iidщ#px"#buf0#sid0# ptrՉ#bol։#$( #ς#י# /$E #"A$ 5$X$ G$$x ,#t0#t1#:"#"## D#$ #(W%G#len0#pos0# sid0#srv#oe"#src#buf} #u%be"u% !0#.#% srv%# # #%Xact^$#bck^$#,&act#bck# '#Q # ## ##8 # #map%# %#,V%#T '#8'#e:'#/'#'#' '' #4#(:#<# A#+#\#!#.'! ' ' 'z J"'e)5U# !4 Q$)F)L tU# K R% !M S&errN')v())H*!)+(-)~G,>)V,I),T),_))`-j)_-u)-)-)P-)W.).).).)')PS()/-)[*0 ! 1fd2))k3\2j4uidj14gidj3j&5=)l)5)m)5-@n%6retp5 p7Z)7*7w*7( )8)"T4fdS$f*w)^U# ] P% !_ S'f*`(x*'*D,*~)-*~-*V-*P/**$0 !# 8*(3\25-@%5 ݉6ret݉9,,*sbU:fds&lt ~1su 1tv&cfdw~%&x~;&:;[%7;|&5;(3<,%-@~%l%~<+&__pS++,W]*,)*,) -,W++,(-<+H&__sP<,`&__sP<*,x&__pR+A,-(-\82,"6t?6__p2-74t8*-%/4buf.t 2N-h4tg4fg08e-4tǐ9/)DpU:sC #/CQ%?E/&argFW@->&_%>_%@.">&`%>`%+)./DG(/,/P(/+L./nq(/,/P(/@r.>&m%>m%@.>&s%>s%@.>&w%>w%+./LX(/' 0LX(0((0(40+&//ds(/' 0ds(0((0(40+Z//(/' 0(0((0(40+}//(/,/P(/'/(/' 0(0((0(40 / 8/)4s 4bt 3*k A 0>i0hAA0 -0+0x+>0,91(PU:s S:reqt V%/W1p+01, 1R,+1Q+071,D1P@0&__sW+0P1 (]1'71!0(D1271yk3j4nowj8P1(4buft 8i1,)4buft 9d5)PU:t&s p%>*l%n*0h%E*0W;)v;)y;Z(<2>@0'd5(q5@G2 %@0R'd5(q5+^2}57B(5+25@(5(5+25@`,5R,5V'5`,5R,5V+25(5,5S+25(5(5+35$(5,5V)-5R+23}5$,(5+]35Cj(5,5V)-5R@w3 >@0+35$.(5+371F](D1+371(D1+35(5+36(6'6(06+'4:6-(K6'U6(b6+f4t6-k(6'67k(6'U67E,b6P+}4N-k([-+46 #(6+410G, 1P,+1Q+41Lc, 1P,+1Q+41k, 1P,+1Q'6(6+&51, 1P,+1V+F51, 1P,+1V'1, 1P,+1V8}56&4buft 85N*u4buftt 25V#u4t1t4t2t85{(c4bufbt 3{Ab05P(d086j(4buft 26"4t2:6 ~4t}2U6 v4tu8n6]3\n6264t264t86(M4bLt B)UC1'K66 >C'L66 ~C'M6C[(7pCJ (7C q!C.vK77CwC xC *\ 7D C+Qx7C,;0Enow,Em?ERAE3CD^7roS UH 0oBTGQqF{z )D)E#)F#J37 3J3G# { A3J9 /-V5 /- @0# !0 # 0 # b 0 # 0# 0# A0# 0# z0# 0#$ 0#( + 0#, M0#0 00#4 .0#8 X0#< 0#@ 0">#D 0#p#F H0$#G b0(#H 01#L 07$#T d08$#X 0:#\ "0<#`7b \$y$0 00# 0#B 0#    3tm,w/x# y#rz#z{# >|#R}#6~#j## #$\#($[> ##  !R#J#t!# 1 wVnV#pV#1" - 1#ref!V#]4(w (xm#(y1#(z0#  ({0#'(|0#r(}0#B:(~0#@(0# -(0#$u(#( . Q bQ# aa .  6# a# a# bit#u32"0*+g#key,#` H0wq1#rq2# 3#04#450#86v#< 7$#@8#Dppp`)  D # # # P#  1#: | D # #2>40Y G Po b*#ڦ##n 5#" # 7 s *8 J K0#* L0#{ M$#fd N# @ O0#exp P0#[6 Q #6 R #G6 S # 6 T #$ib U #(ob U #,x V0#0 W$#4  s  #  U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D<  #L  #P  #T #X  21 tstr u#len v#     p  z 1#L 1# p# ! g#fe $#be $# # @ #$Z 0#(D #,req #0rep #4si &#8 #"% # P#srv #p #Q #> &#txn # # C$# *&#3 A&## Â# Ă#, %# 0#   ] Tn# # ##! # ' k Z auid^<#gid_&#`1#m buxa' t !LfdM# N#hO#-@P#  Qa#R#$S# T0#Ug#V1#7*W}#BXv#5'Y#`Z$# [0#bZ # *c#a TQum#n#So#p# q# r# s#$!6t}#(87u}#,v#0w#4{x#8@y#<hz1#@e{#H|1#Ltm }m  a CfA}#bB #K.(?cbCK#{D$# E7#evF7# G[#H#I#  J#$ [  JB:#get#put#u# #a   !!#!#!#3 !!3#!#G!#.(!'7!(#&!)#!*#!+# ,!+#7!,#@!-#-!.#!/3# !0#$99! ''9#u'#Z'#len' # \'!#F'"#gp"7-@"4un"5 in"6Pp"2u"7?# 1SC1O#1P#h1Q# 1R# ? 1;uid1<#gid1=#1>#$1?# ,1@# 1A#!1B#a1C#1D# |1E#$ 1F#(<1G#,1H#01I#4,1I#8J1J#<1J#@1K#D1K#H1L#L 1L#Pm 1Mg#Tu 1Mg#1S# 1Tm #Y1U# r %a%^$#%_%#k%`%#%a?%e %j%h}#f%i}#A%je$+$,#$-#$.#$/\#   r7P V#I#CC7@G &0#f 0#0#5,8len,90#cr,:0#,;0#b ,Cv,D#B:,E#,F#I*,G#4,H#  a+!!!! ! !!!! ! D + +l+#m_l+#u+#u_l+# v+#v_l+# +l+#v_l+#c+#c_l+# r+#r_l+#7+rq+lst+D+P +0#col+0#sov+0#eoh+0# sol+#eol+#som+0# +ߔ#sl+#  +W#8cap+#@+4+a#b+# + #req+7#rsp+7#\uri+# +#+#OJ+#@+0#V/+ /+\#idx+#val+# 7+ #  "AIJ# K#* L#M# N# O#B P#5(R$#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X1#@!Yp#H-@[P#Lp\P#\g@^P#l`#|oa# b#@d#d#e#o fP#wg#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v$#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.O# 0#i# i#i#Qi#U#$5(tDR g# 5#O5# # h#r##P#B@'#,acl1#01#81#@1#H>1#P?^'#Xsrv#de #h? #lh (#pK#Z #Ҕ##Ԕ#0#֔#gה#[# ٔ#R ڔ##ܔ#ݔ##G #R#7#.##/#1#5')#id#,#1#t#4 ##0#i0#0#0# O#0#+O# 0#i#i# i#$0#0#`0#5#z5# 5# 5# # # 8# # 0# j0#  G#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# pP# g@P# # o# $# m g# u g# Jp# p# # # #  # # g#  # B # p !# "# ## Z## $9# ]%9# &# '# O(# q))# ))# *# w +# ,# -)# = .# /# 00# 10# F2&# :2&#H6C$; ** 1#*! #srv*"# $D  # R# R# / R# # #  #$& P#(} P#, P#0 i#4Q i#< k% px $#sv Ƞ# ɂ#D ɂ# @ 0# iid ˔#J ˔#sid ˔# % " \# % iid є#px $#buf 0#sid 0# ptr Ք#bol ֔#& ( $ k% ׂ% &  $*& &A&  0&&x ,6#t06#t16#:$#$## D#$ #(@'R#len0#pos0# sid0#srv#oe$#src#buf #^'be$u ' !0#.1# ' srv'# # # 'XactG&#bckG&#, (act6#bck6# (#Q # ## ##8 # #map'# ļ'#,V'#T )#8)#e:)#/)#)#)( ) #4#(:#<# A#+#\#!# ) ) #);$9$$u:)@5 61# E7U*#be;)# U*aD7 -?1# g-@1#pol-A# -B0# /-C#)*C > ?1# E@U*#+x(C D1# EEU*# JF# G# %H# I# @J0# K# L#$z+&-dow-#h1-#m1-#h2- #m2-# +-min-i#max-i#%-˔#%-̔# +--@-5#O-5#,-i-Ȕ`-z++%-+&-+C,-ptr-$str-reg-C,r,%,--1#val-+#ptr-,#%-s# len-ڔ#$@-۔#(, -p-$i-ll-id-,a-,J ,$ I-r%0-i-#ptr-#len-#@-# ctx-,#-%-kw-\# --# %-c.# C-~.# -0# &- #-g-I,--$ $-]..].!C- -!1#kw-".#arg-%.# W&-&# %-'1#,-~.].-i.._&- -1#kw-.# .I-"#.-%%str-$I-/,4a#len# !/# !/b  /&/1 U'iǔQ'tmpQ'msgɔS(z/)__s$*/)__s$+04rU,bp ,msgp0W-bq0p- q\S.{AsP/lens0 1zAy07+0E-U,b R,msg0S-b0V- \,lenW.{AP0@1zA0+1V4 U,hdr\,end\V-u\,lenW2val\R+U1n/\U,s\P,e\S.-V.>.Q+(2 1U-u\,len ,sol\W,idx0R,ctx(22eol\V2sov\S.]1p343.c42.25?26K25\27K2e1<8;07h2 31800+20 U-u \S,sol \ ,idx 0,ctx (29q3*|U,t S,si V,err-* -OJ,msgq3W4D3|3:3Q4[335363":3Qw3 ;3E+^5+3U,s ,si  2txn4V2rdr h.\2Q2lenS6^5d5k54I5u5kw:5Q556555;u5/(53U,s V,si S.x P>7!/e U,s V2pn2fe$~2be$~1$2txn4W.~.~2err~2uriP2hR.~2tm~.-7 .?~2hdrS477:7~:7P4:77K c 57574e7 8  585)8*  ?58(7  /__vJ>*7 G /__vI> 7@7"Anow!7Atm!7 G78W+=93jp #U,somh,idxh0 ,capi-! i92eolkp2solkl2colkV2sovkW.]1lh2hm9S2lennd49.2q s 5?24(9K2  5\20X2__p$Q+:.\0U,msg0V-0\W- 0S,ptr\R,end\Q-A,-f,: 3-3#+ E3$434313I13-z3s+a0+;/-\U,msg*0S-0*\ - +0P,ptr+\R,end+\Q-A,,W-f,,: 3..23#+3A0H3[-Q}35^C3/iO3n2r32S133`h3E.k><\0U,buf ,msg0W,idx0. 0R2ptrS2endV3#+3n-3-3*30+i34&35F333..!!303473+3+Q35e3n0 3C4v`3%2{y392}3.V3w1k4<<Lr5<:=w :=R4<< 5<:=w :=R4<=5)=*?5=;=a+F8E0=_.eU,es=S,s p,buf W,msg0V-0$l&+>x.cpU,tb -b$P2txnd4d..e`.L"f\10g.]1gV2hhSDF>p2__sj$W4]>.25?2Ds>/len4>>5>4> ?:?Q4>#?  50?4>5>6]A:nAR:yAP6A:AP5A7Ag$W|B/0 "U,t P,rtr Q2txn4p2p1l2p2V.0V..S.0h.]1W4YB.2U [ 5?20@.T0P2valP>B^/ "p#U,s  S,rep V4BB5#>#5B*P#i#2ret P;B,xF+Y 0)c+U,tY  W,bufY \p,lenY V2txnZ 4l.2[ CV10\ DE2__pi $QDF2__ps $S4AF]A */*:nAR:yAP6A%*-*:AP5A02srv S*S*h*1& %1 %+F+ p++U,s Q,e \V.- W.>. S+G. +,U,buf -- S- Q.5 R>I;/ ,4U,t  ,req  2txn 4l.p, h.]1 d.* `.+ \.90 X.1 T.- p.5 P.9, S., L.4 V.- H.2 D. @4IH.2,,5?2DqH.T0 2val PDH.,V002__p$QDHP.+6P.06.i37DHh.VS01zAe0D)I.xP01zA~0DSI2srv.+(I12.#P01zA.0(IY33. P0(1zA00P.3W.1P0h1zA0+ KI,r4'7U,tq P,rtrq  ,expq.XCss.0tV..tS.0tl.]1uh.*ud.,u`2txnv4W.T0w\2lenxP.xP4J.2455?2DJ1zA001zA0+K/079U,t ,rtr  ,exp.XCs.0W..V.R+l2txn4S2lenP.P(K28J81zA06<885<:=P:=R+YL2099U,t/ W,rtr/  ,exp/S2txn14V02ret4P>lO<5[9#DU,tZ ,resZ  2txn\4l./]h.]1^d.*^`.^S.+_\.90_X.1_T.5`p.9,`S.,`P.4`V.-`L.2`H.`D4M.2995?2D N.T0i@2valjPDM0.,V0H2__p$Q0h.+iP.0i.i3jDWN.2CS6]A<=:nAQ:yAP6A<=:AP5ADmN1zA90DN1zAa0DN2__p|$QDN1zAS0DN8.3W.1P0P1zA 0DOx.?P01zAD00.+0%WD>O2__p$VDVO2__p$Q02__p$Q>Pi40DEU,t -o3\ ,len.1P.1W.2S.T.p.0o.0P.S>P+EcFU,dir\,t Q-m+\W,end\S2lenV2maxP002bR+T}, pFTU,t  2txn 4W2req p2rep l3A3 F32t Q35a MI31% vIDRP.]10 S/msg1 0. 62 $V0p11 $DQ.0, S.., d.0, `.]1- \.*- X.- P2val- P.T0. T6.2GG5?24R ?vIyI5?6#?yI|I50?D-R1zAG 0DCR1zAR 04kR=;LRL:)=P*LLRL?5=4RTRLXL5)T:4TRDRE?TPDR2len~ S(SYNO2eol; V2sol; h4R.2NN5?26K2NN5\24S ?OO5?45S#?OO50?4LS ?PP5?4cS#?PP50?4zS ?AQDQ5?4S#?DQGQ50?4S#?QR50?4S ?RR5?4S>SS5>4SKTbSS5XT5cT6 8SS585)8*SSE58P;KT{(c`5XT5cT4gW3k``:3R4~W>``5>4W]A``:nAQ:yAP4WA``:AP5A4WA``:AP5ADW2len PVD-X.\2\~.-V0 2qsPDRX82lenS2pnVVDwXP2lenV2pnVW(Xef2eolS2solV4X.2ee5?26K2ff5\2DXh.EU*V02retPDY2__p$Q(+Y4gg.3SDrY.P..S6< h:h5<:=P:=R4Y5:iWi55DY2lenS2pnZ4Y?jj5@: @P4Y5kk554Y>kk5>46Z]Al/l:nAR:yAP6A$l-l:AP5A4MZ5:lWl55DgZ2ctx 4~Z5pmm55*m!o.5 i2ctx6 6>nn5>[**;Z' O=`5ssU,px$P,l4 R,l7$P,sol -;D-W-v%].S/txn42idx0Q2ctx(2V=+a,stU,px$V,l4 S,l7$Q,dir-;D-R-v%].P/txn4=a*,1tOtU,px/$V,l4/ S,l7/$Q,dir/-;D0-R-v%0].P/txn24=Kb2CPttU,pxA$P,l4A R,l7A$P,solA -;DB-W-v%B]./txnD42idxE0V2ctxFX2cntGS=b/YttU,pxW$V,l4W S,l7W$Q,dirW-;DX-R-v%X].P/txnZ4=?c1lu?uU,pxj$V,l4j S,l7j$Q,dirj-;Dk-R-v%k].P/txnm4=c.@uuU,px}$P,l4} R,l7}$P,sol} -;D~-W-v%~].V/txn42idx0Q2ctx(2S=Odf5u5vU,px$V,l4 S,l7$Q,dir-;D-R-v%].P/txn4=d-@vvU,px$V,l4 S,l7$Q,dir-;D-R-v%].P/txn4=e0vLwU,px$P,l4 p,l7$P,sol -;D-S-v%].V/txn42idx0Q2ctx(2W02__s$S#e$0$>$ 7/__ue/__cwre=:f .PwwU,px$V,l4 S,l7$Q,dir-;D-R-v%].P/txn4=f,wwU,px$V,l4 S,l7$Q,dir-;D-R-v%].P/txn4=MgR2wDxU,px$,l4  ,l7$P,dir-;D--v%].S/txn42ptrP2endVG,xPxbxUH1.Kmgsg >H.Lgg H.MgH[/gHJ /gH4 H H.vgHwH 1\ hI HQhH;0Jnow iL)1Hw3=L-M\L5S\LZ\L64a\ 6j L kHj= &j ]j\ My5uMjL4)?  j LW5j@ L5j@?  j\4  K-j9 jNj /Nk / k\ Nk 6kb K-Ik1 &kK*ak1 /.%*.0p8pWpx06yint$ 77i "72-y&pk67>Lm?LRAL3CDe7roS UH 7-oBTGQqFpz #D#E##F#9 '-{5 '- @(%# !( # ( # b ( # (# (# A(# (# z(# (#$ (#( + (#, M(]#0 0(c#4 .(%#8 X(%#< (#@ ("E#D (#w#F H($i#G b((y#H (1#L (7#T d(8#X (:%#\ "(<#`  (] ((]# (c#B (%#&{ y   3% %$[E ##   R#J#t # 0 w{Wڥ#ۺ#n #" #TnW  #! #2E47YG o b# >    b # .. ~    #  .#  .# bit %#u32 "7 * +4#key ,~# n #p #" - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 57#8 6#< 7#@ 8%#D6]4"w "x#"y#"z7#  "{7#'"|7#r"}7#B:"~7#@"7# -"7#$u"6#( F *8J K7#* L7#{M#fdN%# @O7#expP7#[6Q&#6R&#G6S&# 6T&#$ibUu #(obUu #,x V7#0W#4  Fu # U@}7#rex~%#wex%#rto%# wto%#cto%#l7#r#w# lr#$>7#(7#,7#0 7#4H%#8)l #< >#@>#A^#D< #L  #P  #T #X, 21tstru#lenv%#  u  l p z #L # # ! #fe #be # %# @ %#$Z 7#(D #,req u #0rep u #4si &#8 #"% # 6#srv #p #Q #> '&#txn # %# R$# 9&#3 P&## ~# ~#, %# 7#  & %#<&!%# &"%#&# # r ] k auid^1#gid_#`&#$ buxa + !LfdM%# N%#hO%#-@P#  Q#R%#$S%# T7#U#V#7*W4#BX#5'Y#`Z# [7#b # *c# TQum:#n%#So%#p%# q# r# s%#$!6t4#(87u4#,vZ#0wZ#4{xZ#8@yZ#<hz#@e{%#H|#L+ $ 4%%$ J Z%JCfA4#bBu #.(?cbC#{D# E>#evF># G0#H#I%#  J_#$ ` _ JB:%#get%#put%#u%# # DC<_``#AaY#setbY#clrcY# WBdY#AeY#remfk#clogk#66h# :i#$XCj#(v%k#,Hl#0um#4n%#8Y%%Dk_%eq%5%8len%97#cr%:7#%;7#Fb %Cv%DF#B:%E~#%F~#I*%G~#4%H~# $    D $L$l$%#m_l$%#u$%#u_l$%# v$%#v_l$%#J$l$%#v_l$%#c$%#c_l$%# r$%#r_l$%#g$rq$st$ D$P $7#col$7#sov$7#eoh$7# sol$#eol$#som$7# $%#sl$J#  $^#8cap$ #@$4$#b$# ${ #req$g#rsp$g#\uri$# $#$#OJ$%#@$7#) D##%#W# #:H !a!^#!_,#k!`,#!ae + ,# -# .%# /# S HP ##JQ5(tD # #O# %# h%#r%#%#6#B!#,acl#0#8#@#H>#P?!#Xsrv #de %#h? %#lh Π"#pK#Z #%##%#7#%#g%#[# %#R %##%#%#ީ#G #R%#7%#. $##/%##5'##id#,##t%#4 %#%#7#i7#7#7# Q#7#+Q# 7#p#p# p#$7#7#`7##z# # # # %# 8# %# 7# j7#  <#  p#  p#  p#  p#  p#  p# ) p# p# Qp# %#cap%# p6# g@6# %# o# # m # u # Jw# w# %# %# %#  %# %# g%#  %# B %# p !# "# #%# Z#%# $,$# ]%,$# &# '# O(# q)2$# )2$# *%# w +# ,%# -B$# = .%# /%# 07# 17# F2\!# :2\!#H@G &7#f 7#7#p7-@4un5{in66p2u7#  ;  #! #srv" #  A"J # K%#* L%#M%# N%# O#B P#5(R#S%# T%#$5 T%#($U7#,6U7#0tV%#44 V%#8'W%#<X#@!Y#H-@[6#Lp\6#\g@^6#l`%#|oa# b_#@d #d #e#o f6#wg~#h%#i%#;i%#2$j%# j%#Rj%#k%#l%#Fm%#ido#p7#b p7#q7#r7#us7#?t7#Vt7#gu# v #hw #yp#yp#jz7# {<#}p#}p#~p#~p#p#.Q# 7#p# p#p#Qp#U%#\!x ,#t0#t1#: # #%# D%#$ %#(!G#len7#pos7# sid7#srv #oe#src#buf #!beu" !7#.#P" srvP"# %# %# {"Xact #bck #,"act#bck##%#Q %# %#%# %#%#8 %#  #map"# V"#,V{"#T ɛ##8ʛ##e:˛##/̛##͛### #$ %#4%#(:%#<%# A%#+%#\%#!%#!.$!! &$ B$ R${ %D  %# G# G# / G# # #  #$& W#(} W#, W#0 p#4Q p#<z% px #sv # ~#D ~# @ 7# iid %#J %#sid %#% " #% iid %#px #buf 7#sid 7# ptr %#bol %#& ( % z% ב% '&F 9& -&P&  ?&&,SC,O%#,P%#h,Q%# ,R%# ( ,;uid,<%#gid,=%#,>%#$,?%# ,,@%# ,A%#!,B%#a,C%#,D%# |,E%#$ ,F%#(<,G#,,H#0,I#4,,I#8J,J%#<,J%#@,K%#D,K%#H,L%#L ,L%#Pm ,M#Tu ,M#,SV&# ,T$ #Y,U%#"(6L%pxxU#G7L%S#6L(Q#7L%R# 7L(V$lenL,W#@LWP%*LS&)7%x{U'si p'bu S(6%l(%h)ret%Q)max%d*))O62{{U'si1 S"*6%{JU$fd%+si p+bu S+ret%Q+max%W%%l%>7%h%16%d,",p6X,#h}-)||)fwd9%R.*(6%V/#**}~0*V1*/d**`~~1*1*203*V3*Q4*4+3+V5+0++R06+P5B+0S+P1^+6*h7tg7fg76+6h%7bgu 7sig 8fdi%8retj%8maxj%9j%9k%6B+g$W%7nowV%:5'V%6j+#L%7nowK%:5'K%*+6PU'si S;,,7x%U'fdw%)siy W)bzu S({%p,",#,a6g/@,+0++R06+P5B+0S+P1^+/W,,1,/u,* 0*S1*/,+0++V06+R5B+0S+R1^+5*ׄڄ0*S1*6,&6D%:C%*-6MU'siL W)ibNu V)obOu S)fdP%p/n-+ֆ0++R06+P5B+̆Ԇ0S+P1^+/-+0++R06+P5B+0S+P1^+5+2G0++R06+P5B+AE0S+P1^+*.;6U'si R)ibu P*>/6WU'si V)obu S(%P,#/u.,Ԉ׈1,/.+0++W06+R5B+0S+R1^+/.*10*S1*//+m0++R06+P5B+|0S+P1^+5+0++R06+P5B+0S+P1^+<['K/pEm ?ER AE3 C D^7ro S UH  09 -5 -@ ~#! # #b #  # #A # #z #  #$ #(+ #,M #00 #4. ~#8X ~#< #@ ">#D #p#FH $ #Gb (#H 1#L 7#Td 8#X :~#\" <#`     #  # B ~#   / 3qFcz D E# F#oBTGQ n #p #"  - #ref !#x]4w x# y# z0# {0# '|0# r}0# B:~0# @0# -0#$ ux#(   b#    ### bit~#u32"0?* +#key, # H0wq1#rq2# 3~#0 4~#4 50#8 6#< 7#@ 8~#D?))  D# # ~# P# #:] D]# ]#P # #)2>40YG o  b# $[ >*   # *# : q R # J # t q#  w # ۺ# n # " # 7 *8!J !K0# * !L0# {!M#fd!N~# @!O0#exp!P0# [6!Q# 6!R# G6!S# 6!T#$ib!U #(ob!U #, x !V0#0 !W#4 # !U @}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H~#8 ) #< 7#@ 7#A W#D <#L #P  #T  #X4 21tstru#lenv~#E E  K  p z "# L"# "# !"#fe" #be" # "~# @"~#$ Z "0#( D"#,req" #0rep" #4si""#8 ":# "%":# "#srv"# p"# Q "# > ""#txn"# "~# ")!# "## 3"'## # "w# "w# ,""# "0#4    ]H Tn  # !H # X k auid ^y#gid _c#  `n# bux aX  ! Lfd M~# N~# h O~# -@ P:# Q#  R~# $ S~#  T0#  U#  V# 7* W# B X# 5' Y# ` Z# [0#  b # * c# T Q u m#  n~# S o~#  p~# q# r#  s~#$ !6 t#( 87 u#,  v#0  w#4 { x#8 @ y#< h z#@ e {~#H  |#L  ~~~  ~CfA#bB #|.(?cbC|# {D# E7#evF7# G# H# I~# J#$   J B:~#get~#put~# u~# #p7-@4un5 in6,p2u7#m(S C(O~# (P~# h(Q~# (R~#  (;uid(<~#gid(=~# (>~# $(?~# ,(@~#  (A~# !(B~# a(C~# (D~# |(E~#$ (F~#( <(G#, (H#0 (I#4 ,(I#8 J(J~#< (J~#@ (K~#D (K~#H (L~#L  (L~#P m (M#T u (M# (S,# (T # Y(U~# a ^# _%# k`%#ane+ ,n# -t# .~# /# )z 5%8len%90#cr%:0#%;0#b %Cv%D# B:%Ew# %Fw# I*%Gw# 4%Hw#  Z$!!!! ! !!!! ! D $$l$~#m_l$~#u$~#u_l$~# v$~#v_l$~#$l$~#v_l$~#c$~#c_l$~# r$~#r_l$~#0$rq$est$D$ P $0#col$0#sov$0#eoh$0# sol$#eol$#som$0#  $~#sl$# $W#8cap$#@z$ 4$Z# b$# $ #req$0#rsp$0#\uri$# $# $# OJ$~# @$0#@G  &0# f 0# 0# "AI J# K~# * L~# M~# N~# O# B P# 5(R # S~# T~#$ 5 T~#( $U0#, 6U0#0 tV~#4 4 V~#8 'W~#< X#@ !Y#H -@[#L p\#\ g@^#l `~#| oa# b# @d# d# e# o f# wgw# h~# i~# ;i~# 2$j~# j~# Rj~# k~# l~# Fm~#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v # hw# yi# yi# jz0# {/# }i# }i# ~i# ~i# i# .z# 0# i# i# i# Qi# U~# 5(tDR # # O# ~# h~# r~# ~# # B-$#,acl#0 #8 #@ #H >#P ?K$#Xsrv#d e ~#h ? ~#l h $#p K# Z # ~# # ~# 0# ~# g~# [# ~# R ~# # ~# ~# c# G # R~# 7~# .s&# # /~# # 5'%#id# ,# # t~# 4 ~# ~# 0# i0# 0# 0# z# 0# +z# 0# i# i# i# $0# 0# `0# # z#### ~#8#~#0#j0#  /# i# i# i# i#  i# i#) i#i#Qi#~#cap~#p#g@#~#o# #m #u #Jp#p#~#~#~# ~# ~#g~# ~#B ~#p !n#"n##~#Z#~#$&#]%&#&]# ']#O(]#q)&# )&#*~#w +#,~#-&#= .~#/~# 00# 10#F2##:2##H)!; # # # #!E #srv#"# !D" "~# ":# ":# /":# "# "#  "#$ &"P#( } "P#, "P#0 "i#4 Q"i#<Q""px" #sv"Ȇ# "w# D"w# @"0# iid"~# J"~#sid"~#h" " ""ζ#""iid"~#px" #buf"0#sid"0# ptr"~#bol"~#""("!"Q""h" "  #E #'#E #J#x , #t0#t1# : #  # ~# D~#$ ~#(-$ :#len0#pos0# sid0#srv#oe #src:#buf #K$be up$  !0# .#$ srv$# ~# ~#$Xact4##bck4##,$actƐ#bckǐ#% ~# Q ~# ~# ~# ~# ~# 8 ~# #mapp$# ĩ$#, V$# T %# 8%# e:%# /%# %#%%m&  ~# 4~# (:~# <~# A~# +~# \~# !~#.m&! y& & & #I'7W~`.U$p7X~ %'I'r&Z''P&Z'('h)d'R*q'+'%5''̊ъ,'P+'*'+'-q'".t/.__p-'70t-'#L~0nowK~15'K~2'>1 #@(7#~0YU$p7$~ 37%~4s&S4p' W5-$7/~V$7/~p#)7g`U6tf4ph p$|7i)l$7jS$'*jW4ik~h%()Ќ,%)P+0)%(' ,'P+'7(9h.lent~'3\}c-<)yk~1j~0nowj~#)}F~֍U87P87P37375ʍ3&%3%9)-U87S9*]70U4p S%~**j+*%B**j+***q+***q}+**+++*++0+**,*P*:+ێ,G+Q-*"0t-* ~0t}-* v0tu2*]1\*-+0t-:+0t2Q+0t:[^+:J ^+:L^+;4]@ ;4@ ;  ~@ :.v+:w~ +< :&Q+:';0=now'<:: (Xm:(^ >5(O : Q0:R0: U0: V]:W*$7 P>j0^;y$ !07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 0oBTGQqFpz $D$E#$F#9 +-{5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 X,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7 6 B  , ,,# ,#B ,#I{B3$[> ## 8R#J#t8#Hwty6 7# w8#2>40YtG o b#ڽ#ۊ#n ܠ#" #73 b3#CC  # C# C# bit#u32"0*+I#key,#n#p#" - #ref!# H0wq1#rq2# 3#04#450#86#< 7#@8#D K]4"w "x*#"y#"z0#  "{0#'"|0#r"}0#B:"~0#@"0# -"0#$u"K#([ )*8&J &K0#* &L0#{&M#fd&N# @&O0#exp&P0#[6&Q;#6&R;#G6&S;# 6&T;#$ib&U #(ob&U #,x &V0#0&W#4 5 5[) # &U@#}0#rex#~#wex##rto## wto##cto##l#0#r##w## lr##$>#0#(#0#,#0#0 #0#4H##8)# #< #7#@#7#A#W#D<#5#L #5#P # #T# #XA 21#tstr#u#len#v#    p #z%#L%# %# !%#fe%"#be%"#%# @%#$Z %0#(D%#,req% #0rep% #4si%$#8 %#"%%#%#srv%P#p%P#Q %P#> %$#txn%# %#%"#%$#3%$## %w#%w#,%؎$#%0#    ] Tn  #! # k auid^1#gid_#`&## buxa * !LfdM# N#hO#-@P#  Q#R#$S# T0#U#V#7*W3#BX#5'Y9#`Z# [0#b # *c# TQum?#n#So#p# q# r# s#$!6t3#(87u3#,v_#0w_#4{x_#8@y_#<hz#@e{#H|#L* # 3 #O_ OCfA3#bB #.(?cbC#{D# E7#evF7# G#H#I#  Jj#$ej JB:#get#put#u# {#OC<_``#Aai#setbi#clrci# WBdi#Aei#remf{#clog{#66h# :i#$XCj#(v%k#,Hl#0um#4n#8d d O { do   p   p7-@4un5 in6p2u7#H0SC0O#0P#h0Q# 0R#  0;uid0<#gid0=#0>#$0?# ,0@# 0A#!0B#a0C#0D# |0E#$ 0F#(<0G#,0H#00I#4,0I#8J0J#<0J#@0K#D0K#H0L#L 0L#Pm 0M#Tu 0M#0S# 0T# #Y0U#) D###P# #:] a ^# _%#k `%# a*e+,#-#.#/# h ]P ##  6@G &0#f 0#0#u5)8len)90#cr):0#);0#b )Cv)D#B:)Ew#)Fw#I*)Gw#4)Hw# 6(           D (s(l(#m_l(#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(sD(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (߉#sl(#  (W#8cap(#@1(4(#b(u# ( #req(#rsp(#\uri(# (#(#OJ(#@(0#{V/( /(#idx(#val(# 7( # t!PA I JP# K#* L# M#  N# O#B P#5( R"# S#  T#$5 T#($ U0#,6 U0#0t V#44 V#8' W#< X#@! Y#H-@ [#Lp \#\g@ ^#l `#|o a# bj#@ dP# dP# e#o f#w gw# h# i#; i#2$ j# j#R j# k# l#F m#id o# p0#b p0# q0# r0#u s0#? t0#V t0#g u# v"#h wP# yi# yi#j z0# {<# }i# }i# ~i# ~i# i#. # 0# i# i# i#Q i#U #"5(tD R  # #O # # h #r # # #B %#,acl #0 #8 #@ #H> #P? &#Xsrv P#de #h? #lh ζ&#pK #Z # ҉# # ԉ# 0# ։#g ׉#[ # ى#R ډ# # ܉# ݉# ޾#G #R #7 #. 6(# #/ # #5' '#id #, # #t #4 # # 0#i 0# 0# 0# # 0#+ # 0# i# i# i#$ 0# 0#` 0# #z #  #  #  # # 8 #  # 0# j 0# <#  i#  i#  i#  i#  i#  i# ) i#  i# Q i#  #cap # p # g@ #  # o #  "# m # u # J p#  p#  #  #  #  # # g #  # B # p !#  "#  ## Z ##  $B(# ] %B(#  &$#  '$# O ($# q )H(# )H(#  *# w +#  ,#  -X(# = .#  /#  00# 10# F 2r%# : 2r%#HV"; '' #'! #srv'"P# #D% %#%G# %G# /%G#%#%#  %#$&%P#(} %P#,%P#0%i#4Q%i#<$%px%ǰ"#sv%P#%w#D%w# @%0# iid%ˉ#J%ˉ#sid%ˉ#2$ %"%#$%iid%щ#px%Ұ"#buf%0#sid%0# ptr%Չ#bol%։#$%(%̤#%$%2$$[" $ $ $ 5$r%x ,  #t0 #t1 #: "# "# # D #$  #(%  G#len 0#pos 0# sid 0#srv P#oe "#src #buf #& be "u 3& ! 0#. #f& srv f&# # #P&X act $#bck $#,& act #bck #'  #Q # # #  # #8 # P#map 3&#  l&#,V ȑ&#T ɱ'#8 ʱ'#e: ˱'#/ ̱'# ͱ'# ' P'0(  #4 #(: #< # A #+ #\ #! #.0(! <(X( h( (&*dow*#h1*#m1*#h2* #m2*# )*min*i#max*i#%*ˉ#%*̉#2)*-@*Ϡ#O*Р#e)*i*ȉ`*(+%* )&*h()*ptr*str*reg*׏)])%,**#val*2)#ptr*e)#%*0# len*ډ#$@*ۉ#(-* *p*i*ll*id*-*a*4*JD**r%0*i*#ptr*#len*#@*# ctx*)#*%*kw*# *+# %*+# C*+# *0# &* #+ $ + 9)*K+ "  K+ +Q++!C* *!#kw*" ,#arg*% ,# W&*&# %*'#D*"++ + +++_&* *#kw*+# ,*!" ,*%#str*$*$,< U%px"&op&totS'l&curPQ't9PW(,&maxh)*v+,=?U%px>"Q&srv@PR,,BV- ---.#-$0/ //>8/+F-/8[U%pxZ"R+-9mrU%srvlPS&pn"V0:{C,,- ---+-G:U%srvPS&p"V0:,,- ---$l.g8RU%pݰ"W&srvPS'<V&actp&bckl1#F&w`14F*t2o/:'`U3srv&PS4p("W4grp)o/P5:TC5E9Q36.,- ---6.,- ---(/7x APR6//,- ---6[/u/-/,/8/P,/-/$9/l<8:s7P;/]/\/9/::sP2Q09AU3s@PV4pB"R4grpCo/W60,є- ---660/-/,Q08_0S-k09v0:< ":sP=08 &U3p "V4srv PS>B< 60,Ȗݖ- ---,Q0ݖ8_0W-k021:0ȗU3sPQ?p"4grpo/R6J11bv-1)@1P6a11-1,1-1)@1P918w:svP?grpxo/918g:sfP91;m:slP?grpno/22+9aЗU3srv`PS4pb"V4grpco/W5:5E9Ә6X2,- ---6t2,#- ---)7x PP23;U3srvPW>8>84p"p4grpo/l62,,7- ---63,7U- ---6F3u/ -/,/ 8/PAn3К79Q>b863u/)@-/,/)@8/P63u/@O-/,/@O8/V,Q0OX8_0S-k02D49ZU3sYPV604D4-R4,/8/S,]4-k49]4:G:sFP9v4l;P:sOP2k5`:hU3srvgPS4pi"V5:C5E9364,- ---64,3- ---(507x ~PR6+5,- ---6W5D4Ɯ؜-R4,/Ɯ؜8/P,k5؜-y595;A:s@P2168 U3srvPS4p"V5:5E965,- ---66,+@- ---(6H7x PP,]4-k426;֟U3srvPS>8>84p"p66,<G- ---66,Gp- ---66]4-k4,D4֟-R4,/֟-/=_7<U3p "V4srvPS>B<6K7,- ---,]4-k4B7X9cPFU3pxb"3uribVC7b7[dPp4peS7"1fl7;ghB8$;PPU3s P7[PT4txn8P4req V4msg9S4px"L7;0H7@-PW4lenPD7"1@4ctx1X4pS)`72101X?c)x4hex0R1ks7*PB9T8 PU3s  S7[ PW?txn 84msg9T4px"V7;0P4lenPS4ctx1X4pQ17;1LBz><eU3sd 7;gPp4errhV5ߦDout6O:z>ߦ->8>P,,Φߦ8 -P--6/;>->8>W(:@>P@>\@>V6: ?-?,*?-@8"@W8,@P) @7@S@B@L@M@V@X@H6_> ? -?,*? -:RGsR>GpR>> > VH ?7;1P:p0"{;2P>3/I?sFP.*?7// 6"HI?6I?< 5"IHz?I?mP>{;P?grpo/>2<K 8HeAy9P:grpo/>/?sPI>f9/9A<:grpo/>;"9AL<:grpo/:sPBjB< U3s SA#Bȯ?__v%>A B?__v%>1¯?__v%>1?__v">ARB?__v">1?__v">BB:Z{U3sY V4p[$P4err\SBDE89U3s ?fd4errP(C 7v$DT4ret P7@ L1Ǵ7#"H4src#X6lCDֳ8DQ8DS6CD3}8 EQ1B}@E@14__v8>P6C#E %-0E(C!7v$WDW4retXS7@XS(D@!4msg66D;E8LEQ8WEP6TDcE˶Ӷ8tEP-E6tDD8DQ8DS6DD8DQ8DS6DDƹ8DQ8DS,Dغ8DQ8DS;DJ//`.j/#..#E#/`j*ret;;E"TGfdS.cEg$WGnowV/5'V.E#LGnowK/5'KBF<@U3t S79P596EF6y-F,F=I8FR-F64Fz>->->,,ڽ8 -P--6TF;E8LER8WEP6rFcE158tEP-E,Fh-F;F/ (Gs 'P;F% 1Gctr 0FGinc 00;FG& "Gctr !FB G9U3px"QBI<%UC?$$3err$ C $Ck$"AG>&-%>-%AG5B>&1%>1%AGFS>&5%>5%(H`!>&9%>9%)x!>979P(jI!4arg:S6aHIֿ- J,Jֿ-,J-8J-DJ6HI- J,J-,J-8J-DJAH@>&@%>@%1@>@7@PAIDQ>&H%>H%69IIix- J,Jix-,J-8J-DJ,I- J,J-,J-8J-DJAI>&Y%>Y%AIQ^>&e%>e%)!4beguV?endu1-:>&%>%LJ> i< hLQJ -< +&%>%MK8QU3px"S3l4  3l73dirC;DK+WCv%+V7;PR1>&%>%ML8`U3px"S3l4  3l73dirC;DK+VCv%+W1>&%>%ML;rU3px"S3l4  3l73dirC;DK+VCv%+W1!6>&%>%M9M< U3px "S3l4  3l7 3dir C;D K+VCv% +W1>& %> %MML; yU3px "S3l4  3l7 3dir C;D K+VCv% +W11F>& %> %M]N9) U3px' "S3l4'  3l7' 3dir' C;D( K+VCv%( +W1>&. %>. %MN.:A U3px? "S3l4?  3l7? 3dir? C;D@ K+VCv%@ +W7=B P11F>&H %>H %N|:m UO[+OpOJ +OOL+OO-LJOPO ~O-MJOO qpO.v|OOwOPO.QOO/;0Qnow/Em?ERAE3CD^7roS UH 0oBTGQqFez "D"E#"F#9 %-p5 %- @&~# !& # & # b & # &# &# A&# &# z&# &#$ &#( + &#, M&R#0 0&X#4 .&~#8 X&~#< &#@ &">#D &#p#F H&$^#G b&(n#H &1#L &7#T d&8#X &:~#\ "&<t#`   &R &&R# &X#B &~#p n   3 $[ >   # #    R #J #t #  w2>40YG %ao b;#ڏ#0#n F#" # 7    b #  9    #  #  # bit ~#u32 "0m * +#key ,9#n#p#m" - m#ref!#< H0wq1D#rq2D# 3~#04~#450#86R#< 7#@8~#DLLL<]4!w !x#!ym#!z0#  !{0#'!|0#r!}0#B:!~0#@!0# -!0#$u!#(  *8J K0#* L0#{M#fdN~# @O0#expP0#[6Q#6R#G6S# 6T#$ibU0 #(obU0 #,x V0#0W#40 # U@}0#rex~~#wex~#rto~# wto~#cto~#l0#r#w# lr#$>0#(0#,0#0 0#4H~#8)' #< 7#@7#AW#D<#L #P 3 #T9 #X_ 21tstru#lenv~#p p 0 v ' p zm#Lm# L# ! #feQ#beQ#~# @~#$Z 0#(D#,req0 #0rep0 #4siw$#8 #"%#a#srv5#p5#Q 5#> $#txns# ~#"#$#3°$## w#w#,M$#0#_  - J ]s Tn  #!s # k auid ^&#gid _# `# bux a  ! Lfd M~# N~#h O~#-@ P#  Q # R~#$ S~#  T0# U # Vm#7* W #B XR#5' Y #` Z# [0# b # * c# T Qu m # n~#S o~# p~# q# r#  s~#$!6 t #(87 u #, v#0 w#4{ x#8@ y#<h zm#@e {~#H |m#L   ~~ ~ ~  ,CfA #bB0 #.(?cbC#{D# E7#evF7# G#H#I~#  J#$    JB:~#get~#put~#u~# )#U5$8len$90#cr$:0#$;0#b $Cv$D#B:$Ew#$Fw#I*$Gw#4$Hw# #    D #¬S#l#~#m_l#~#u#~#u_l#~# v#~#v_l#~##l#~#v_l#~#c#~#c_l#~# r#~#r_l#~##rq#st#SmD#P #0#col#0#sov#0#eoh#0# sol##eol##som#0# #~#sl##  #W#8cap#m#@#4##b#U# #6 #req##rsp##\uri## ####OJ#~#@#0#d) D##~#P# m#:X a^#_%#k`%#aue+,#-#.~#/#  2P #D#>>d2JW5(tD  # F#OF# ~# h~#r~#~#a#B: #,aclm#0m#8m#@m#H>m#P?X #Xsrv5#de ~#h? ~#lh !#pK#Z #~##~#0#~#g~#[# ~#R ~##~#~# #G #R~#7~#."##/~#m#5'"#id#,#m#t~#4 ~#~#0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0#F#zF# F# F# # ~# 8# ~# 0# j0#  1#  i#  i#  i#  i#  i#  i# ) i# i# Qi# ~#cap~# pa# g@a# ~# o# Q# m # u # Jp# p# ~# ~# ~#  ~# ~# g~#  ~# B ~# p !# "# #~# Z#~# $"# ]%"# &o# 'o# O(o# q)"# )"# *~# w +# ,~# -"# = .~# /~# 00# 10# F2# :2#H@G &0#f 0#0#p7 -@4un5J in6a)p2u7# 8!o;  m#!p #srv"5# 5A"J5# K~#* L~#M~# N~# O#B P#5(RQ#S~# T~#$5 T~#($U0#,6U0#0tV~#44 V~#8'W~#<Xm#@!YL#H-@[a#Lp\a#\g@^a#l`~#|oa# b#@d5#d5#e#o fa#wgw#h~#i~#;i~#2$j~# j~#Rj~#k~#l~#Fm~#ido#p0#b p0#q0#r0#us0#?t0#Vt0#guD# v;#hw5#yi#yi#jz0# {1#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U~#ox ,#t0#t1#:;#;#~# D~#$ ~#(: <#len0#pos0# sid0#srv5#oeQ#src#buf9 #X beQ u} !0#.m# srv # ~# ~#5 XactA#bckA#,!actƾ#bckǾ#!~#Q ~# ~#~# ~#~#8 ~# 5#map} # Ķ #,V #T !#8!#e:!#/!#!#!5!z" ~#4~#(:~#<~# A~#+~#\~#!~#.z"! " " "6 c#D ~#<# <# /<###  #$&P#(} P#,P#0i#4Qi#<#pxQ#sv5#w#Dw# @0# iid~#J~#sid~## "Θ#M$iid~#pxQ#buf0#sid0# ptr~#bol~#w$ (c# # # $ 8$p $$p $"$P=,~U#si+Q$$% %P%%R&"%yk~'j~(nowj~)F%=6*U#si5R)%>=D0U#siCQ#msgC%S*%%;q%%R$%q%%R% 6 +%a2(buf~0 )&j=UrU#siTS#msgT%Q*&&%&P*)&%,%*@&&#,&*z&&0E%&Q%&P$&?C%&P,'$'EG,'+&E+(buf0 +&j((buf0 &&g$W~(nowV~'5'V~&'#L~(nowK~'5'K~+)'6&(buf0 -[%6'e-J %6'-.vV',-w~ z'. -'Qi'-(;0- )Q0-)R0- )U0- )Vo-)W'D5+E0=y$ 07i  "02-y &ik 5int 60 >Em ?ER AE3 C D^7ro S UH  0oBTGQqFpz !D!E#!F#9 +-{5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,h#0 0,n#4 .,#8 X,#< ,#@ ,">#D ,#p#F H,$t#G b,(#H ,1#L ,7#T d,8#X ,:#\ ",<#` 7  ,h ,,h# ,n#B ,#1{  *  3 . #3#4#a#5##6# #7# X #8##9#!#:#N",!"-#+ ".#!"/#"0N#  $[ >   _# #   R _#J #t #  wtm,w/x# y#rz#z{# >|#R}#6~#j## #$#(2>40YG o b#_#ۦ#n ܼ#" # ,7 O bO# __ ,  4# _# _# bit#u32"0*+e#key,# n #p #7" - #ref !# H 0wq 1#rq 2# 3#0 4#4 50#8 6#< 7#@ 8#D7g]4w x$#y#z0#  {0#'|0#r}0#B:~0#@0# -0#$ug#( w E *8%J %K0#* %L0#{%M#fd%N# @%O0#exp%P0#[6%QW #6%RW #G6%SW # 6%TW #$ib%U #(ob%U #,x %V0#0%W#4Q Q wE  # %U@ }0#rex ~#wex #rto # wto #cto #l 0#r #w # lr #$> 0#( 0#, 0#0 0#4H #8) #< 7#@ 7#A W#D< Q #L Q #P  #T #X]  21 tstr u#len v#     p  z$#L$# $# !$x#fe$e #be$e #$# @$#$Z $0#(D$#,req$ #0rep$ #4si$m"#8 $#"%$#$#srv$#p$#Q $#> $}"#txn$[# $#$ #$"#3$¦"## $w#$w#,$C"#$0#   & #<&!# &"#&# #  ]( Tn  _#!( # 8 kk auid^1#gid_#`&#~ buxa8  !LfdM# N#hO#-@P#  Qr#R#$S# T0#Ux#V#7*W#BX#5'Y#`Z# [0#bk # *c#r TQum#n#So#p# q_# rT# s#$!6t#(87u#,v#0w#4{x#8@y#<hz#@e{#H|#L~ ~  rCfA#bB #\.(?cbC\#{D# E7#evF7# Gl#HT#I#  J#$ l j JB:#get#put#u# 0#r) D###P# #:b a^#_%#k`%#a/e+,#-#.#/# m bP ##C5)8len)90#cr):0#);0#b )Cv)D#B:)Ew#)Fw#I*)Gw#4)Hw# (    D (šA(l(#m_l(#u(#u_l(# v(#v_l(#(l(#v_l(#c(#c_l(# r(#r_l(#(rq(st(A[D(P (0#col(0#sov(0#eoh(0# sol(#eol(#som(0# (߉#sl(#  (W#8cap(N#@(4(#b(C# ( #req(#rsp(#\uri(# (#(#OJ(#@(0#0@G &0#f 0#0# ? AIJ# K#* L#M# N# O#B P#5(Re #S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X#@!Y#H-@[#Lp\#\g@^#l`#|oa# b#@d#d#e#o f#wgw#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# vk #hw#yi#yi#jz0# {<#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#?e 5(tDR x# #O# # h#r###B##,acl#0#8#@#H>#P? $#Xsrv#de #h? #lh γ$#pK#Z #҉##ԉ#0#։#g׉#[# ى#R ډ##܉#݉##G #R#7#.&##/##5'%#id#,##t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  <#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# g@# # o# e # m "# u "# Jp# p# # # #  # # g#  # B # p !# "# ## Z## $&# ]%&# &)# ')# O()# q)&# )&# *# w +# ,# -&# = .# /# 00# 10# F2o## :2o##H 4 ; '' #'! #srv'"# Y!D$ $#$G# $G# /$G#$#$#  $#$&$P#(} $P#,$P#0$i#4Q$i#<!$px$e #sv$#$w#D$w# @$0# iid$ˉ#J$ˉ#sid$ˉ#! $"$#C"$iid$щ#px$e #buf$0#sid$0# ptr$Չ#bol$։#m"$!($Y!!$!!$! }"w q " "" Q "J"p7!-@4jun5 in6"p2u7"#o#x ,4#t04#t14#:k #k ## D#$ #(#G#len0#pos0# sid0#srv#oee #src#buf # $bee !u0$ !0#.#c$ srvc$# # #$Xact"#bck"#,$act4#bck4#%#Q # ## ##8 # #map0$# i$#,VȎ$#T ɮ%#8ʮ%#e:ˮ%#/̮%#ͮ%#%%-& #4#(:#<# A#+#\#!#&.(7(#&)#*#+# ,+#7,#@-#-.'#/(# 0&#$-&"! & & & .' 1$1%#kw1&# 1-W'#W'Ne e .''1516#kw17'# '& '  '###'( (##G#'O(-SC-O#-P#h-Q# -R# ) -;uid-<#gid-=#->#$-?# ,-@# -A#!-B#a-C#-D# |-E#$ -F#(<-G#,-H#0-I#4,-I#8J-J#<-J#@-K#D-K#H-L#L -L#Pm -M"#Tu -M"#-S(# -T~ #Y-U##,p><U$?:Nl$=: $=:e $';e %err;$ ;&[*!'&>%'>%&+"(su?,P)@S**Ch'&`%'`%+Ch'`)`P**p'&d%'d%* +'&h%'h%*/+'&s%'s%&F+@")t,P*+'&\%'\%+'\)\P,+,/-,.-/---#--/-/p")L"i<-P*+p}'&%'%*,'&%'%&a,"'$.,-,.----#--/-,,,-,.----#--/-,,----#--/-/")5'0p(resP  0-n1m0<- -1+1x+N1,2z-=U%msgz-$B:  3.M>q{U4sp 4pxpe  4urip&R5repr d5svs`5svss\5msgt h&."6"#*.6(S7len+8&%8%+86P&.#6"E./H#68$0P&.`#6". /#68$0P . 3/=MU4sL V4repL  4uriL&W7pxNe 5msgO h5upP0S,|// -/,//-/./-/9/,:buf ;/=U:nTP2k0>> yU%s V%rep W%uri&8U4s7 S4rep7  =1=U4s W4rep  5msg ,0/-/*1O`8\&M1#5pn8> .1>1P*g1IT7__v>*17__v>/#8\;1e>[:tZ=2>U4s 4rep  ?25msg @&&2#5es3~,=2/-/&2$8^>6=~.3PV-&3-23->3-J3>V3~/0$Ab3~An3Q&2p$5pny35tm.3p>3~>3P./-/ 3 o#By3>PCoutNz-1B:NCerrO31/OCptrO7endQ7cR7 3 -D3"Cnow!3Ctm!3 <E >UF1*K33 >F*L33 ~F*M3F[+4pFJ +4F.v74FwF -\ h4G FQW4 4GFҍ4 u4?5(Oe F.;0Hnow.GF -XO(Hpid-ZFX-[F-^ F/F/F, 0F Q0FR0FSS0FaT0F U0F V)FW}56']'7H0?y$ !07i  "02-y &ik 27 5int 60 >Em ?ER AE3 C D^7ro S UH  0o BT G QqF> > @ 0z #D#E##F#9 +-/5 +- @,# !, # , # b , # ,# ,# A,# ,# z,# ,#$ ,#( + ,#, M,#0 0,#4 .,#8 X,#< ,#@ ,">#D ,#p#F H,$#G b,(#H ,1#L ,7$#T d,8$#X ,:#\ ",<#`5 7@ :$W c $ , ,,# ,#B ,#jc3$[> ##" YR#J#tY#iwy6 7# w8#Tn  #!#k 2> 40YG o b#Z##n #" Z#j7 b#j  r# # # bit#u32"0!*+#key,#FnF#pF#!u" - !#ref!F# H0wq1#rq2# 3#04#450#86#< 7$#@8#D u]4"w "xK#"y!#"z0#  "{0#'"|0#r"}0#B:"~0#@"0# -"0#$u"#( *8$J $K0#* $L0#{$M$#fd$N# @$O0#exp$P0#[6$Q#6$R#G6$S# 6$T#$ib$U #(ob$U #,x $V0#0$W$#4   # $U@}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$>0#(0#,0#0 0#4H#8) #< 7#@7#AW#D<#L #P  #T #X 21tstru#lenv# $  $ *  p z!#L!# # !>#fe6#be6## @#$Z 0#(D#,req #0rep #4si>!#8 "#"%"##srv#p#Q #> N!#txn,# #y#`!#3w!## Â#Ă#,!#0#    ]1 auid ^<#gid _&# `1#D bux a K ! Lfd M# N#h O#-@ P"#  Q8# R#$ S#  T0# U># V!#7* WT#B X#5' YZ#` Z$# [0# b1 # * c#8 T Qu m`# n#S o# p# q# r#  s#$!6 tT#(87 uT#, v#0 w#4{ x#8@ y#<h z!#@e {#H |!#LK D T Dp 8pCfAT#bB #".(?cbC"#{D$# E7#evF7# G2#H#I#  J#$2 JB:#get#put#u# #8 ) D###P# !#: - a ^$# _%#k `%# a}e+,}#-#.#/:# 8 -P F##  5'8len'90#cr':0#';0#_b 'Cv'D_#B:'E#'F#I*'G#4'H# &    D &e &l&#m_l&#u&#u_l&# v&#v_l&#c&l&#v_l&#c&#c_l&# r&#r_l&#&rq&st& &D&P &0#col&0#sov&0#eoh&0# sol&#eol&#som&0# &ߔ#sl&c#  &W#8cap&&#@&4&#b&# & #req&#rsp&#\uri&# &#&#OJ&#@&0#@G &0#f 0#0# AIJ# K#* L#M# N# O#B P#5(R6#S# T#$5 T#($U0#,6U0#0tV#44 V#8'W#<X!#@!Y#H-@[#Lp\#\g@^#l`#|oa# b#@d#d#e#o f#wg#h#i#;i#2$j# j#Rj#k#l#Fm#ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v<#hw#yi#yi#jz0# {G#}i#}i#~i#~i#i#.# 0#i# i#i#Qi#U#65(tDR ># #O# # h#r###B-'#,acl!#0!#8!#@!#H>!#P?K'#Xsrv#de #h? #lh '#pK#Z #Ҕ##Ԕ#0#֔#gה#[# ٔ#R ڔ##ܔ#ݔ#ގ#G #R#7#.s)##/#!#5'(#id#,#!#t#4 ##0#i0#0#0# #0#+# 0#i#i# i#$0#0#`0##z# # # # # 8# # 0# j0#  G#  i#  i#  i#  i#  i#  i# ) i# i# Qi# #cap# p# g@# # o# 6# m &# u &# Jp# p# # # #  # # g#  # B # p !}# "}# ## Z## $)# ]%)# &# '# O(# q))# ))# *# w +# ,# -)# = .# /# 00# 10# F2&# :2&#Hry; %% !#%!$ #srv%"# * D #h# h# /h###  #$&P#(} P#,P#0i#4Qi#< px6#sv#ɂ#Dɂ# @0# iid˔#J˔#sid˔# "L#!iidє#px6#buf0#sid0# ptrՔ#bol֔#>!!(* !ϡ !׸ N!B `! $ T! w! $ f!!&)dow)#h1)#m1)#h2) #m2)#"")min)i#max)i#%)˔#%)̔#G")-@)#O)#z")i)Ȕ!`)!!+%)""!&)}!")ptr)$str)reg)פ"- #%,))!#val)G"#ptr)z"#%)Q# len)ڔ#$@)۔#(B# )p)$i)ll)id)B#a)I#JY#$#r%0)i)#ptr)#len)#@)# ctx) ##$%)kw):# )1$# %)$# C)$# )0# &) #+$ E +$ Z"$`$ 6 $ $ `$ $f$$!C) )!!#kw)"5%#arg)%%# W&)&# %)'!#Y#7$$ $ +$$%_&) )!#kw)%#%# "5%)%#str)$#$%acl)* )+!# u),# ;D)-!# ).# )/0#;%%aD)> )?!# g)@!#pol)A# )B0# /)C#&p7!-@4un5in64&p2u7%#&x ,r#t0r#t1r#:<#<## D#$ #(-'h#len0#pos0# sid0#srv#oe6#src"#buf #K'be6!up' !0#.!#' srv'# # #'Xact4&#bck4&#,'actr#bckr#(#Q # ## ##8 # #mapp'# ĩ'#,V'#T (#8(#e:(#/(#(# ( (m) #4#(:#<# A#+#\#!#.m)! y)) ) %) 1$1%#kw1&:# 1- *# * & 6 6 )8*1516!#kw178*#G*) */SC/O#/P#h/Q# /R# , /;uid/<#gid/=#/>#$/?# ,/@# /A#!/B#a/C#/D# |/E#$ /F#(</G#,/H#0/I#4,/I#8J/J#</J#@/K#D/K#H/L#L /L#Pm /M&#Tu /M&#/SG*# /TD #Y/U#=,@($(%!#E(&)#('# f,d@ =? >#&? ?R#%,? F! G]!-@ H=,!@ I],? Bop D]#v Jf,#&.,?nU'fdmV(@mS(|?m.(v$m.)(@oX)2@pW*retqP)B@tt+-2,__s~$-~!~0!~>! ~7,__u~.,__c~w-F)Z@,H)_@,.$*__s$R-!0!>! 7,__u#.,__cw[--&.>U( !>V( ( /@G/X?*fdS*errd*msg:`0.1.2."T3fdS4/i?)U5 (8R6 !*>S7err+V8F/>;aU5 !:>Q8m/?IpU5 !H>Q9r0?h,U:sg$ V:reqg W6Jir0S6>jp;/x0 <0R<0Q=/$7retR;0010;(00<0P;?001000 101000 < 1P11,>0yk?j3nowj20E+3buf 20,)3buf >0g$W3nowV?5'V>"1#L3nowK?5'K43?0U5?&5= 5=65'6:err5 7ptr:l7val0p6s@Q+1O\@&%@%+2dq@&%@%=93$6h6=@d7polQ6E)S@Jr0+2@&%@%+2@&%@%=2$@&%@%.%@/6P+3@&%@%-H7acl%P6u:Q;P33%14;g3314;~33.14;33M_14;33<4P;3314;331403fx14> 4/3:?5(264~4?3U:px16:l41$ P:l71$:dir15;D2`$5v%2$R45>GU:pxE6:l4E$ P:l7E$:dirE5;DF`$5v%F$6Hp6T@HV6?HR6I/S/@/?.(%6gQ6;gl6 ?gh6>?gd6?g`AD?UB*L55 B*M5B[+5BJ +5B.v5Bw6CB-Q 6D5(O6B.;0Enow.;K  )?MK 6'*6%$@6L%0LAy$ $07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez 'D'E#'F#  n # p #e" - e# ref !#R]4&w &xR#&ye#&z0#  &{0#'&|0#r&}0#B:&~0#@&0# -&0#$u&X#( h ! %%#u%#Z%># len% ># \%!>#F%"#h2L40YG o b#$[L[ '#[# k R'#J#t#  w'##n #" # E 0Tn! ! '#!!0# @ k hp 7 -@ 42un 5in 6p 2 u 7@# b#   ### bit>#u32 "08 * +# key ,# H 0 wq 1# rq 2# 3>#0 4>#4 50#8 6#< 7#@ 8>#D8 a uid^&# gid_#`#  buxa !L fdM># N>#hO>#-@Pk#  Q #R>#$S># T0#U#Ve#7*W%#BX#5'Y+#`Z# [0#b# *c#  TQum1#n>#So>#p># q'# r# s>#$!6t%#(87u%#,vQ#0wQ#4{xQ#8@yQ#<hze#@e{>#H|e#L%>>> A Q> A,SC,O>#,P>#h,Q># ,R>#  ,; uid,<># gid,=>#,>>#$,?># ,,@># ,A>#!,B>#a,C>#,D># |,E>#$ ,F>#(<,G#,,H#0,I#4,,I#8J,J>#<,J>#@,K>#D,K>#H,L>#L ,L>#Pm ,Mh#Tu ,Mh#,SW# ,T#Y,U># *8(J (K0#* (L0#{(M# fd(N># @(O0# exp(P0#[6(Q #6(R #G6(S # 6(T #$ ib(UE #( ob(UE #,x (V0#0(W#4    E # (U@ }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) <#< E#@ E#A e#D< #L #P  #T #X t 21 t str u# len v>#  E  <p  z e#L e# # ! # fe # be # ># @ >#$Z 0#(D #, req E #0 rep E #4 si &#8 k#"% k# # srv !#p !#Q !#> '# txn # ># 4%# '#3 2'## Å# ą#, &# 0#t   ) >#<)!># )">#)## B ]5+8len+90#cr+:0#+;0#.b +C v+D.#B:+E#+F#I*+G#4+H# y*    D *4* l*># m_l*># u*># u_l*># v*># v_l*>#2* l*># v_l*># c*># c_l*># r*># r_l*># O*rq*st*D*P *0# col*0# sov*0# eoh*0# sol*# eol*# som*0# *># sl*2#  *e#8 cap*#@*4*y#b*# *K # req*O# rsp*O#\ uri*# *#*#OJ*>#@*0#) D##>#^# e#:+D##^ #a#^##_%#k#`%##a+e"+",#"-#".>#"/# i^P ##9 -- 5 --@.>#!. #. #b . #  .#.#A.# .#z.# .#$.#(+ .#,M.#00.#4..>#8X.>#<.#@."L#D .#~#FH.$#Gb.(#H.1#L.7#Td.8#X.:>#\".<#`. ..# .#B .>#     3/C fA%# bBE #.(? cbC#{D# EE# evFE# G#H#I>#  J#$  2 JB:># get># put>#u># #J&5(tD # #O# ># h>#r>#>##B"#, acle#0e#8e#@e#H>e#P?"#X srv!#de >#h? >#lh Ύ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#޿#G #R>#7>#.%##/>#e#5'$# id#,#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z#### >#8#>#0#j0#  1# w# w# w# w#  w# w#) w#w#Qw#>#cap>#p#g@#>#o# #m h#u h#J~#~#>#>#># ># >#g># >#B >#p !#"##>#Z#>#$#]%#&# '#O(#q)%# )%#*>#w +#,>#-$%#= .>#/># 00# 10#F2J"#:2J"#H@G &0#f 0#0#  ;  e#! # srv"!# !A"J!# K>#* L>#M># N># O#B P#5(R #S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H-@[#Lp\#\g@^#l`>#|oa# b#@d!#d!#e#o f#wg#h>#i>#;i>#2$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#gu# v!#hw!#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#J"x ,# t0# t1#:!#!#># D>#$ >#("<# len0# pos0# sid0# srv!# oe # srck# buf# "be  u # !0#.e#>#  srv>## ># >#!i#X act!# bck!#,# actƉ# bcklj#}$>#Q ># >#># >#>#8 ># !# map ## D##,Vi##T ɉ$#8ʉ$#e:ˉ$#/̉$#͉$#$!}$% >#4>#(:>#<># A>#+>#\>#!>#!.% $% 4%K %D  ># <# <# / <# 7# 7#  7#$& ^#(} ^#, ^#0 w#4Q w#<\& px # sv !# Ʌ#D Ʌ# @ 0# iid >#J ># sid >#s& " ΐ#& iid ># px # buf 0# sid 0# ptr ># bol ># & ( %  \& s& ' ' '2'  !'"m' AkU# V#!!S$Y(@/p. U%s. V&txn0Y(p&fe1 l'"2_(R''*2_(S('e()v(*(P+'&h^S,(@%-\l,%(X%-\r+>(&hXS.(*(P)(/(:R>0sR(0pR(((&/($0>1 />1>8/>2A>0 o U$)@p R U%s V'{AeQR3)@>`  U%s V%si S&reqE P&repE Q.)  ))))4p%5)P6)J^7tv1I)7tv2I)8retK^)<3*9A> &U%s S%si W(**  **P)*(6*e(  *v(V*(P(T*(  *(P)((t*e(q w *v(V*(P.(  *(P)(/*#L>0nowK>15'K>":+*AC08U9sB V9siB W:reqDE p:repEE S(!+:+Rm)G+)R+.:+)G+)R+;^+-0bufE 1B:>"-@l@U9sk V9sik S(+)))))4%5)P(+)Jb))))4%5)P,&,%<9w>P.-O)-.)- *6-Q)A-(O,)))))4%5)P(,-f)-.)-my*6-Q)A-(,e(*v(W*(P(,(*(P)((,)KQ))))4&5)P(,S-)`-.S-)`-;)-/(0s'!;M-%10ctr0M-0inc00;l-G&"0ctr!M-"-@U9s Q=2)9M%U9t8:s: V<>*;>p)>)>Z(',@.(&?@0.2BI)2,k.h&<@0R.28;)2(.2)2(.2,)2)2(.2,K*2R*2W.2Kg*2R*2W(.2)2*2S(/2)2)2(0/2)2)2(G/2o{)2(r/2)3* 3W4&53R(/2)3* 3W4&53R(/"3)03):3.)*)W))4&5)P(/F3 )S3(0F3)S3(%0_33=)l3+?0n?@0(V0_3 )l3(m0F3 ")S3(0e(*v(S*(P(0( *(P)((0x3  )3(03!!*3P*3Q(13 !7!*3P*3Q("13?!V!*3P*3Q(1x3V!!)3(X13`!w!*3P*3W(x13|!!*3P*3W.3!!*3P*3W,1&:len1>P(1)@"x"))))@@"x"5)P(23"")3.3"")3(.23"")3.4"")4(m2'4"-#)84.B4"-#)S4.4" #*4P(2]4-#O#)j4@<$$8len>;26&0bufE ;2N*u0buftE /2V#u>0t1t>0t2t>;"3{(c0bufbE 1{Ab0-P(d0AF3@ 7s  7si  ;_3(0bufE ;x3j(0bufE ;3(M0bLE /3yk>1j>0nowj>/3"0t/3 ~0t}/4 v0tu;!4 ]1 \!4/B40t/]40t;t40t"4z@P%%U9s Q9si PP:err>S:fin>RBZ %%B ,XB y>B,^BB[-5BJ -5B.v>5/Bw> b5C B/QQ5B;0Dnow<<B $B0#Ej (@ E, )e@ B1>B Q0BR0B U0B VBW!4=>P\&%0fAyd58len9d#cr:d#;d#7b CvD#B:E#F#I*G#4H# % 3ZA3%\&U len3 cr3 :W 23 e%V new3Q intk&Qt+`&0Ay7i "%2-y&^kint6%>:m?:RA:3CDS7roS UH % 9z DE#F#J7 [JG[# k9 AJDoBTGQ[ 3   # #   R #J z#t # " w( 234%Y-G 8to bN#ڗ#C#n Y#" # , 9 -g5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .s#8 Xs#< #@ "3#D #e#F H$#G b(#H 1#L 7#T d8#X :s#\ "<#` # #B s#t  m  3 b#  `  # # # bits#u32"%*+#key,`#n#p#: H0wq1k#rq2k# 3s#04s#45%#86P#< 7#@8s#DJJJ:]4w xg#y#z%#  {%#'|%#r}%#B:~%#@%# -%#$u#(  *8J K%#* L%#{M#fdNs# @O%#expP%#[6Q#6R#G6S# 6T#$ibU. #(obU. #,x V%#0W#4. # U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) Q #< ,#@ ,#A L#D< #L #P  ] #T c #XE E . K p 4  W t ] Tn  #! # k auid^#gid_v#`# buxa  !LfdMs# Ns#hOs#-@P#  Q #Rs#$Ss# T%#U #V#7*W #BXP#5'Y #`Z# [%#b # *c# TQum #ns#Sos#ps# q# r# ss#$!6t #(87u #,v/ #0w/ #4{x/ #8@y/ #<hz#@e{s#H|#L   ss s  / s  V CfA #bB. # .(?cbC #{D# E,#evF,# G #H#Is#  J #$ 5    C<_``#Aa #setb #clrc # WBd #Ae #remf #clog #66h# :i1#$XCjC#(v%k1#,Hl1#0um"#4ns#8 s s s    s 1s!C7qp7-@4un5t in6tp2u7I# SCOs#Ps#hQs# Rs# I ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4,I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm Mq#Tu Mq#S# T #YUs#A's`&&Ufd& Rdir&sQf&& (PA,s&&Ufd+ Pdir+sRB2s&&Ufd1 Pdir1sRTRB8s&'Ufd7 Rdir7sP!ret9sP&& :PAAs'@'Ufd@ Pdir@sR!retBsP"' CP#AJ@'d'UfdIsP#ASp'*UpRexpRsR OJTsS!fdUsW!iUsQ Vh AWsd FBXsV AXsS!fdsYs` Z_$ )) P$!)-) P%T)f)&&'f)h)&&(yks)js*nowjs(+l's*nows*expsBs**UpV+B*+A*+&B*+A* tAsS#A*,+UpSAs0+:+Up#0B@++U!pR,[,J ,brs 2 ,}t",.vLV ,ws p- , Q_,;%, X,s, Q%,R%, U%, VV,Wk  k B   =B &>S-+0ByintCBC#SZS72fB,hB0a$ !Ղ7i "-y&k6>m?RA3CD roS UH   S _ %qF p oBTGQz #D#E##F*#24YG o b#$@[E #E#US R#J#t#Sw##n #" #S9 -5 -@%#! # #b  #  ##A# #z# #$#(+ #,M#00#4.%#8X%#<#@"#D ##FH$#Gb(#H15#L7K#Td8K#X:%#\"<#` K # #B %#  S S3( b(#88S   #8#8# bit%#u32"*+>#key,# n #p # " - #ref !# H 0wq 1#rq 2# 3%#0 4%#4 5#8 6#< 7K#@ 8%#D   @]4"w "x#"y#"z#  "{#'"|#r"}#B:"~#@"# -"#$u"@#(PS *8 J K#* L#{ MK#fd N%# @ O#exp P#[6 Q0#6 R0#G6 S0# 6 T0#$ib U #(ob U #,x V#0 WK#4 * * P  #  U@ }#rex ~%#wex %#rto %# wto %#cto %#l #r #w # lr #$> #( #, #0 #4H %#8) v #< #@ #A #D< *#L *#P  #T #X 6 21 tstr u#len v%#    v p  z #L # # ! #fe o#be o# %# @ %#$Z #(D #,req  #0rep  #4si w!#8 U#"% U# #srv #p #Q #> !#txn e# %# # !#3 °!## # #, M!# ق#    |  S] Tn  #! # Sk auid^#gid_u#`# buxa  !LfdM%# N%#hO%#-@PU#  Q #R%#$S%# T#U#V#7*W(#BX#5'Y.#`ZK# [#b # *c#  TQum4#n%#So%#p%# q# r# s%#$!6t(#(87u(#,vT#0wT#4{xT#8@yT#<hz#@e{%#H|#L   (% %  %DST%  D{CfA(#bB #.(?cbC#{DK# E#evF# G#H#I%#  J_#$ZS _ JB:%#get%#put%#u%# :#  B %#BM#p7-@4un5 in6p2u7#") D##%#Z# #: f a ^K# _w#k `w# a3e+,#-#.%#/j# q  fP ##   " G5&8len&9#cr&:#&;#b &Cv&D#B:&E#&F#I*&G#4&H# %           D %žE%l%%#m_l%%#u%%#u_l%%# v%%#v_l%%#%l%%#v_l%%#c%%#c_l%%# r%%#r_l%%#%rq%st%E_D%P %ق#col%ڂ#sov%ڂ#eoh%ۂ# sol%#eol%#som%ނ# %%#sl%#  %#8cap%_#@ %4%#b%G# % #req%#rsp%#\uri%# %#%#OJ%%#@%#:@G &#f ##I!SAIJ# K%#* L%#M%# N%# O#B P#5(Ro#S%# T%#$5 T%#($U#,6U#0tV%#44 V%#8'W%#<X#@!Y#H-@[#Lp\#\g@^#l`%#|oa# b_#@d#d#e#o f#wg#h%#i%#;i%#2$j%# j%#Rj%#k%#l%#Fm%#ido#p#b p#q#r#us#?t#Vt#gu# vu#hw#y#y#jz# {_#}#}#~#~##.# ## ##Q#U%# Io5(tDR # #O# %# h%#r%#%##B"#,acl#0#8#@#H>#P?"#Xsrv#de %#h? %#lh |##pK#Z #%##%#Ղ#%#g%#[# %#R %##%#%##G #R%#7%#.$##/%##5'}$#id#,##t%#4 %#%##i### ##+# ### #$##`##z#### %#8#%##j#  _# # # # #  # #) ##Q#%#cap%#p#g@#%#o#o#m #u #J##%#%#%# %# %#g%# %#B %#p !#"##%#Z#%#$%#]%%#&-# '-#O(-#q)%# )%#*%#w +#,%#-%#= .%#/%# 0# 1#F28"#:28"#H   ; $$ #$! #srv$"# c D  %# # # / # # #  #$& Z#(} Z#, Z#0 #4Q #<  px o#sv # #D # @ ʂ# iid %#J %#sid %# " #M! iid %#px o#buf ӂ#sid Ԃ# ptr %#bol %#w! ( c   !PS { ! ! ! * !J8"x , #t0 #t1 #:u#u#%# D%#$ %#("#len#pos# sid#srv#oeo#srcU#buf #"beou" !#.#,# srv,## %# %# W#Xact½!#bcký!#,|#act #bck #k$%#Q %# %#%# %#%#8 %# #map"# 2##,VW##T w$#8w$#e:w$#/w$#w$# w$  k$$ %#4%#(:%#<%# A%#+%#\%#!%#. $!  %%S .% S"s%B +,U#]%++$__s"K%+,$__s#K&%B( ,,U'sig'%S&%BB,4-U'sigA%P(BAMR"&qB]@--U)sig^%R*B^%V*,_&P*^B`l~ e+[*& +J *&+L*&+.vW& {+w%{&,S+'Qj&-%D &eS-B&D &%S-B&@ -BlL <U?D-0nCy$ 07i "02-y&ik5int60>Em?ERAE3CD^7roS UH 09 %-&5 %-@&#!& #& #b & #  &#&#A&# &#z&# &#$&#(+ &#,M&+#00&1#4.&#8X&#<&#@&">#D &#p#FH&$7#Gb&(G#H&1#L&7#Td&8#X&:#\"&<M#` 7    &+ & &+#  &1# B &#&G]3 n #p #]"  - ]#ref !#qFo BT G Qz D E# F#2>40YG Mo  b'#$[>  X# #  RX# J# t#w( X# # n 2# " (#87 [  b [#kk8   @# k# k# bit #u32 "0 *  +q#key ,#j H 0wq 1#rq 2# 3#0  4#4  50#8  6#< 7#@  8#Dzz zj]4w x# y]# z0# {0# '|0# r}0# B:~0# @0# -0#$ u#(/ *8J K0# * L0# {M#fdN# @O0#expP0# [6Q# 6R# G6S# 6T#$ibU^ #(obU^ #, x V0#0 W#4  /^ # U @}0#rex~#wex#rto# wto#cto#l0#r#w# lr#$ >0#( 0#, 0#0 0#4 H#8 )U #< 7#@ 7#A W#D < #L  #P a #T g #X 21tstru#lenv#  ^  U p z ]# L]# z# ! #fe%#be%# # @#$ Z 0#( D#,req^ #0rep^ #4si-!#8 # "%# #srv# p# Q # > =!#txnR# # h# O!# 3f!# # w# w# ,!# 0#  [ x ] Tn  X# ! # k auid^#gid_# `# buxa  !LfdM# N# hO# -@P# Q # R# $S# T0# U # V]# 7*W# BX# 5'Y # `Z# [0# b # *c# TQ um# n# So# p# qX# rM# s#$ !6t#( 87u#, v3#0 w3#4 {x3#8 @y3#< hz]#@ e{#H |]#L    #3 #ZCfA#bB^ #.(?cbC# {D# E7#evF7# G# HM# I# J>#$9c> J B:#get#put# u# #)  D# # # P# ]#:D a ^# _%# k`%#a+e+ ,+# -1# .# /# 7 eP # w# q qe@G  &0# f 0# 0#p7-@4cun5x in6p2u7#45"8len"90#cr":0#";0#b "Cv"D# B:"Ew# "Fw# I*"Gw# 4"Hw# !           D !‹2!l!#m_l!#u!#u_l!# v!#v_l!#!l!#v_l!#c!#c_l!# r!#r_l!#!rq!st!2LD! P !0#col!0#sov!0#eoh!0# sol!#eol!#som!0#  !߉#sl!# !W#8cap!L#@! 4!# b!4# !d #req!#rsp!#\uri!# !# !# OJ!# @!0#!AI J# K# * L# M# N# O# B P# 5(R%# S# T#$ 5 T#( $U0#, 6U0#0 tV#4 4 V#8 'W#< X]#@ !Yz#H -@[#L p\#\ g@^#l `#| oa# b># @d# d# e# o f# wgw# h# i# ;i# 2$j# j# Rj# k# l# Fm#ido# p0# b p0# q0# r0# us0# ?t0# Vt0# gu# v+# hw# yi# yi# jz0# {# }i# }i# ~i# ~i# i# .}# 0# i# i# i# Qi# U#%5(tDR  # 2# O2# # h# r# # # Be"#,acl]#0 ]#8 ]#@ ]#H >]#P ?"#Xsrv#d e #h ? #l h +##p K# Z # ҉# # ԉ# 0# ։# g׉# [# ى# R ډ# # ܉# ݉# <# G # R# 7# .$# # /# ]# 5',$#id# ,# ]# t# 4 # # 0# i0# 0# 0# }# 0# +}# 0# i# i# i# $0# 0# `0# 2# z2#2#2## #8##0#j0#  # i# i# i# i#  i# i#) i#i#Qi##cap#p#g@##o#%#m #u #Jp#p#### # #g# #B #p !+#"+###Z##$$#]%$#&# '#O(#q)$# )$#*#w +#,#-$#= .#/# 00# 10#F2!#:2!#H@h;    ]#  ! #srv "#  D # # # /# # #  #$ &P#( } P#, P#0 i#4 Qi#< px%#sv# w# Dw# @0# iidˉ# Jˉ#sidˉ#  "Έ#!iidщ#px%#buf0#sid0# ptrՉ#bol։#-!( ϐ ק =!/1 O! C! f! U!!x , @#t0@#t1@# :+# +# # D#$ #(e" #len0#pos0# sid0#srv#oe%#src#bufg #"be%u"  !0# .]#" srv"# # ##Xactl!#bckl!#,+#act@#bck@#$ # Q # # # # # 8 # #map"# "#, V## T &$# 8&$# e:&$# /&$# &$# &$ $$  # 4# (:# <# A# +# \# !#.$! $$ $d 6%aD7#?]#g#@]#pol#A##B0#/#C#$%&#dow##h1##m1##h2# #m2##%#min#i#max#i#%#ˉ#%#̉#&# -@#2# O#2#9&#i#ȉ`#͚%+%#%&#<%c&#ptr#str#reg#c&&%,# #]#val#&#ptr#9&# %## len#ډ#$ @#ۉ#(' #p#i#ll#id#'a#'J'i'r%0#i##ptr##len## @## ctx#&#'%#kw## #'#%#(#C#(# #0#&# #'  ' i&'( %  ( }(%(}(!C##!]#kw#"(#arg#%(# W&#&#%#']#''( }( '((_&##]#kw#(#(i'!"(#%#str#$i'$S)acl#*#+]#u#,#;D#-]#  #.##/0#)E#3#4]#acl#5)#neg#6# ()wD#9#:]#xC#;]#%))u'#;D()#)&c*'E<--U'px:%'l4:  'l7:'dir:(;D;((v%;}(P&*fFG.0.U'pxE%'l4E  'l7E'dirE(;DF((v%F}(P&9+CT0.F.U'pxR%'l4R  'l7R'dirR(;DS((v%S}(P)+E`P.Z.U( _(PF_' (1_ )+0Cg`.j.U'pxe%'l4e  'l7e'dire(;Df((v%f}()$,Dmp.w.U(v%l}((PFl' )e,yFt..U(v%s}(S(PFs'Q*3u),E./U(v%}(V(PF'P+ DS,ret-A//+DS) - F/0U(v%}(S(PF'Q*3)L-D0u0U(v%}(P(PF'V*3)-D0@1U(v%}(S(PF' *3ɉ.endW.cS/-('+*ԉR-00**ԉ&.F@12U(v%}(W(PF'R(+s+~Cl+3h.cW.endd.psV.plS/w.@'0* 1X'2* P3.C22U4v%}(P4PF'R3.@D(22U4v%'}(P4PF''R39/XF.2M3U4v%-}(4PF-' 3~/jD6P3y3U4v%5}(R4PF5'Q5s7~/R23/DD33U4 CS4PFC'W41C 6lenE7/NDP33U8ptrP3c0CW344U4 VP4PFV'V41V 2Xc&S23YP3S2Ew@4t6U4 vV4PFv' 41v 5ixiVW5jy0Q2I*y0p2B y0l5ptrzS9>1440&~%0~%-440~2~P91440&%0%-4402P/1p'0&%0%1'02P/ 2'0&%0%1'02P-#5;50&%0%-#5;502P3?4D69U4 V4PF' 41 5iih5j0V2I*0d2B 0`5ptrW9*3660&%0%-6602P9t3660&%0%-6602P/3'0&%0%1'02P/3(0&%0%1(02P-^7v70&%0%-^7v702P34BC!99U4  P4PF 'P41  :4BE-99U8kwl,4P(:4E5::U8kwl44P10(0\63V5]C>) :`:U4u=W4b=V5acl?)S-3:B:0&A%0A%356EK(`: ;U8kwJ0\L2DMP5kwlN4W75KF_;\;U8pat^'S;$68Fs(`;;U4;Dr(W<$6k;;=26-n;;>>6P>J6V?W6Cl@bk6patm'6tmpm'387D(;}=U4?VAD;A2D@=AGF5=2;D(\2C(X2PF'S21`2CW5argT/7H(6end0E-<#=5retR37C)==U8acl)2;D(S2*C(V-==0\38E)=?U4?V4oEWAD >AC>AEw>20F)R2!C(S2uV38ED)?@U4DCW4oEC ADl@ACi?AEg?20FF)R2!CG(S2uHV2\IV-0?B?0&L%0L%3:9[Dr6% @@U4Eq6%2iEs:9W2Es:9p2XCt@9P2Ft@9S)S)3_:yE6%@DBU4?4oE 8polPADAA`EAAOC6B5arg`5negW2!FV20F)\2D@9S2E:9X2E6%T-GA_A0&%0%-GA_A02P3o;EPBCU4E6%P8px% 8l4 8l78dirAE8B2iE:92XC@92;D(S5acl)P2PF'W2v%'2XE2&F2C-BB6__s 3;Ca)C+DU4E`6%P4C`0V2iEb:9S2XCc@9R5acld)PBC0D?DUC1$K;; >C$L << ~C$M <C[%/<CJ %/<C.vO<ZCws<DC'Qb<<< 0EC<@ <+C/(<< )F!D)<} <2%v(x'9YPG@D0Fy$ 07inti "02-y&wk60>Sm?SRAS3C7Dl7roS7 U7H 0oBTGQqFez  D E# F# n# p#e" - e# ref!#R]4w xR#ye#z0#  {0#'|0#r}0#B:~0#@0# -0#$uX#( h n 2L40YsG ~o b#$[L ##  @R#J#t@# P w#ۉ#n ܟ#" # E 9 -C5 - @># ! #  # b  # # # A# # z# #$ #( + #, M#0 0#4 .>#8 X>#< #@ "L#D #~#F H$#G b(#H 1#L 7#T d8#X :>#\ "<#` # #B >#J  C  3   b #  6    #  #  # bit >#u32 "0j * +# key ,6# H 0 wq 1A# rq 2A# 3>#0 4>#4 50#8 6#< 7#@ 8>#Dj*8J K0#* L0#{M# fdN># @O0# expP0#[6Q#6R#G6S# 6T#$ ibU0 #( obU0 #,x V0#0W#40 # U@ }0# rex ~># wex ># rto ># wto ># cto ># l 0# r # w # lr #$> 0#( 0#, 0#0 0#4H >#8) ' #< E#@ E#A e#D< #L #P  3 #T 9 #X_ 21 t str u# len v>#p p 0 v ' p  z e#L e# # ! # fe # be # ># @ >#$Z 0#(D #, req 0 #0 rep 0 #4 si #8 #"% # P# srv #p #Q #> !# txn # ># :# !!#3 8!## Å# ą#, # 0#_  - J ]s Tn  #!s # k a uid^&# gid_#`# buxa  !L fdM># N>#hO>#-@P #  Q #R>#$S># T0#U #Ve#7*W #BX#5'Y #`Z# [0#b # *c# TQum #n>#So>#p># q# r# s>#$!6t #(87u #,v#0w#4{x#8@y#<hze#@e{>#H|e#L   >> > >  ,C fA # bB0 #.(? cbC#{D# EE# evFE# G#H#I>#  J#$    JB:># get># put>#u># #>p7-@4un5J in6PWp2 u7#) D##>#^# e#:W a^#_%#k`%#a>e+,>#-D#.>#/h# J xP ##x5#8len#90#cr#:0##;0# b #C v#D #B:#E##F#I*#G#4#H# k"           D "&" l"># m_l"># u"># u_l"># v"># v_l">#$" l"># v_l"># c"># c_l"># r"># r_l">#A"rq"vst"D"P "0# col"0# sov"0# eoh"0# sol"# eol"# som"0# "># sl"$#  "e#8 cap"#@"4"k#b"# "6 # req"A# rsp"A#\ uri"# "#"#OJ">#@"0#@G &0#f 0#0# s!AIJ# K>#* L>#M># N># O#B P#5(R#S># T>#$5 T>#($U0#,6U0#0tV>#44 V>#8'W>#<Xe#@!Y#H-@[P#Lp\P#\g@^P#l`>#|oa# b#@d#d#e#o fP#wg#h>#i>#;i>#2$j># j>#Rj>#k>#l>#Fm># ido#p0#b p0#q0#r0#us0#?t0#Vt0#guA# v#hw#yw#yw#jz0# {1#}w#}w#~w#~w#w#.# 0#w# w#w#Qw#U>#5(tDR  # #O# ># h>#r>#>#P#B>"#, acle#0e#8e#@e#H>e#P?\"#X srv#de >#h? >#lh ##pK#Z #>##>#0#>#g>#[# >#R >##>#>#O#G #R>#7>#.$##/>#e#5'$# id#,#e#t>#4 >#>#0#i0#0#0# #0#+# 0#w#w# w#$0#0#`0##z# # # # ># 8# ># 0# j0#  1#  w#  w#  w#  w#  w#  w# ) w# w# Qw# >#cap># pP# g@P# ># o# # m ># u ># J~# ~# ># ># >#  ># ># g>#  ># B ># p !># "># #># Z#># $$# ]%$# &# '# O(# q)$# )$# *># w +# ,># -$# = .># /># 00# 10# F2!# :2!#H:; !! e#!!p # srv!"# D  ># <# <# / <# 7# 7#  7#$& ^#(} ^#, ^#0 w#4Q w#<b  px # sv ȗ# Ʌ#D Ʌ# @ 0# iid >#J ># sid >#y " ΐ#  iid ># px # buf 0# sid 0# ptr ># bol >#  (  b  y ! !!p !8!p '!J!x ,# t0# t1#:##># D>#$ >#(>"<# len0# pos0# sid0# srv# oe# src # buf9 #\"beu" !0#.e#"  srv"# ># >#"X actE!# bckE!#,# actƻ# bckǻ##>#Q ># >#># >#>#8 ># # map"# ĺ"#,V"#T ##8##e:##/######~$ >#4>#(:>#<># A>#+>#\>#!>#.~$! $ $ $6 "-%F@DDU#u#B:0V#@0$FS$IR$m+W%O 0&%FDEU$F> $IS'outE(`($0R$V"%FUEEU#FTS)retVP*&FjE$FU#FiV$0kP$kS"<&F0FFU#FS(x(%\*&FFPGU$IS$ ^V$^W$F>p+[&+J &+L&+.v&,+w> &, +$Q&$Fev[CHPG0Gy7i 2-y&Skint3CzDH7roSz UzH %z  D E# F# $[ 36   # 6# F 9 -Q5 - @h# ! #  # b  # # # A# # z# #$ #( + #, M"#0 0(#4 .h#8 Xh#< o#@ "3#D #Z#F H$.#G b(>#H 1#L 7#T d8#X :h#\ "<D#` " "# (#B h#Q >  T 3"*8J K%#* L%#{M# fdNh# @O%# expP%#[6Q4#6R4#G6S4# 6T4#$ ibU#( obU#,x V%#0W#4..T"# U@ }%# rex ~h# wex h# rto h# wto h# cto h# l %# r # w # lr #$> %#( %#, %#0 %#4H h#8) #< ,#@ ,#A A#D< .#L .#P  #T #X:p   ]hhC fA# bB#{.(? cbC{#{D# E,# evF,# G#H#Ih#  J#$    @G &%#f %#%#<;G %PGGUctr<R!%V6G!%Qage"%PBGGT^i)G=%a<%b<%F:%GGUctr9<S1G9%Vv9%;%Q6G;%Rage<%PBGGT^{ GX%GCHUctrW<S1GW% vW%Y%Q6GY%RHZ%ageZ%PBHHT^[FJ .vwh  Q :%!now <b]& IPH0}Gy7inti 2-k7r b#k y  # # # bit3# GPHIU W Z[HH(HR hHjH hHjH+7 T|HHf HH+7 sHH THHf HH+7 'sHH @THHfQsHH vsHHsII GGnG%mG%G%GG G DtGLGDtagO Jy3sG3LGRG tagO GIIUsubnewV ~IqIW(R&2 .sI"IC0IAICP ZMIPI+ qsPISI(Q TyI|IfR II+7 sIIsII_GsubnewbIGdG_G_[G_ PI*!oG3 W^q UNI0Gy7inti 2-k7r b#k y  # # # bit3# u32"% s32#3 ;* +#key,#oGoIKU unewo .{IdJp(VlShTJ Jf)&2JJAJGJRJVJP_ )JJJJ?  NGo unewooldooG%LGBH^H dGG [G H! dGF GF [GG 9HG!"ret]N #tGu$LG%tag &y&3#RG$ %tag &#XH 3%x 3"r 3#KHoK~LU unewo #KK5pAq8)MVYleSqh}dTuKxKf`)KKKKKKP)KK2L>L#IHo$ u%newo"oldo oG% LG BH3 ^H dG G [G H! dG G [G 9H!"retN~H#oLLU "uPx"Vj~LL')SPRTLLfH{o zuxz|oLG}y~HH(oMMU 'uPx'V4HM MYd')mSxPWRT M&MfHo uxoLGkeyy3*H1oMUNU 0uPx0W2o(LG3VTMMf3NNAPM3>NKNAPM)N$m+$oG%#`N`N0iHy7i 2-y&Sk2,int3CDH7rH %>3 @%9 -w5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Xs#<z#@"3#D #Z#FH$#Gb(#H1#L7#Td8#X:s#\"<#`   #  # B s#~  w  3 $[ 3&   # &# 6 4%G 6go  bA#5*8 J K%# * L%# { M# fd Ns# @ O%# exp P%# [6 QG# 6 RG# G6 SG# 6 TG#$ ib U#( ob U#, x V%#0  W#4AAg5#  U @ }%# rex ~s# wex s# rto s# wto s# cto s# l %# r # w # lr #$ > %#(  %#,  %#0 %#4 H s#8 ) #< ,#@  ,#A A#D < A#L A#P  #T #XMp   ]ss C f A# b B#.( ? cb C# { D# E,# ev F,# G#  H#  Is# J#$   d@= ?>L# &??#?FG-@H@I-? B opD# vJ#xH"s`NNUZ@#Xfd$sSret$sV*__s&W&&%&3 &,__u&__c&a[J . v ws  Q!bLSN0Hy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % 0H"fd#s# I$l# H%l#J7 RJ GR# b0 AJ;oBTGQ[ 3   # #    R # J z# t #  w 234%Y$G /ko  bE# ڎ# :# n P# " # , 9 -^5 -@s#! # #b  #  ##A# #z# #$#(+ #,M#00#4.s#8Xs#<#@"3#D #e#FH$#Gb(#H1#L7#Td8#X:s#\"<#`  #  # B s#k  d  3 b#  W ### bits#u32"%* + #key,W#n#p#1 H0wq1b#rq2b# 3s#0 4s#4 5%#8 6G#< 7#@ 8s#DAAA1]4w x^# y# z%# {%# '|%# r}%# B:~%# @%# -%#$ u#(  *8J K%# * L%# {M#fdNs# @O%#expP%# [6Q# 6R# G6S# 6T#$ibU% #(obU% #, x V%#0 W#4% # U @}%#rex~s#wexs#rtos# wtos#ctos#l%#r#w# lr#$ >%#( %#, %#0 %#4 Hs#8 )H #< ,#@ ,#A L#D <#L #P T #T Z #X< < % B p +  N k ] Tn  # ! # k auid^#gid_m# `x# buxa  !LfdMs# Ns# hOs# -@P# Q # Rs# $Ss# T%# U # V# 7*W # BXG# 5'Y # `Z# [%# b # *c# TQ um # ns# Sos# ps# q# r# ss#$ !6t #( 87u #, v& #0 w& #4 {x& #8 @y& #< hz#@ e{s#H |#L   ss s  & s  M CfA #bB% # .(?cbC # {D# E,#evF,# G # H# Is# J #$ ,    C<_ ``# Aa #setb #clrc # WBd # Ae #remf #clog # 66h# :i(#$ XCj:#( v%k(#, Hl(#0 um#4 ns#8 s s s      s  (s : .hp7-@4un5k in6kp2u7@# S COs# Ps# hQs# Rs# @ ;uids# $?s# ,@s#  As# !Bs# aCs# Ds# |Es#$ Fs#( <G#, H#0 I#4 ,I#8 JJs#< Js#@ Ks#D Ks#H Ls#L  Ls#P m Mh#T u Mh# S# T # YUs#A*sNOUfd) Rdir)sQNO +PA/s O@OUfd. Pdir.sRB5s@O`OUfd4 Pdir4sRKRB;s`OOUfd: Rdir:sP!retTd[S0Iy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Xs#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#B:~%#@%# -%#$u~#(  \*8 J K%#* L%#{ M#fd Ns# @ O%#exp P%#[6 Qn#6 Rn#G6 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#-@P_#  Qv #Rs#$Ss# T%#U| #V##7*W #BX#5'Y #`Z# [%#bo # *c#v TQum #ns#Sos#ps# q# r# ss#$!6t #(87u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a C<_``#Aa{ #setb{ #clrc{ # WBd{ #Ae{ #remf #clog #66h # :i #$XCj #(v%k #,Hl #0um#4ns#8v sv s sa  v    s   s     p7-@4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4,I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7I8#>#coI*5+%#fd,%#H"sSTU B:"sS!*"SAUs TBTU"fdTv Q"dirTs #f=IgPT5UU$ofsh!WIisQ!5jsS!jsR%chgksp%fdksW&fTU'wS(('V)TU*S+vI#s,#I#s-op#s-fd#s,I#.*# /I@UUU"fdv Q ^IsS%ptrR5SAsUUU"fdv p"dirs %ofsV!IS!^IRBsU8VU"fdv p"dirs %ofsV!IS!^IR/A@VVU"fdsW%ofsļS!^IżR/NIVVU"fdsV%ptrP/AVXU"p "expsS.OJs%fdsd! sp!Hsl0.WZW'S' Q(("):WZW*-W09XX(J(U&aXX(r(}+9H$s,#I$s,I$,I$s,5'$s.*$+ayks,js-nowjs+l's-nows-exps1BsXYU2p V3I7Y3I9Y32I;Y3H=Y3I@Y4tAsS5AJYZU2pI S1UAesZZU2pd 6fdfsP1~HvsZZU2pu 50B[[U6p R7[X7J 7brs  7}t7.v 7ws 8 7Q 7;%7 XZ7s7 Q%7R%7 U%7 V7W!(I/s4 !I00 !I1, ! B;8 !I>< !fI?s@ %evD D  0s !Ic 3Cg!f[0Iy7i "%2-y&^kint6%>:m?:RA:3CDS7rH % oBTGQ[ 3O   # O# _  R #J z#t #  w 234%H;LYG o b#H##n #" H# X, 9 -c5 - @s# ! #  # b  # # # A# # z# #$ #( + #, M:#0 0@#4 .s#8 Xs#< #@ "3#D #e#F H$F#G b(V#H 1#L 7#T d8#X :s#\ "<\#` : :# @#B s#c V  l 3 b#  l  t# # # bits#u32"%#*+#key,#HnH#pH## H0wq1#rq2# 3s#04s#45%#86#< 7#@8s#DN~]4w x#y##z%#  {%#'|%#r}%#B:~%#@%# -%#$u~#(  \*8 J K%#* L%#{ M#fd Ns# @ O%#exp P%#[6 Qn#6 Rn#G6 Sn# 6 Tn#$ib U#(ob U#,x V%#0 W#4hh\#  U@ }%#rex ~s#wex s#rto s# wto s#cto s#l %#r #w # lr #$> %#( %#, %#0 %#4H s#8) #< ,#@ ,#A L#D< h#L h#P  #T #Xtp    ], Tn  #!, # < ko auid^#gid_#`# buxa<  !LfdMs# Ns#hOs#-@P_#  Qv #Rs#$Ss# T%#U| #V##7*W #BX#5'Y #`Z# [%#bo # *c#v TQum #ns#Sos#ps# q# r# ss#$!6t #(87u #,v #0w #4{x #8@y #<hz##@e{s#H|##L   ss s  sv   CfA #bB#` .(?cbC` #{D# E,#evF,# Gp #H#Is#  J| #$ p & v a C<_``#Aa{ #setb{ #clrc{ # WBd{ #Ae{ #remf #clog #66h # :i #$XCj #(v%k #,Hl #0um#4ns#8v sv s sa  v    s   s     p7-@4&un5 in6p2u7 #ZSCOs#Ps#hQs# Rs#  ;uids#$?s# ,@s# As#!Bs#aCs#Ds# |Es#$ Fs#(<G#,H#0I#4,I#8JJs#<Js#@Ks#DKs#HLs#L Ls#Pm M#Tu M#S# T #YUs# >ptr:fd;su32<u64=5H 7I8#>#aLJe%#s1%#HEs[[UB:EsS *ES!I[*\U"fdv S!VJ0\\U"fdsS#pos%V*As\\U"fdv P"dirsQ#retsPuAs\4]U"fdv S"dirs $iJ ]#i%P%Bs@]]U&fdv S&dirs 'iJy](i%R)A&]]U&fd%sS)NI0]]U&fd/sS)A9]}cU&p8 &exp8sp*?J:%d *I;%h *OJ<sl(eo<sh(fd=sP*WI=sQ* >sd*J?s`*H@sW*7JAs\'I(^+P**R+OsW,:~__-S-Q../__0X+Pp*(esQ,xaa-"S.-.7.A1aa0LS,X cc.i.t2c$c..3 HGs4#IGs4IG 4IGs45'Gs5*G 3XvIFs4#IFs6opFs6fdFs4IF 5*F3yks4js6nowjs3l's6nows6exps%B2scdU&p1 S' JL4d'-JNFd'HPXd'ISsd)$A]deU&p\ S%ZAtse8eU&ps (fdusP%Hs@ereU&p )0Be!fU(p R7[X7J 7brs  7}t7.v 7ws "8 7Q7;%7 XZ7s7 Q%7R%7 U%7 V7W IsX  Is`  vJs\  JP 5 #JT % I l  fIsp #ev t Kj > 0Jint7ri 2-y&dk3C/DY76H 9 -G5 -@!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8X!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3JI!JJ(JMdJNRJJJ  $JElowE#E#CPsNllOJP$9Jg >UnfVWdfPQ'94]KU_*judtpVRWlhWPQ* RPrvP#JUnTdTrpT#nnV)ddW)rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$) Jm1m0 C![;!J ;\k,"@0Jint7ri 2-y&dk3C/DY76H 9 -G5 -@!#! # #b  #  ##A# #z# #$#(+ #,M#00#4.!#8X!#<y#@"D#D #k#FH$#Gb(#H1#L7#Td8#X:!#\"<#`   #  # B !#N 6 G 6 3JI!JJ(JMdJNRJJJ  $JElowE#E#CPsNllOJP$J K[@UuZvZPQw\pJHK\fpl*{`VW\DRPPXT8*P'LP4JUnTdTrpT4nnV:ddW:rrXCd0Yd1Yn0Yn1Yn2Yq0Zq1Zb[bm[ww$: J!m1m0"C#[L#J L% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; : ; I8 : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.? : ; @ &.? : ; @ '1(1).? : ; ' I *: ; I+.? : ; ' @ ,: ; I -: ; I ..? : ;' @ /: ;I 04: ;I 1 U2: ;I 34: ;I 44: ;I5 U6 718.? : ;' I 9: ;I:4: ;I;1 <.: ; ' I =.: ; ' >: ; I?.: ;' @ @.? : ;@ A1B.: ; C.? : ;' I@ D4: ; I? < E!F4: ;I? < G4: ; I? < H4: ; I?  I4: ; I?  J4: ; I % : ; I$ > $ >  I : ;  : ; I8  : ; I8 ' I .? : ; ' I@ : ; I 4: ; I : ; I .? : ; ' @ 4: ; I  4: ; I .? : ; ' @  U% .? : ; ' I@ : ; I : ; I 4: ; I$ >  I$ > I !I/ &I 4: ; I?  % $ > : ; I$ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I.? : ; ' @ : ; I .? : ; ' I@ 4: ; I U!4: ; I" #4: ; I $4: ; I? < %!% : ; I$ > $ >  I : ;  : ; I8 .? : ; ' I@ : ; I 4: ; I : ;  U 4: ; I4: ; I  : ; I .? : ;' I@ : ;I 4: ;I 4: ;I  : ; : ;4: ;I% : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I &4: ; I ' (4: ; I) : ; * U+1,1-1. /.? : ;' I 0: ;I14: ;I 24: ;I 3 : ;44: ;I5 : ;6 : ;I7.? : ;' I@ 8: ;I 9: ;I : : ;;1 < U=41 >.: ; ' I ?: ; I@41A.: ;' I B: ;IC4: ; I? < D4: ; I?  E4: ;I?  % : ; I I$ > $ >   : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; .? : ; I@ .? : ; ' I@ : ; I 4: ; I11.: ;' I : ;I.: ; ' I : ; I : ; I !4: ; I "#4: ; I$4: ; I %.? : ; ' @ &4: ; I? < '!(4: ; I?  % : ; I$ > $ > I!I/  I  : ; : ; I8 : ;I8 &I : ;  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' @ $: ; I %&4: ; I'4: ; I (1)1 *.: ;' +: ;I,.? : ; ' I@ -4: ; I . /: ; I 0 U1 24: ;I 314.: ; ' I 5: ; I6.? : ;' @ 7: ;I 84: ;I 94: ;I:1;4: ;I<4: ; I? < =!>4: ; I? < ?4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;  : ; : ;I8 I !I/  : ;I8 : ; I : ; I8 &I: ; ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' @ #: ; I $1%1&.: ; ' I ': ; I(.: ; ' ): ; I*.? : ; ' I@ +: ; I , U-4: ; I .4: ; I /101 1 241 3.: ;' I 4: ;I54: ;I6.? : ;I@ 7 8 : ;9 : ;I:4: ; I? < ;!<4: ; I? < =4: ; I?  % $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 11&I.: ; ' I : ; I: ; I .: ;' I : ;I1 U!41"4: ;I# $41 %: ;I&.? : ; ' @ '4: ; I ( : ; )4: ; I *4: ; I? < +!,4: ; I?  -4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/  : ; I8 ' I : ; < !I/' I : ; !I.? : ; ' @ : ; I 11 .: ; ' : ; I: ; I 4: ; I   4: ; I!.? : ; I@ ".? : ; @ #4: ; I$.? : ; ' I@ %4: ; I &.? : ; I@ '4: ; I? < (4: ; I?  )!% $ > : ; I$ > I!I/  I  : ; : ; I8 : ; I8  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; .? : ; I@ 4: ; I4: ; I  U4: ; I .? : ; ' @ : ; I .: ; ' @ 1!.: ; "4: ; I? < #4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 &I  : ; I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $: ; I %4: ; I & '4: ; I ( U)4: ; I* +4: ; I,4: ; I? < -4: ; I?  .!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;$ : ;I%.: ; ' I@ &: ; I ': ; I (4: ; I )4: ; I * : ; + U, -4: ; I.1/1011 2 U3.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 9.: ; ' I :: ; I;4: ;I < : ;=4: ;I>.? : ;@ ?4: ;I@.: ; ' A1 B41C.: ;' I D: ;IE: ; IF.? : ;I@ G : ;H.? : ;' @ I4: ; I? < J!K4: ;I? < L4: ; I?  M4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 &I I !I/ : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I? < %!&4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ;: ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".: ; ' @ #: ; I $1%1&1'.: ; ' I (: ; I).: ; ' I@ *4: ; I +4: ; I , U-1 .: ; I/4: ; I04: ; I1.: ;' @ 2: ;I 34: ;I 44: ;I 5.: ;' I@ 6 : ;7 U8 94: ;I:4: ;I;41 <.: ;' I =: ;I>: ;I?.? : ;' I@ @ A.: ; ' B.? : ;I@ C41D E4: ; I? < F!G4: ; I? < H4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $4: ; I % &4: ; I'.? : ; I@ (.? : ; ' @ )4: ; I*4: ; I +1,1-1 .1/.: ; ' I 0: ; I1: ; I2: ; I 3 U44: ; I? < 5!64: ; I? < 74: ; I?  % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '1(1 )1*.: ; ' I +: ; I,: ; I-.? : ; ' I@ .4: ; I /4: ; I0 : ;1 U213414 U541 64: ;I 7 84: ;I9 :4: ;I; <.: ; ' =.: ;' I@ >: ;I ?: ;I @.: ;' @ A4: ; I? < B!C4: ; I? < D4: ;I % : ; I$ > $ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I".? : ; ' I@ #: ; I $: ; I %.: ; ' I@ &4: ; I '4: ; I ( U)4: ; I* +1,1- ..: ; ' I /: ; I04: ; I11 213.? : ;' I 4: ;I5.? : ;' I@ 6: ;I 7: ;I 84: ;I 94: ;I:4: ;I ;.? : ;' @ <: ; I= : ;>4: ;I?.: ;' @ @4: ; I? < A!B4: ; I?  C4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ;' @ #: ;I $.: ;' I@ %4: ;I &4: ;I '1(1) U*41+1,1 -41 . 1/.: ;' I 0: ;I14: ;I2.: ; ' I 3: ; I4: ; I54: ; I64: ; I7 : ; 8.: ; ' 9.? : ;' I@ :: ;I ; : ;< U= >4: ;I? @ A.? : ;' I B.: ;' @ C4: ; I? < D!E4: ; I? < F4: ; I G4: ; I?  % : ; I$ > $ >  I  : ;  : ; I8  : ; I !I/ : ;I8 &I' I: ;  : ;  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I# : ;$ : ;I% : ;I&.? : ; @ '4: ; I ( )4: ; I* +.? : ;' I@ ,: ;I -: ;I .4: ;I /4: ;I0 U14: ;I24: ;I 3 : ;4151617.: ; ' I 8: ; I9.: ;' @ :1 ;.: ; ' <: ; I=.: ;' I@ >.? : ;' @ ?41@.: ;' A: ;IB.: ;' I C D UE41 F4: ; IG.: ;' @ H4: ; I? < I!J4: ; I? < K4: ;I?  L4: ; I?  M4: ; I N4: ;I? < % $ > : ; I$ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; (  : ; I !I!< ".? : ; ' I@ #: ; I $: ; I %4: ; I &.: ;' I@ ': ;I (4: ;I )4: ;I *.? : ;' @ +4: ; I , : ;- . U/101 112 U341 441516.: ; ' I 7: ; I84: ; I94: ; I:: ; I;.? : ;' I@ <4: ; I? < =!% : ; I$ > $ >  I  : ;  : ;I8 &I : ; : ; I8 I !I/ & : ; I8 : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; !( "!I#.? : ; ' I@ $4: ; I %1&41' U( U)41 *1+1,1 -.: ; ' I .4: ; I/ 0: ; I1: ; I2.: ; ' 34: ; I44: ; I 5 6: ; I 7 8: ; I 9.? : ; ' @ :4: ; I? < ;4: ; I?  4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$.? : ; ' @ %: ; I &4: ; I '4: ; I ( U) U*4: ; I+.: ; ' @ ,1-1..: ; ' I /: ; I0 : ; 1 2.: ;' @ 3: ;I 44: ;I 5 : ;6174: ;I 81 9.: ;' :: ;I;.: ; ' <: ;I=.? : ;' @ >4: ;I?4: ;I@41 A B.? : ;' I@ C: ;I D : ;E41F 1G: ; IH.: ;' I I J4: ; IK : ;L.? : ;' I M.: ;' I@ N.: ;' @ O4: ; I? < P!Q4: ; I? < R4: ;I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/ : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( : ; I!!I".? : ; ' I@ #: ; I $1%1 &.: ; ' I ': ; I(: ; I).? : ; ' @ *1+.: ; ' ,1-4: ; I? < .!% : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I : ; I !I/  : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I"< #.: ; ' I@ $: ; I %: ; I & U'4: ; I(4: ; I )4: ; I * + ,1-1.1/ U0.? : ;' I 1: ;I2.? : ; ' I@ 3.? : ;' I@ 4: ;I 54: ;I 64: ;I 74: ;I84: ;I9.: ; ' :: ; I;.: ; ' I <4: ; I=.? : ;' @ >1 ?4: ;I? < @ : ;A41 B.: ;' I C: ;ID.: ;' E.: ;' @ F4: ; I? < G!H4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ;I8 &I ' I : ; I!I/  : ;: ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ;  : ; I : ; I 8  : ; I 8  : ; ( !I! : ; I" : ;# : ;I$ : ;% : ; &.? : ; ' I@ ': ; I (: ; I )4: ; I *4: ; I + ,4: ; I- . U/ : ;01112.: ; ' 3: ; I4.: ;' I@ 5: ;I 64: ;I 74: ;I 8.? : ;' @ 9.? : ;' I@ :: ;I ;1<1 = U>.: ; ' I ?: ; I@4: ;IA.: ;' @ B4: ; I? < C!D4: ;I? < E4: ; I? < % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/  : ; : ; I : ; I: ; : ; : ;I8  : ;I8 : ; I' II : ;  : ; ' !I/ : ; I 8  : ; I 8  : ; ( &I: ; !I!< ".? : ;' @ #: ;I $.? : ; ' @ %: ; I &4: ; I '4: ; I (1)1*1 + , U-4: ; I.1/.: ; ' I 0: ; I1: ; I2.? : ; I@ 3.? : ; ' I@ 4 U541 6.: ;' I 7: ;I84: ;I9: ;I :4: ;I ;.: ; ' <4: ;I =.? : ;' I@ > : ;?4: ;I@ A.: ;' B4: ; I? < C!D4: ; I? < E4: ; I?  %  : ;  : ; I 8  : ; I 8 $ >  : ; I8  : ; I8  I .? : ; ' I@ : ; I : ; I 4: ; I $ > % $ > : ; I$ >  I  : ;  : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ %1&1'1(.: ; ' I ): ; I*: ; I+ : ; ,4: ; I? < -!% $ >  : ;  : ; I8 I!I/ $ > : ; I  I  ' I &I : ;  : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' I : ; < !I/ : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; @ # $4: ; I% &.? : ; ' @ ': ; I (: ; I )4: ; I *4: ; I +4: ; I? < ,!-4: ; I?  % : ; I$ > $ >  I  : ;  : ;I8 &I ' I : ; : ; I8 I!I/  : ; I8 : ; : ; : ;I8 : ; I' I : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I" : ;# : ;I$ : ;% : ;&.: ; ' I@ ': ; I (: ; I ).? : ; ' I@ *4: ; I+4: ; I ,4: ; I- .4: ; I / U04: ;I1 U24: ;I 3.? : ;' I@ 4: ;I 54: ;I 64: ;I7.: ;' @ 8: ;I 9 :.? : ;' @ ;.: ;' I@ <1=1>41 ?.: ;' @: ;IA : ;B.: ;' @ C4: ; I? < D!E4: ; I?  F4: ;I?  % : ; I$ > $ >  I  : ;  : ; I8 : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8  : ; ( !!I".? : ; ' I@ #: ; I $4: ; I %4: ; I&.? : ; @ ' : ; ( U)4: ; I *.? : ; ' @ +4: ; I? < ,!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ : ;I8 : ; : ; I8 ' I : ; < !I/' I : ; .? : ; ' I@ : ; I 4: ; I 4: ; I 11.: ;' I : ;I: ; I 4: ; I4: ; I? < !!4: ; I? < % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 .? : ; ' @ : ; I 11 U 141 4111 .: ;' : ;I : ;4: ;I.: ;' I : ;I&I.? : ; ' I@ : ; I  < ! % $ > $ > : ; : ; : ;I8 I!I/  I : ;I8 : ; I  : ; : ; I8  : ; I8 .? : ; ' I@ : ; I : ; I 11 1 U41 411 .: ; ' I : ; I: ; I4: ; I4: ; I  4: ;I! "4: ;I#.: ;' I $: ;I%: ;I&&I' U(4: ; I ).: ;' I % $ > : ; I$ >  I  : ;  : ;I8 : ; : ; I8 I !I/ : ; I8 ' I : ; < !I/' I : ;  : ;  : ; I.? : ; I@ 4: ; I 4: ; I  U : ; 4: ; I4: ; I? < !% $ > : ; I$ >  I  : ;  : ; I8 : ; I8  : ; I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I' II'  : ; < !I/ : ;  : ; I : ; I.: ; ' I@ : ; I   4: ; I !4: ; I " U#.: ; ' @ $ U% &1'1(1).: ; ' I *: ; I+: ; I, : ; -4: ; I? < .!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8  : ; I 8 .: ; ' I@ : ; I !4: ; I ": ; I #.: ; @ $4: ; I%4: ; I &1'1 (1) *41 +.: ; ' I ,: ; I-: ; I.4: ; I/.: ; ' @ 011.: ;' I@ 2: ;I 3 : ;44: ;I 5.: ;' @ 64: ;I 74: ; I? < 8!% $ > : ; I$ >  I  : ;  : ; I8 I !I/ &I : ;I8 : ; : ; : ; : ;I8 : ; I : ; I8 ' II'  : ; < !I/ : ;  : ;  : ; I : ; I : ; I 8 .: ; ' I@ : ; I 4: ; I !.: ; ' @ ": ; I #4: ; I $ : ; %.: ;' I@ &: ;I ' : ;(4: ;I ).: ;' @ *4: ;I + U,1-1 .1/ 041 1 213.: ; ' I 4: ; I54: ; I6: ; I74: ; I? < 8!% $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 11 U4141  .: ;' I : ;I4: ;I 4: ;I  &I!4: ; I? < % $ > $ > : ; I I  : ;  : ;I8 : ; : ; I8 I !I/  : ; : ;I8  : ; : ;I: ;I.? : ;' I@ : ;I 4: ;I 111  U4141  .: ;' I : ;I4: ;I  4: ;I! "&I#4: ; I? < D J src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includehaproxy.cstdio.hstdlib.htask.heb32tree.hsignal.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.hbuffers.htime.hacl.hresource.hstdio.hlibio.hctype.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.hcfgparse.htime.hqueue.hbuffers.hlog.hsession.hPgg<!W!gK!!Y&"lt [a<.Y0frAuzt? .w <(ZYYYYYXuJu?=w @bj*\m؟Z tt;/KFJsxRi3<M<3<M ~7<I<7<I j-<hxX5<K<5<K sɣˑZu#أLugYK/N˒1g0,0ZW ˅ST*<)GLz~s~JL)g;K~f@<<<K fX"J5yJ~f~ .~< .w  tw<~f~ .~<@f~ .~<<~t"Y~XYh<.~XYX/zX~  wtf~Ʉ,Z=!e!eɝ!eY=;g91U=;g91U://vfuZuYggYZɻͶ~Ȉɽ://vfuu 䰑xLgK=;g91UK=;=;Yg82T=;73Se/g=-TAMe/g=-Ywzw;=/fh:"OX1zJM;gg/g.r?:h8@0;Yz:>Kguf# srcbase64.c0#UX9y/-A7-=Z:=[K$<;/gM@8Z0>=;0h6qQM 7A1@80#@;= Xx<6mXf;/ src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestandard.cstdlib.hstandard.hun.hsockaddr.hin.hstdint.htypes.hnetdb.htypes.hselect.hctype.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hserver.hproxy.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.h; w-=Y-/!=e X/L>/tv~AAY=#isX -uhy2"J>-v/82J?-w/z<4  zB=S4;/M)uJ!ghZtKvJrBY;/ s. XttLK!Jj#!c/9w1pKvpJ%=-M=;ghgh< :hu.ZKvoBq@Jj.<q׮/u|mfuL XghKvii=;/=t .}J-=8uXf"27 <t.3YukvX tIg-= ׯ 2=uX/!;L/.fY tw6"Z?ugh } .}.=~ .<~<@W=~J. ~< uYZ !-OSjM|guuX^tJZuYgwY/%S191G!u;g-/;K;/K' ^tY!u;g;/-K;/";/ ȕvygb?=u-//YY>:x $8itft~JJf~׃;>;=-/u-//YY[;x֘*8@g;g[?>,0d>/KYY>,1lfz.?U?1h,0d>/KYY>:1ktz.?hk[>,0d>/KYY>,1u pf!g;K\8kgqi!%Y>/vKzX f,yh/K" srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetlog.cstandard.hstdarg.htime.htypes.hstdio.hlibio.hstddef.hserver.hproxy.hprotocols.hsocket.hsockaddr.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hmemory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hglobal.htime.h=xȭ~?=>mxȭ~?/>lJ#U?=>[UkC[Uk< wq<f"A!W=>,Zfjp=guzM/V/Zuf0gsK Wi#~d>KcL%>hAXgX  7ZX v?;=m"OJ1fO 6gedq0<bV srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includetask.ctask.heb32tree.hticks.hebtree.htask.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hqueue.hproto_http.hhdr_idx.hstandard.htime.h@J JfX<aJCy.C JYhu%J!gV>!Wg>wu-g/iwttT@;0^J.$.hXzJB|J.(Jc.~X@zJ<txtzJBJ|<e<<sY*JVQtbtgWgY/Zhg;+.\ <~@zJ<txtzBJ|<;f<</fZ:Q /--;Y/ srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/typestime.ctime.htime.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.hstandard.h,Xfx~~t0~f ~. ~X ~.<~of!W===/LU?<fk~ .~ ff~ti/B~$ff}g=}.<~<.=~<":Xg}.g=-g~Xfg~X ~XI=/e//}X }.JYguY}XCXI=KK}Jt2g}tf}X(Jf-=/K}itX}XXg}t<f< $<=fE;E<; E @ɪ>/~ ;R/J;=c֭"Yg=~<Y"h=hR.< ֒rk,v]C@&#s1;/I=z&; 1;/I=mo srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/commonfd.cport_range.hfd.hport_range.hstdint.hstddef.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.h %=|gK>Krt=;g=W X^/,v;/E\y%SA)%18$ . 8"uuu=v7Y#!uwsf s.=d</bz<5zXzJWL1u srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commonpipe.cpipe.hglobal.hlog.hsocket.hsockaddr.hun.hin.hstdint.hprotocols.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hmemory.h0%x>dYgYfotY-h-M2k*>r=ht!t=Y;g<=jegYgYy. fY } src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetregex.cpcreposix.hregex.hstddef.hctype.htypes.hstdio.hlibio.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h>V==7.Lt1J;M=uE!?19g"0wסfMBcf"i,>MYvM fotXH"hidKJ"g;Khd>p  pfKیid1:vg;Ku82@X?d?!J]a .f h;/dXWt?t\TixT[U][k)PttV~=;$9[~J<4z.=Z[4<4)EZ[<4)EZ[<4z.=Z[4<4z.=Z[2s@s0s0 #U}Jf}f}w">~&~ X~<~ ~X}< &~eY;u]*.LY;uY.2Y} v4.~K~X d~~~<N9 .yX!e=sgW;/s!=-f JJNh-=={~<v t<E &/tK|X.;/K>,Y@;Y ;/  ;/O>/)W<hX0<Q,Y;i<;/v,!;>E.בsJmv"xgh;%gU=Y====z<X(xXɝL= u" yBI=-*oXo:hf}/;0;~<K1w;ej JK~,׻ɻʁY=WY"<yfyf<f_Y);~0;"L;dvg;Zv;dv;*<K1BzX!e=sZ=Uh;/Ys!=-=K;g;gZ:jJ&J '1;+I M;7Jb<lfg"**Kw;h*u";qv;JM'끟/;gw E<<wf; f!u;iv;eYhgJgIfLg;gs</; !# fJ JNWL!W %>:=Y;gXv; w;1;K<X  !#*g=ɏ=g=Nege=?i9@Uj8?dhV>Y~&v .vf w;ww;e=2{Lww;R;Kv"vv;rJhtfؑ; ;v;O'$WL- $=s= f==:>XKg; v;0qf0g;cv;2O'WL!W J$=s= .;>dJvg;0qf0;iv;+JM##ML{'&/;gw <vf f=>ge0qL;x;-?ؑ;e=w@< <v< <9=el<;-?ؑ;e=v@< <v<  <9=em<ב;v;~&Y;=egK/g"9fg&;<*Y00f.z/nfL;/f}zggw;;" J%&xVh:>dhm&}&+/;vK;/g;K/;JK'$WL- $gz";'hiXKg;L}X/g;JK/g;u;}/g;K/g;dYZ;/;PPLNg-==ّ;%/g;M:01Y!DžgWe=xxE/g;^$/;M;zg;"}g;u  t;}gm Y=d>w; }<#/=X}<';v;(x<u;oؑ; J J JK|X/;6Kg;v;ns!=-31M';/On"v; Yg;yu;  JR'g;nv;* (1;;/;Y ;/ ;/>&YZ:gj;0;sYZ:gd;/Pp;/;k;/x..JP%'gv;z fy<@cY>Skg:v w< f;/ofo.<t蓭g}Lk*0,>k.0Tf\f<t =h dg"*^d>.<x;};t(=j8j::Yg/;g;=YgDwXeg$ .l<'K/"(=i;:Y-"eg,.</g;pLg;u9gg;gL';/Kk"v;L'e/lKk"v;L'e/lKk"v;L'e/lKk"v;L'e/lKk"v;L'/v;e/l&j"v;@Y;xKg; Y;xKg; Y;xKg;)L'gv;L'/v;vv; e/l&Z;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;L'e/4Kkv;Yg;xK;K'P!eulv; Kg;yu; %/w;xv; ';/&Z;~Y;L'e/lKZ;hv;L'e/lKZ;hv;L'/v;e/l&Z;gv;o;xK;3L'e/4KZ;hv;Yg;xK;L'e/4KZ;hv;;xK;K'Pmv; Kg;yu; @&eeXfefe.<*;/ ~Yg;J!sJ@z4sgC.eusKYKvg J?sggY tOf3uIf\\XQ`ru" *m}^f=;!  <=Cy(W= f;/  &i9ibhhX~p֑>gbkgg};/@z;/^g-!'z;;gi K7~g;A ~;Y=` z"X~u<]=; `! ^ "!e.=C<=;/} srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeserver.cserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.hmemory.hbuffers.htime.hfd.hport_range.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.h<>Kiǟ<>[~g  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includechecks.cproxy.htask.hqueue.hticks.hport_range.hfd.hacl.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.hglobal.h1t/tff/ dv!=_>:>fsftW<).W<).d<sJ .s<.*?f=L>:hds< <s<Jv< vf f/3=;37@8?Vhg=zv. .[sA4C#gst unt148KFP#;idZgjNCy4 <wU?}t v< XX]egBu</Y <wxJD"NJ?U873X6&=M\<} <}&`XgK̟zgj $K;/ L# fK| fs<J<|<Yewfhiyrf*M ؟>tun&gJ3<zY*JyY*JmY{=-=٭K>t;z<YX*`UxX6<YX!!l;iW/u&y@>=g ڢi1w;iW/&'h_5d=zY*`xX6<YX K!!z *^>WUzN.4JL.6JOX1.O<t6?Tuwwu5hVhztiL=uw#KK-=zf-=#K><T/wugy"!u;gz==; A '~t6wB({<zfXuKYzUz֟'XN.4JL.6J==; u*`Uy=s.& twX e '/&zfoXtp tXd?u/>XJKW/t ~<=Cy CeXts<t%J#c?L-Odg=>muehhg-vqXKe>Ys"  srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeclient.cstream_sock.htask.hproxy.htime.hfreq_ctr.hbuffers.hfd.hhdr_idx.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hstdio.hlibio.hglobal.hstandard.hsession.h/>=q;=y C .Kk|=#>riy 2XNf2N.2foffU +fofuuuubtO<ٯ=8g; <yG}&<}}<}t}}<~ *uvx?gu,\/^dh,h }$Yvhgfu, f=K=euqme==eu}Y"ue]C~ .f.XDue EZ#}""~o.~ ; yYvf9;c*.#ȑvf <az)ugis?Xgis1xYs1=g v srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproxy.cproxy.hstdlib.hticks.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hunistd.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hglobal.hstandard.htime.hcfgparse.h 1<=W[WZ=WMY#U.>MW[W[Y  vX w=%=;WY= f!Xɱe.=y/E=;Ye=;ggV.<H=;WZfpX}=;eZfkX5b=;g ftX!=;ggVzjT=;Yg9u+ vXCw= tv< <<ס/=~e#&rX  r@g'u X=~ 82nX#t,@!%K|;/~2%),@Mf/tK) J_82 JKܮ}t }f<}X }f<} }f<} }<<}Xf}e }f<}<f}fe }<> ux-i91彿׾Yjffj<.jf.eu}ֹ׻}<%wgYg'|,f|X>5wt=1ɑfX?!~xXAi ngYʥKv /3p}f*J}/N.4JL.6JJPKp}'fY.(JN.4JL.6JWr<\/g<s+$s='Op>d \gbg${yt"qtwrh&v.g   srcinclude/proto/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_uxst.cfd.htask.hbuffers.hstdlib.hticks.heb32tree.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.hebtree.htypes.hun.hbuffers.hsession.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.hstandard.htime.hsession.h<=lHdv/Vg@ff~'$#vy, J ~OX tv'vo Y_zX?D%Yt <t. fNKP1>Cyt5~.( )#~Xf?q~..;i~t/f~fo tpfuuutOyfnfs;k7'<mfp<>uvuu=uuuvuvן=uɠ6zfjZx.@h|<|fpuuyt@bluf|<t=>uuv|<|<wf|<t|ftuu|txhtvuuyuu|ttvKY|XXWL%}guve=IN| <s<J<|ffɇegs!sg.n~ ~...5.}Y"~tXXYt%)A/ <vJM\N&XZ.K| <|>-uYQPN Jv.K|<<|-uu}J;E<;<Ef;E<;<Ef;E<;<k|<.|>-u;E<;<fi7YI=K= {Y*Jcm<n.t{=ȅ|<|ZX仢 Cy<B<qf<<c;Y1f:vO1<:h:}twJp 廑pXztY*JdXY*JhY*J_gtY*JdXY*JhY*jrytztxJxȢg 3 srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_http.chdr_idx.hbuffers.hserver.hfreq_ctr.hstandard.htime.hticks.hacl.hproxy.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hserver.hproxy.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h capture.hmemory.htime.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hglobal.htask.hselect.hJ%/;uyfK=/!jY![s/w[s/x!;YZtgv;KIgsY f=vKI=sY t$*?9?h Xx!-L>'-L#+M+jKe XxJKupBuyX?UBzXȔ8j{+?:0I=Wu>"=gH0>u;//WD|v.sdJ:Z,>2? /|X;M;/kX2Cu;= }.<|X$<\.;buvvK9X=t\uy fJg=s=sfu.ZKZ4v X'y.MZQi -N/j#0 .mf"d=ujM;/_=;YuA)uuiwz< tw|gKxt!x-=vvfXg>MMMol frtPqPq>=;gh f"2|Jf| |fXPkduuYgKK8$*jT{{J/e=e=eh{7z(L-KKK8$*jT m&yJ:Jy .yevX tu<ah:0>&Y$'=;YK>o. /;=yX;s tX=f;=9Ÿ.Iu/W= JVu/W=Q!uYuY/fXctht t/slf.GXɻ=Oɻ=#uYK//_Xht\ttPtp usx.7A=:2MX/n}tu=W=fkDJL:0v==;h =uw=2Y;#=c=Zu;kAuY &+;g}L:0v==;h =J2Y0!KX˒ۑUfX=M˒ۑ`K;/jvt <;=v:=/lwXA.W=;='[e=;/g$ ~'yXBz<^zf=AM-i9i9- zf^b@#z+ ׯC;/0;;>K]/Cy.Cy;sxX=sy!!M:Z>!W?9)/ wX8@j-]v <s<= tY>Y=my,hSN<.fb.fm.th/jw2/ 1h껡#L0",>ef!vf.e<:>ɳy{u<}%Pu/tL,_~"XX>d>&/ :v̭/=- <8@}Jv":0 f;x}';u$V>>8/>:-@:?@f@<.ht:0-wc49:=;K~׹">:>1!;?>E;=-/=9=?7/-@=b@Lu~1Yg/A7Y\8=[9=Z,==W=/bK=-/;=;׭;gpxt <z<affaXats؇Y=;<q< Y>*K]/MLgׯC>:0:==I=U1K>:0:?;=;=9KAȟ)- wX-]w <s<= .Y>+ Y=ZxL =;/=;MBwc?/Igx=72`#;<`fg;>,h`Xt1+fb.fm.th/j`w2/ _t <_e"<]<;="J]<"X}f=e>:>Dxt w|z0_~("XlX>e=&/k̭0=e=@[~';/]=-vJ".]<":[W/9N i.Z:=Y-?:==:=>uf;=:>-=d0~<i#}J=u;u\8=Z:=Zd==~">:>1;!)?=!C1Yg/A728=?9Y[9=Z,>3t#=;,>>9;=1=qA:S</h K=-/;.%dvu:L!==ulc.&ɜ.Y+w.Y]U#Y t(# .kBz<.kt^tJ}X<K/=:/-==>Kv>:0:==I=.@P+5 . th=>fDfg;i9YKA<>:giY;7# "4 #82? %y<y r<fs< rY t(0!=;  _yJ q<XgK !eAؼ5@g; >dA7@d>:h# <wJ p<XgKge=u pfbt atg tfKgge=Yg pfbt atg tfgggɼ]Ƀ pfbt atg tf v˭ o<X}$h=9uuY{/ugge->,/e>:W gcNeh:0W=d3Je . 7|/!"-#'oȟXCyfmn??9puvvK<Xtm=-gvJ .<m.<m.Zf -|Xe=;gg;0:=gA,hgg4F`_g?9[KrgECyfm/,"&:0|8h!.l, -?Cyfm/,"&:0~<|g;Y;>;/tȫ=u. tu. ; (?)Ac?ci rf XgyJ/hYg:L;j9wK>:ZH>x82re=;g;h .ޒu:==:gu"<W~r>-=vf Xh-/w>{>tY*J g;:>:gug~tt|L;/~ȟg;:>:gu!gntvf <s .s.f!vJKU .M-=vf{uJ.{=g;g;dvn-=vvfnB?Uwu-;uL un<<n<.n<<q˻Փ"i-/w;=4Yz֭=,=L%).jMfu.//_uYz.,igCJ$*itu-\=-\gY0TYlX=;==,=LW>y^z.kMfu=0-Q*=>v^z.kMftg-Q*=>v&z.JkM f;gZY1=%.uY$*.iM fv.jg?qjY$*JMfntkgeCW_$*JMfstkLW .&z.+=>1j>:ggYWCu:v>,/hXMnaj/;XMje/; f'y.l*@1uLYuYXMnaj/;XMje/; f&z.+=>1j>,/hv:v=W5XMnaj/;XMje/; fz.>=>Mj >,/hr:v>:h/V=mXMnaj/;XMje/; f%)JjMfljZ-N[2T?Jg  srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includestream_sock.ctask.hticks.htypes.htypes.hstddef.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.hacl.hproxy.hin.hstdint.h socket.hqueue.hserver.hfd.hport_range.htime.h freq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.h memory.htime.hproto_http.hhdr_idx.hpipe.hstdio.h libio.h standard.htime.hpipe.hglobal.hpxG.c<=utPuytX:0 /;h =WQ]Y? ȃ:0,h=c1YZ[M.\:0,h=c1{ytZ t=zz< t;(JK=s2,h>gV{Ȕq wt<jf ? :0u=-/;@11c=h:>j,;KKOCwؽ/}sft=;;Y~~ <vX < f  w)>V0=;:?gZ֟ &Zhd>]KȆ}J=-gvJ .X}t <t:u2<>:u>;s~/;Y% ;KKO =;bք;KKN}UtK~f;u. .ֻT dJK=s0>,>#i;g/sZwdX~ r fxfDjw-=){=-gvJ .m<h{s<t<'#{vH <>:uz<<z<<z<t;YzXN /WY;5=>e +z.X= <?8^C" tZxv <fxs<t0x<<xft=-gvJH .xUM=-gvJH .xUJg:<n<9' srcinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeappsession.ctask.hticks.heb32tree.htask.hebtree.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htypes.hin.hstdint.hsessionhash.happsession.hfreq_ctr.htime.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hfd.hport_range.hstdio.hlibio.hstream_interface.hsession.hqueue.hproto_http.hhdr_idx.hstandard.htime.hglobal.h`<0KoXtp tqXuut<Xqtr<etJrX/..TVh*J/V=:YM˟Y txJe=YAG!K/hL>U#=:Y=:Y=l% Y<*J%LAJuuv=gJZ;$X?:>LZX=grJzJuu <8Y><9hY!ggK73S J>ʜiuugsYpy<5ft*Hu;>X@c?~ցg儠;g=B*&/}LJ}Sg=gT <~t;g/?{.gLX{JX.-=ffe<z֐ <70g;=;kuwNN9uf<<i|JLLJ!*S u=@[kJX(<^JhJv}@c?}J=g}LFgLH>/my. J/Ka#fxuu-g\}Jt>?9?}fZZփ=:};gf}.yIgLZX=gytZ YYI=B*/yLJYI=y<;gtX?d>yJ=gxtLFKLH>/my. J/Kc!fttxJ>>:>xfZX=fxL#~X<~fu ~<L:> g=gc@nx< <-";=?+>,>cwu 9t< tw/Y=@8@@8#3/Mi>!XKL!;Y^%=W<pJ<tt >L:>B5,$ -@;z<-Mcw%.`/Z0.RIuMvJgu). YK=;=W4=-ut =;=^e=L J)tE hVt} @pl{hfzJB|J .g|X~X@zJ<.xtzJBJ|. J@uMu <.9tti0u=?sKxgvy w"KYuzy. ={X<h.zBJLe1fgvc1i,lzXjf :%SJ@fg-N [uWX= t/ J@>:=>HX5tKX;W t>Vhqt=uw<q<JK-=f"KWLYsw;qXLKqX=eבu=~%T/1;/*Xqfq<-gvJ .t=;gL*x=;=e=qqXgK>t=;g-~=srU wq==IZ>t;h%,(?*gɃr=K>t=;g~02)%*"~( Z=e=pfuw^Qk(..Jeu? pJ  t w |g xtfKp^e=}Efq<p<-p<vJH.p<<meu p.gvfU<=Yiǟ t`K"1;YUg t srcinclude/commoninclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includestream_interface.cticks.hbuffers.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.htypes.hacl.hproxy.hin.hstdint.hqueue.hserver.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.htime.hproto_http.hhdr_idx.hstdio.hlibio.hstandard.htime.htask.h+? Af.?<Y<*JCf/*[\<=uv  J;t?:vqvvgyX?:vqvvgAXW Jt=Y?:vqvvgXX..=-gvJH..<uJU  src/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/protoinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includedumpstats.cstdlib.hbuffers.hstandard.htask.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.huri_auth.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hgrp.hpwd.hsession.hstream_interface.hpipe.hqueue.hproto_http.hhdr_idx.hctype.hstdio.hlibio.hglobal.htime.hpipe.hsession.hcfgparse.h;"VWg;=ۑ/S<+V<;&X`-x tv@\-~X@p<X!;/aJJ~fg1~0yx4f/S<-<X7x+j`b .g  pC:zt=<{XC..o.^| $#zf 'VjZBg-ko/;[?W <%'g- v.x>g;M?g"(7S?=c <RL/e<N 67-@}FY/;E <F#0K Wϑ*#X&ȑ!j8@gjF O IG&$*M)&~l>g-~lA~3ZJt~J~w~zolv#2gN|_}'j>!vguϔEh!-|ft|*-z>zwwzzwz"zP@?Gv @?Ph:eg~=e/.v&7:h,ɟ=Yu< <u< ~f~<<~f<~fbk#)af<eu ieJ-=*ʻ-g-K;=ϳ =g~&%xK-=!-g;=eguuqg6ti9gw vf .OAj@  ?</.<jrI.v< tJg ' srcinclude/protoinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/import/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sysinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeproto_tcp.cfd.hticks.hacl.hbuffers.hproxy.hin.hsockaddr.hstdint.htypes.hip_tproxy.htypes.hprotocols.h socket.hmini-clist.htask.h eb32tree.hebtree.hbuffers.h session.h server.h proxy.h fd.h port_range.h time.hfreq_ctr.h sessionhash.happsession.hlog.h un.hregex.hpcreposix.hstddef.h memory.htime.hstream_interface.h queue.h proto_http.h hdr_idx.h proto_tcp.h acl.h ctype.hstdio.hlibio.hstandard.htime.hglobal.h task.hcfgparse.h,mKgY=u=\O-NJ/`=gt*y<9?=Pv. tx |zXP+wv+Wu.wzBi-fv"6Υ? ~#:Kueggg>:K#oJg=B=W.tKXt:ugg-Mg+w.ZYjzXlUhz fi= .wJ <f".+w{tv,0x 5y.C .$AY X]u!!vi91M6*x:0zX<z<.v,0xyf<4 E X$Ax:wȽ1gg wt1XgN<4JL<6JgN.4JL.6JJ2<N.4JL<6JfxtO<2.N.4.L.1xtN.6JxN.6Jf <|7zzf\kx\k/s{ugW=Yuve~ ~t<z%Wuu .h 9} txx{tMy@=L" Juyfu} <B< q f<<b ;Y1f: Qf1<:Z:fx.K K~K~YhY~zx?wt6qt6&zXAT;=?PVJYuYh#KLL:>KL?!e.={ xsX <W/W/+g;,",,zf4vO[]S\PG i -[fuK;=+(BuuSA;gw[[#UJx-vue=gg"V0 #c1Zjuwuuuuuuuuu srcinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includesignal.csignal.hsignal.hsigset.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsession.hmini-clist.htask.heb32tree.hebtree.hprotocols.hsocket.hsockaddr.htypes.hserver.hproxy.hin.hstdint.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.hmemory.htime.hqueue.hproto_http.hhdr_idx.hstandard.h+g=JK0/ Jgw̟T xfa3uɑvz Xy. srcinclude/protoinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinet/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/includeacl.cacl.hserver.hproxy.hprotocols.hsocket.hsockaddr.htypes.hmini-clist.htask.heb32tree.hebtree.htypes.hin.hstdint.hfd.hport_range.htime.hfreq_ctr.hsessionhash.happsession.hlog.hun.hregex.hpcreposix.hstddef.h memory.hbuffers.htime.hsession.hstream_interface.hqueue.hproto_http.hhdr_idx.hacl.hctype.hstdio.hlibio.hstandard.h-;<=<=g2Y4<= "V0"V0",0J$*igYZTv/(X@?9=L8@82==i=,/Mu;>%J$*igY0TvY\*igZVKL 7Ag-Mh:0g`\xKhU`;/`^z< <+?#=-O;ev;=uzt/[!uv< l" K%fX@=-Mgy=uYytz<4fZts .wfuwf,%.. tK;ugK&=[-g,\u>:hܮB?KytttOf p.r<sf .wf=-KwJ'%.. tLK_usXKZ =Muti,\u:>ܮB?KM3.bXthtt f=Y{!e.=C<=;/hK-k;/1^MY+s;/~2vX J>uwђJy.>YW;gL;=vDW=;/fW=1h;=;K=shvMKɄ=;/K=;=?C .vtC twX;/L>;/L=;w <z^t <z$ȔuG1U tl1;/QD;Y Je=u .zu;/_X ;/L;/M>:g1ytC=-;/;/L;/M=i9>:/=:>YK zu/xu叮5 W=j;^7?qj/Y3/ztJ5J <Q#<_. W=4;/O:=g:>Z,h5=-l W=.ntW=0/;=;g J st< hu/oX\q590/=v  <t.JMu-Zz=;!==/xtY=- X>MN=90/=1).JKKg-LuO/Sg;4uW/V0CxJDx< "W srcinclude/commoninclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bitsfreq_ctr.cstandard.hfreq_ctr.hstdio.hlibio.htypes.hfd.hstream_interface.hbuffers.hsocket.hsockaddr.htime.htime.hPG$TPz.@K[/=K/?=--}<{&zXO)lLY=K/<-~.?+0LK &zXA)BLY=K/<-~.?+0\-KG> srcinclude/commonebtree.cebtree.hPHfX~)37 .yz{<N srcinclude/commoneb32tree.ceb32tree.hebtree.hIytn/g&;=/X~.<~<<~ <<~< X2=;A8=/>.~ftX}=;>->.p~~ytn/g&;=I/VX`.<i<<i <A7 X2=;A8=/>r.fqt>X|=;>-> .pJ} .X<#KLL:>KL?!e.={ u6g;=;=hKu;= Xgg=Kmtz Xg .!;=",ZZV>>,">0!l< _=Wii<i< ;/-!z<SAWiHw9[M[#U Jz-vuW=gg"V0 #c1Zjuwuuuuuuuuu srcinclude/common/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/includeinclude/types/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/bits/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/sys/var/flx-toolchain-0.5.0/i586-flx-linux/tool-i686-host-linux/usr/lib/gcc/i586-flx-linux/3.4.6/../../../../i586-flx-linux/include/netinetinclude/protoev_epoll.cticks.hstdint.hepoll.hfd.hstdio.hlibio.htypes.hstream_interface.hbuffers.hsocket.hsockaddr.hunistd.hstandard.htime.hglobal.hlog.hun.hin.hprotocols.hmini-clist.htask.heb32tree.hebtree.htypes.hsignal.htask.hmemory.hS!J3,!W.=//*:=W=?=+wNue XvXM/.ic 1|9>/[fL;-A9@+/=MWKYfL;-A9@+/=MW/;/Yf@+[#[u"dLV>KuwzXBK[u t~J,dvCg!rrfBlts~iJ~t -J ȇSAsgZM9[[!;YM!;\UJu-v[,JKZ廻gzn<1-LY Xu.^[2K-=gJ=u'xtfeu<>,K0X/WY  >:Z):Z@:.؟|4"f< vf= tWY*U?(bbf"~ >>V2 :Z/}<f}fGYl$YY$p=W}i<}< W<`tttAdh9[M!;\UJfJ""u/ft!uW=gʻg6<1-LY I:p99~q U:8::q:  s::7::~cHr8:q7;8,,a.8,H8.$  . 0  f.). <.e. E.+.J.,. !.&...x.. %.-. 5.=. .. $.. >.. /.<. 2.<. 0.. .. j.1. \.. .. .. /.6. =.t. q.. .D. 1.=. .R. .T. .. 1. . .6. T.. .l. /.. .G. .%. /.(. /.. .. @.. -.y. j.. k.. .6. f.[. ... ..0. ... .{. T.w. T.w. .. g.. .. .. .a. +.. +.. +.. +.. +.. <.. @.X. <.. +.. +.. +.. +.. +.. C.e. .. +.. +.. <.j. +.0. +./. C.. 7.+..A..}. F.\. [.W.  .<.  .D. .h. k.. K.4. 7.6. q.d. b..  .<  '.. .<'  . . A.  | ( : ( @R | 4| j !.8. 0|  B.4|  7.X| 0 G. .H. T.0.Z.\. X| 6 ..D. \.3.S.,. X| @L ..D. \.?.6.  .T| - ..D. \.'.6. X|  @..C.].0b..^.8| `0 T..| v   .J.=.g.n.J..^... .l.\. .{.j.p. x.. 8| T g..| ($$p $$$(  .$$@} 8$$ R.=.8$$н_  ..,$$0 .| 8T%m '.". tT%  .?. .. .\. ..0#..C. T%0J T%S ,T%| ?.,T%`{ ?.T% $T% .| ' 7 '`* T' .... @.. .D'Y a.Y. .B. T' <.5.... .0'd 0.0'`z ".x' g........+..*..L'  _...=..H'  .%. ... ,' .,'pS .L' [.. <..i.|'5 .J. ...  . . ... )..t'0g  .2. ... 3.l....  .$' .| +Q p+ T  . K.........<+  ?...0+  U.0+p .0+@ =.0+P` U.$+ .| 4-9 ..0-  .0-s .0-  /.(-V 8- ^..4-+ . . 0- .$-E (-a (-@ <-  .x.N.X-. 0.....2..D-U  w.. .. 0-p  .(-0 (- D- .^.:.. 8- G.a. 0-p$ .8- . .8- R. ..0-0  .4-" %. .0-p# . <-P&D b. M..0-( Z.<-0)3 b.X.  .,-p+i  ,-+ h. T-,) .. .i. .4. 0-4G . <-07 [. .3.0-9 U.p-9  .f. V.t.v. .l. s.. .0-0D Z.<-E E. &.*. -pF6 =.F. G.`... z.. .p. }.. g. .z. g..H. d. .M. Z.<. .+. .. \-Tq  1.F. ... M... S.. .@. 1. .G. a./. K..z.V. q.7.. .. z.w. *.}. .. ... Z..R. ^.;. V.r. &.&. {.<-0o\  ..&.-oD ,-oo =.,-PpA  .(-pY (-qY (-`qe -q: ,-rs 5.,-rv 5.0-s *. ,-sE ;.,-t? 5.0-Pt_ -. ,-tE ;.,-u? 5.8-@u *. ^.,-uE ;.,-@v? 5.8-v /. w.,-PwE ;.,-w? 5.(-wd $-Px .| (<pxC D<xA M. {. .C.,<{x I.T<{ .I. .\.1.$.,<P 8.8< ..0< 1.$<j '.0<W .| $>` .<>0) %..P.0>`J .$>& .$>M ,>0 .| (?  ? ?Q (?r (?n <?b ...0?`A $.0? x.0? u.(?0 (?З" L?  . .{.'.r.,?c %.,? .4? . .D? $. .B.0.,? .8?F  ..<?P . ...8? W. f.h?  2..c..2.(.G.T.0.,?  .,? c.?   .{. .. 1..&. `.. Q.. O...0?@a B.?; 0? .0? 5.0? 5.0?` 5.0? 5.0?y 5.0?y 5.0?y 5.0? 5.$? .| G- G* ,G0 .,G .| 0xHU <.$xH .dxH{  .. .v. .4.0#.. ..'...l. #..0#. .@4. .. ..@ ..0.X. .D.pF. e.=.0./. U... P.-. ]....p...TxH .. ..pd. .<xH Y 5..` .,xH9 .xH . '.\. '.T. ].p. D.!. -. %.?. E.?. #.. D.XxH*  .). s..0+..@.$xH .| <@L g. .R. L@L O.F. v.!.. 0@LT .@LQ @LpQ 0@L\ m. t@L0f .\. .. b.G. 6.V. ..0..@L+ (@L $@L6 .| ,xN{ _.8xNp ..$xN0 ? #.(xNp  0xN` C .0xN v .0xN0 }.LxN@ .6.t..t.xNu xN .&...$.I.4..8._.F..2.. .R. .H. .$xNP%p | (0Q% | pQ`&$ pQ&  pQ&  $pQ&5 $pQ'0 pQ@'$ 8pQp' . .,pQ* .,pQ*L  .pQ0+  pQ@+ | $0S+C .,0S , %.40S,t 5...00S@-  .| T- T.0 T0. TP.  T`.  Tp. ,T.c ,.4T. *. +.,T/X !.,T0e &.0T0 [.0T@1\ .$T2 .$T2 .(T2m TP3) 0T3=  .$T3  .,T3d  .(T@44 (T6. $T9+ .T9 T: 0T :@ .0T`: .,T;L .0T`;a <.<T; .X..<T=c ./. .<T=  .. .<T? !.. .0T @h +.0T@ .8TPB . .(TC; $T0D .| 0Z@D M.,ZD Z.8ZE\ .#. .,ZE4 .,Z0FQ  .<ZF .R.0D. | ( \PGO ( \GF $ \GS | (\PH (\I | 0 ]I_ .0 ]Kn .( ]L{ ( ]M ( ]M | D ^`N .5. ..| h^N$ h^ O  h^@O  $h^`O5 $h^O0 h^O$ 0h^PR .,h^`R ".,h^S@  .h^PS  h^`S | $ `S'  ` T" ( `PT , `@U? ( `UU ( `UX ( `@VM ( `VK 0 `V x., `X- H., `Y .$ `Z( ., `Z2 .. `[ | $b[' ,b[J ,b0\P b\2 (b\t (b@]c ,b] .$b] Db] ..T.X.,bc  K.,bd  .$be( .,b@e2 ..be | ( e  | (`e@ totalxfer_smallserver_drop_conntask_delete_filenominconnmax_lencurfdback_refslposcfg_cfgfilelb_nodeiface_name_IO_buf_endhttp_msgstoppingerrorsrlimitsockaddr_inwscoremaxacceptdown_transnbprocapoolstrashsa_datauint16_tsockaddr_storagefwdfor_hdr_namel_nextin_port_trdr_strusers__off_tfalltracknextlogfac1capture_namelen_locknext_fullminavail__u_longpx_leneb_troot_tatolerr_loccheck_lenregex_tt_queuenicefailed_checks__u_intsa_familyfailed_connsappsession_name_lenl_onoffuser_authcfg_pidfile_IO_read_ptrinspect_rulesprod_IO_write_endhdr_idx_pool__rets_addrfeconn_max__ss_paddingtrackitnolingercurr_posswitching_rulesrequires_IO_read_enditoa_strrdr_lenerror_snapshotcfg_maxconnlocal_portre_pcrelast_timerbacklogsin_familyprx_queue_sizelong long unsigned intsessidcookie_domainstats_timeoutstop_timereq_add/data/git/public/haproxy-1.3cookie_strprev_ctrhash_listfailed_secualgosrc/haproxy.c__uid_tmonitor_urisin_portstart_dateproto_listbytes_incum_feconnputcharbrefmaxqueue_chaincapture_lenrdrbanalyse_expsockaddr_unfullconnunsigned charcheck_portauth_realm_IO_lock_t__uint32_taccept_datelong long intpeerlenerr_codewmulturl_param_post_limitsend_maxsock_protsun_pathprocessdenied_reqorgto_hdr_lencurr_sectv_requestinvalid_repinvalid_req__mode_tstdinrlimit_memmax__time_tredirect_rulebranchestv_usecrsp_expckleneb32logfac2_IO_write_ptrappsession_nameuser_pwdmaxfdminlvl1HTTP_METH_OPTIONStot_usedurl_param_lendenied_respHTTP_METH_NONEbe_sess_per_sec__rlim_tsv_st__ss_alignpuidnb_rsp_capnb_listenersoptions2ownerarg_modeHTTP_METH_GETiface_lenhtbl_proxy__loff_thealthslowstartleaf_pnb_oldpidsreq_cap_poolcookie_lenexpire_IO_save_baseuweightl3_addrlenclientnext_weightdata_ctxhdr_idx_elemdefbe_shortbufss_familyhttpreq__pad2re_erroffset__endptrcum_beconnurl_param_nameaclbconn_retriesnext_svidgracepool2_requrinow_msnbbeuri_len_limitportsnode_p__socklen_texpb__task_unlink_rqfe_sps_maxcur_sessold_argvGNU C 3.4.6chrootmaxpolleventsbytes_outsa_family_tsuitesoldpids_sigexcept_maskeb32_nodetotpendnbconnt_connectfe_sps_limnb_req_capHTTP_METH_DELETEcum_sessHTTP_METH_PUTeb32_deletebeconn_maxexcept_toerr_posniced_tasks_sbufsin_zero_IO_save_endwdivuuidrdr_pfxstdouttot_wactterm_tracesrv_actlogsrv1logsrv2srv_queue_sizefwdfor_hdr_lenrlim_maxallocatedpeeraddr_vtable_offsettot_wbckshort unsigned intrlim_cureb_nodefe_sess_per_secsig_dump_statemaxsockt_datacap_hdrappsessionscur_sess_maxruleb__off64_thh_match_domain_IO_read_basereq_expfwrr_groupanalysersconssockaddrtell_old_pidsrsp_addsport_rangefbckhh_lentv_acceptHTTP_METH_HEADto_logxfer_largeproto_IO_write_baseauth_hdrsig_soft_stopnb_tasksfailed_reqnbpend_maxsrv_bckcapture_nameupdate_server_eweightpool2_sessionerr_type_IO_markerlb_treecum_lbconnrr_idxmon_netcontext__suseconds_tfree_listbind_procstats_socklogwaittotalconnstrtolactconnminlvl2protocoleb_rootpool2_bufferprev_statepool2_pendconnhttp_meth_tmsg_statepool2_capturelbprmsin_addrcheck_reqsun_familynbfetable_IO_buf_baserun_poll_loopstat_scopecur_pollersock_familyfastinterrecv_enoughHTTP_METH_OTHERcache_idxhave_appsessionHTTP_METH_POSTdata_sourcecondb_IO_FILEpend_posin_addr_tprev_srvcookie_namecurr_ctrcheck_addrtimevalana_statehdr_content_lenHTTP_METH_CONNECTcli_cookiecli_addrpool2_taskbe_sps_max__task_unlink_wqlast_changesock_addrlenriseto_forward__pad1prev_eweighturi_prefixdeinitorgto_hdr_namepx_id_markersfwlchh_names_nextdown_timenbpenddisplay_build_optsargcserveridappsession_lentunehostnameapp_poolfwrr__int32_tcfg_nbcfgfileslogsdo_logsrv_addrredispatchesrequest_counthttp_txnre_nsubrlimit_nofileserver_take_connswitching_rulemon_maskrelative_pidhdr_exp__gid_trweightretryblock_condtv_sec_cur_columnuniq_idsig_pausesock_domaintot_weight__ctype_toupperactionerrmsg_IO_backup_basesignal_queue_lendisplay_version__nptrspread_checksfdtabpool2_appsessnb_rspaddstderrsock_typepool_headuri_dirs_depth1l_lingerloglev1loglev2mon_fail_condexcept_mask_to_old_offsetuser_lencallswhenexcept_netHTTP_METH_TRACE__basepx_stlogsrvrun_queuecurrrsp_cap_poolpermredirect_rulesmaxpipesprognameforce_persist_rulesdowninterindexhdr_idxpidfdsource_addrlast_checkspendconns__ctype_tolowersig_listennb_reqaddcfg_maxpconnfailed_resptask_freedata_stateshort intprefpregservedtrackedsrv_cookiedispatch_addrinspect_delaymonitor_uri_lennposcurr_weightappsession_hashprivateoptionssrv_conn__quad_tappsession_hash_removeappsession_hash_lookup__s2_lensrc/sessionhash.cappsession_hash_initappsession_hash_destroyappsession_hash_fappsession_hash_insertitem__s1_lenolenconvlenbase64taba2base64src/base64.cdisable_all_listenersprotocol_enable_alldisable_listenerprotocol_unbind_allunbind_all_listenersprotocol_unregisterprotocol_registerenable_all_listenerssrc/protocols.cprotocol_bind_allprotocolsenable_listenerprotocol_disable_alldelete_listenerstats_add_authnode_copystats_set_flagout_uout_uristats_set_uriuri_copy__retvalrealm_copyintervalblenout_namestats_set_nodeout_realmstats_add_scopestats_set_realmstats_check_init_uri_auth__lendesc_copyout_base64ulistnew_nameout_ubase64stats_set_descsrc/uri_auth.cold_scopestats_set_refreshscope_listauth_base64str2sun__uint8_tulltoh_rorigurl2ipout_errh_lengthhostenth_addr_listout_freeultoa_r__uc__uistrszsrc/standard.codivurl2sa__strl2ui__str2uic__fd_maskulenstr2sa_rangestrl2llrcret_valomultidivstr2saporthportloctetshextabstrl2iclimit_rinvalid_domainchar__strl2uicstrlcpy2unit_flagsescapeimult__fds_bitsh_addrtypesaw_digit__usiurl_codeparse_time_err__ctype_bstr2net__str2uih_aliasesencode_stringmy_strndup__u_charinvalid_charhttp_code__resultishexstrl2ircbuffer_realign__gnuc_va_listsrc/buffers.cinit_bufferargpbuffer_replacebuffer_writedeltabuffer_maxbuffer_write_chunkbuffer_replace2chunk_printfbuffer_insert_line2buffer_dumpdata_lendataptrnbloggerssend_logsess_term_condtm_isdsttvseclog_facilitieslogsrv_addrlenlogfdunixmonthnametm_zoneget_log_levelget_log_facilitylogmsgget_localtimeqfprintftologtm_minlogsrvstm_sectm_wdaytm_montcp_sess_logtm_yearlog_ptrWarningtm_ydaytm_hourtm_mdaysentprx_loglog_levelssrc/log.cloglevelminlvlnbloggerfac_levelplogfdlogfdinettm_gmtoffsess_fin_stateAlerttick_first_2nzeb_walk_downprocess_runnable_taskstick_is_lttimers__task_queueinit_taskrun_queue_curnb_tasks_cursrc/task.ctick_is_expiredeb_firstmax_processedrqueue__task_wakeuprqueue_tickseb32_nextwake_expired_taskseb_nexteb32_first__tv_ms_le2__tv_islthz_div__tv_ms_cmpcurr_sec_ms__tv_ms_remainhuman_timetv_offset__tv_remain2__tv_add_ifsetmax_wait_tv_ms_addtv_eternity__tv_isleinterruptedtv_zerotv_update_date__tv_isgt_tv_ms_remain2__tv_adddeadline__tv_remainto_msadjustedfixupcurr_sec_ms_scaled__tv_ms_elapsed__tv_ms_cmp2src/time.cdisable_pollerport_range_release_portnbpollersfd_deletedeinit_pollersfork_pollerpoller_namelist_pollerssrc/fd.cget_pipekill_pipeput_pipeinit_pipesrc/pipe.cpipes_usedpipes_freepipes_livepool2_pipepipefd__pipe_module_init__reschain_regexhex2regmatch_tsrc/regex.cdst_sizehex1rm_eocheck_replace_stringregoff_trm_soexp_replacepmatchold_dstdst_endmatcheswarnif_rule_after_use_backendcfg_register_keywordspw_uidcursectioncfg_parse_listencur_argcfg_kw_listport_lowproxy_type_stratoiforce_persist_rulest_blksizepw_passwdcurproxyconfsectst_gidproxy_reset_timeoutscfg_keywordnext_pxid__s1check_config_validitynext_srvport_highwarnif_misplaced_blockcfg_optswarnif_misplaced_reqaddwarnif_rule_after_reqxxxdupstrHTTP_302__blkcnt_ttargetst_nlink__unused3__unused5cfg_unregister_keywordssrc/cfgparse.cha_grouppw_dir__nlink_tst_modeHTTP_303pw_namegr_memlast_listenhintnew_listenst_uidwarnifnotcapoptnumcfg_opts2errlenst_ctime__blksize_tgr_passwdreqlensnameskipfailreadcfgfilepw_gecoswarnif_rule_after_blockcfgerrcfg_parse_globalnew_leninit_default_instancerportparsewarnif_rule_after_reqaddst_mtimehttp_err_codespw_gidchunk_dup__dev_tstr2listenergr_namecfg_optst_rdevst_devdefproxylinenumfstatthislinest_blocksrealportnew_ptrcfg_keywordssslv3_client_hello_pktst_inost_atime__ino_tgr_giddo_checkport_range_alloc_rangepw_shellcookie_set__u_quad_tdestinationnewsrv__fd__unused1__unused2__unused4warnif_rule_after_redirect__statbufha_userwarnif_misplaced_reqxxxerrnumsrv_downtimesrc/server.csrv_getinterpc_bckset_server_uphttpchk_build_status_headerout_errortask_newsrv_hlt_stprocess_chkfd_insertprev_srv_countpc_endevent_srv_chk_rsv_statependconn_from_pxout_pollset_backend_downtick_firstgmt_timexferredset_server_disabledtick_addsrv_was_pausedbind_attemptsout_wakeupstart_checksport_range_alloc_portcheck_for_pendingout_nowakeset_server_enabledredistribute_pendingset_server_downmininterratioevent_srv_chk_wsrc/checks.ct_connbchktick_add_ifsetremotesrvposnew_chksrv_is_usablesrv_dynamic_maxconnpendconn_addsrc/queue.cpendconn_get_next_sesspendconn_freependconn_from_srvinit_pendconnprocess_srv_queueget_frt_addripv4out_fail_idxacl_fetch_dstacl_fetch_dportout_free_sessionladdracl_testsalensrc/client.cmax_setpatternsacl_keywordmin_setfreeptrbufupdate_freq_ctrout_fail_reqcapfetchbuffer_initacl_kwsacl_patternacl_timeacl_fetch_src__client_inithdr_idx_initbuffer_write_enarotate_freq_ctrarg_lenacl_kw_listproxy_inc_fe_ctrout_free_taskout_closeout_fail_rspcapacl_fetch_dconnmax_acceptacl_fetch_sportout_fail_repout_fail_reqget_original_dstuse_cntproxy_inc_be_ctrlerrmaintain_proxiesproxy_parse_timeoutstop_proxyproxy_cap_strstart_proxiesverbosetick_remainproxy_cfg_ensure_no_http__proxy_module_initstrtouldo_blockfindproxy_modeproxy_parse_rate_limitproxy_mode_strfindserverdefpxcfg_kwslisten_proxiespxerrfindproxysrc/proxy.cpause_proxypause_proxiescursrvdata_leftresync_responsebuffer_shutr_nowbuffer_forwardbuffer_check_timeoutsuxst_req_analyser_statsunix_sock_usagedestroy_uxst_socketerr_renamebuffer_shutw_nowout_free_requnix_sock_usage_msgcreate_uxst_socketbuffer_write_distempnameuxst_bind_listenerserr_returnuxst_add_listeneruxst_unbind_listenersbacknameuxst_process_sessionbuffer_install_hijackerresync_requestunix_sock_parse_request__uxst_protocol_initresync_stream_interfacefuncerr_unlink_backuxst_event_acceptresyncrpf_lastbuffer_flushuxst_bind_listenerrqf_lasterr_unlink_tempproto_unixsrc/proto_uxst.cuxst_unbind_listenerfinsthttp_msg_invalidhttp_server_errorsess_set_cookiehttp_is_lwsold_idxmanage_client_side_appsessionhttp_msg_oodhttp_msg_rpbefore_crbuffer_abortdone__tv_isgehdr_idx_set_starthttp_msg_rpreasonhdr_begfind_cookie_value_enddebug_hdrHTTP_200delimcmp_lenhttp_msg_last_lfapply_filter_to_req_headershttp_msg_hdr_namehttp_method_desclog_lenhttp_get_pathacl_fetch_shdratt_begret_ptrapply_filter_to_resp_headersret_statepreserve_hdrprocess_responseatt_endacl_fetch_stcodeacl_fetch_chdracl_fetch_shdr_ipbuffer_stop_hijack__http_protocol_initmsg_fmtlast_hdrreturn_prx_condHTTP_301http_methodsend_check_maybe_wait_for_bodyhttp_header_add_tail2http_msg_req09_urihttp_msg_rpbeforetmplineacl_fetch_stverval_begacl_fetch_shdr_valbuffer_set_rlimhttp_msg_rpversess_cookiedel_frompathlenquotedhttp_msg_rpline_eolacl_fetch_chdr_ipacl_fetch_hdr_valhttp_msg_rqmethqdpairhttp_msg_rqvernext_paramhttp_capture_bad_messagestats_check_uri_authreturn_hdrhttp_msg_hdr_l2_lfhttp_parse_stslinehttp_is_crlfcur_endacl_fetch_urldel_hdr_valueapply_filter_to_req_lineis_cookie2acl_parse_verhttp_sess_loghttp_is_ctlmanage_client_side_cookieshdr_ctxproduce_contentfind_hdr_value_endcheck_response_for_cacheabilityhttp_body_endhttp_msg_req09_veracl_fetch_chdr_cntapply_filter_to_sts_linesrv_inc_sess_ctrhttp_parse_reqlinemsg_bufhttp_find_headerserver_id_lenhdr_endhttp_msg_rqmeth_spcur_hdrhttp_msg_analyzerhttp_msg_hdr_valsessid_tempother_endacl_fetch_rqvercur_nexthttp_msg_rqbefore_crvalue_lencur_ptracl_fetch_hdr_ipseparatorhttp_is_tokenauthenticatedhttp_find_header2end_paramshttp_200_chunkacl_fetch_url_iphttp_msg_rsp_reasoncur_idxhdr_idx_first_poshttp_msg_hdr_l2_lwshdr_nexthttp_msg_rpcode_spinit_proto_httpopaqueacl_fetch_shdr_cntrule_setfirst_paramreturn_srv_prx_502stripped_afterval_endhttp_process_requesthttp_msg_hdr_l1_lwshttp_msg_complete_headeracl_fetch_pathbuffer_erasehttp_msg_rqline_eolhttp_msg_rquriapply_filters_to_responseacl_fetch_hdr_cntcur_paramasessionreturn_bad_reqhdr_response_badapply_filters_to_requesthdr_idx_first_idxstripped_beforeperform_http_redirectnext_responsehttp_process_request_bodyvalue_beginacl_match_methhttp_return_srv_erroricaseurilenhttp_is_sepcapture_headershttp_msg_rqbeforefind_http_methhttp_msg_rquri_sphttp_is_sphthttp_err_chunkssrc/proto_http.chttp_msg_rpver_spHTTP_401_fmthttp_msg_hdr_l1_lfhttp_header_match2get_srv_from_appsessionacl_parse_methhttp_msg_rpline_endhttp_msg_rqline_endhttp_process_tarpitequalmsgnumhttp_header_add_tailhttp_msg_rpcodenext_hdracl_fetch_url_porthttp_msg_hdr_firstacl_fetch_methmanage_server_side_cookieshdr_encode_mapacl_fetch_chdr_valhttp_err_msgsurl_encode_maphttp_is_ver_tokenhttp_msg_req09_uri_eacl_fetch_hdrprevprst_rulehttp_msg_hdr_l1_spreturn_bad_resperror_messagecur_proxystream_sock_readtick_issetread_pollstream_sock_chk_rcvstream_sock_shutrout_may_wakeupout_shutdown_rspliceoff_insrc/stream_sock.cstream_sock_data_finishlast_lenstream_sock_splice_instream_sock_shutwstream_sock_chk_sndwrite_pollfdoutoff_outstream_sock_write_loopstream_sock_writecur_readfdinsrc/appsession.cappsession_cleanupinitializedhtblelementkey1ses_msizeidlenappsession_initkey2appsess_refreshappsession_refreshtemp1temp2appsession_task_initser_msizenew_staterequeue_serversacl_fetch_connslotsupdate_backend_weightconnect_serverget_server_hhstepinit_server_mapavoididxget_server_rr_with_connsfwrr_get_srv_initfwrr_init_server_groupsfwlc_set_server_status_upold_stateacl_fetch_fe_sess_ratefwrr_get_srv_downmap_set_server_status_downfwrr_set_server_status_upout_update_backendget_server_phnode2slashesbestfwrr_get_server_from_groupconn_erracl_fetch_queue_sizeprev_nextfwlc_srv_repositionget_server_uhbe_downtimeredispatchfwrr_queue_srvmay_dequeue_tasksassign_server_and_queueacl_fetch_avg_queue_sizemap_set_server_status_upfwlc_set_server_status_down__backend_initfwrr_get_srvfwrr_queue_by_weightfwlc_dequeue_srvfwrr_remove_from_treefwrr_set_server_status_downout_update_stateplenacl_fetch_be_sess_ratedohashget_server_ph_postfwlc_get_next_serveracl_fetch_be_connsrc/backend.cfwlc_queue_srvavoidedfwrr_update_server_weightfwlc_remove_from_treeiteratorswapfwlc_update_server_weightfwrr_get_srv_nextconn_slotget_server_shsrv_redispatch_connectfwlc_init_server_treeswitchednewidxinit_headfwrr_update_positionsrvtoavoidfwrr_dequeue_srvfwrr_get_next_serverassign_serverfwrr_switch_treesrecalc_server_mappgcdacl_fetch_fe_connbackend_parse_balanceassign_server_addressacl_fetch_nbsrvrecount_serverssrc/stream_interface.cstream_int_returnstream_int_check_timeoutsstream_int_retnclosestream_int_report_errorsection_typesrc/dumpstats.cultoaprint_csv_headercurpxstats_dump_sess_to_buffernewlinestats_dump_httpcurr_sess__dumpstats_module_initstats_dump_raw_to_bufferstats_dump_rawstats_dump_proxynewptrtask_in_rqstats_parse_globaldump_error_linestats_dump_errors_to_bufferpartialacl_fetch_req_ssl_verproto_tcpv4tcpv4_add_listenertcp_bind_listeneru_int16_tacl_fetch_req_lenchlencilenfporttcpv4_bind_socketsilen__tcp_protocol_inittcp_close_returntcp_bind_listenerslocalmsg_lennot_ssltcp_inspect_requestproto_tcpv6tcp_parse_tcp_reqin_tproxysrc/proto_tcp.c_in_argstcpv6_add_listenerfaddrtcp_ruleu_int32_ttoo_shorttcp_returnbind_addrforeign_okwarnip_transp_workingbleftitp1itp2in_tproxy_addrretlendefault_srv_errorsession_process_counterssess_set_term_flagssess_update_stream_intsess_update_st_con_tcpsess_prepare_conn_reqsession_freesess_change_serverinit_sessionsess_establishsess_update_st_cersrc/session.chdr_idx_addsrc/hdr_idx.cfd_set_bytes_do_poll__fd_cond_cfail_srevt__fd_is_set_do_test__fd_remwritenotnull_do_termfail_revtdelta_ms__fd_setsrc/ev_select.c__fd_clrfd_evts_do_initfail_swevtfail_wevt_do_registertmp_evtsreadnotnull__fd_cond_sold_sig__sigset_t__signal_process_queuesignal_descriptorsrc/signal.csignal_handlercur_pos__valsignal_statesignal_queueblocked_sigsignal_registersignal_initfilt_capcond_resout_free_acl_exprexprbacl_fetch_nothingacl_parse_ipout_free_termfind_acl_by_namesrc/acl.ctermsmay_matchacl_parse_reg__acl_initaclkwprune_aclpatflagsfree_pattern_listacl_fetch_falseacl_match_dircond_find_requireacl_keywordsold_charcur_termkwenddefault_acl_listout_free_expracl_match_domacl_free_regprune_acl_condacl_match_ipacl_term_suiteacl_nameacl_match_endnew_stracl_match_nothingout_returnacl_parse_stracl_match_subacl_parse_dotted_verparse_acl_expracl_match_regacl_termacl_parse_intacl_fetch_truefind_acl_kwacl_register_keywordsacl_resout_free_suiteknown_aclparse_acl_condacl_unregister_keywordsparse_aclcur_suiteacl_exec_condtmp_suitefetch_nextacl_parse_nothingfind_acl_defaultarg2out_free_nameacl_match_begmatch_wordsuite_rescur_aclprune_acl_exprout_free_patternacl_match_intacl_fetch_wait_endacl_match_strtmp_termrecursecreate_poolnbpoolspool_destroy2dump_poolspool_flush2pool_refill_allocsrc/memory.cpool_gc2freq_ctr_remainnext_event_delaysrc/freq_ctr.cmul32hifreqpastread_freq_ctreb_trooteb_dotagnew_leafnew_leftgpsideeb_untagsrc/ebtree.ceb_root_to_node__eb_insert_dupdelete_unlinkeb_gettagnew_rght__eb_deletegparentsibtypesrc/eb32tree.c__eb32_insert__eb32_lookupold_leaf__eb32i_lookupeb32_lookup_geold_nodenewkey__eb32i_insertflsnzroot_rightsrc/cttproxy.ccheck_cttproxy_versionreventssrc/ev_poll.cpollfdwait_timefail_penbfdepoll_waituint64_t_do_forkepoll_eventepoll_createfail_eealloc_chg_listdmsk2eventfail_fdepfdnbchangesfail_fdevtfd_flush_changes__fd_cloopcodeold_evtepoll_fdfd_chgepoll_ctlfail_chg_listsrc/ev_epoll.cfail_chg_ptrepoll_eventsdmsksrc/ev_sepoll.cabsmaxeventsalloc_spec_entryre_poll_oncenbspecspec_processedfail_fd_listspec_idxspec_listfail_specloopinglast_skippedfd_statusrelease_spec_entryswitch_statefd_createdDWstructlong double__udivdi3USItypefloat__udivmoddi4DWunion__cbtmpUDItype/var/flx-toolchain-0.5.0/source/gcc-3.4.6/gcc/libgcc2.c__umoddi301.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.0101.01BT h r S a  l ] x P' I Pl t Xi  EHKSt~5V0GGfB|PSYx#1E&0<j@GmpsypsyTsuIA C P c q s | Ni$,68BG^ 4vAFchQY^h T }F2     W |   5`0{)KN\FW\_QVsaiG  Q"!#"-"!%!)""E!"&&r%%*%O%r#$D//%&/n0&&%%/n0&&%%'*n01*++,%,&.\ll_ee!KPKJJJHIDHHfBB=>1,1.D/2222x4444<56l pf\lddM.NGHY==<<788$9Q9;:>:::<d_ePKKJ!KIJJHHHDH==<Y=AfBef LBLDEGGFTGMMMuMF GMMOQPБ+ papTa{P*Sapp"QqQQQPRrRRRuRRySTŖU:VYZZW XVW$W.WVW$W.W[[aa`a!`^`[/\Y\\\],]c]~]_+uF]Q^F^^,^3^^*^+_h__!`h__aafgjkiiffffgikpkijgh h)h'mmmmmnnnaooooqqpqqqrp̘rrrsv,wsss}t,wwtttmuwwuuuuvǂvvwzxБǏXxyϐyyzz{{{{H|]|} }}}E~M~~~np`y܂̓pӄyʊϊՊފՋǏϐ"~+\Ŗ̘ٚVPHJ<.׭ 8ȨШƨE\iZ]`f~׭ ׭  efl[ K % 0 P X [ U k  a h p % K vfJ,hk,G  7 e ;&9ms9P~ms9P~&7  P PcCIcyfyac 0J  J]I O 0] p U W y&]nqv~  D 0&%B _ ] i U W H T o    V \ $Z"+AAINd~~@Sf&+>  O R ) L !!!!!!!!!!!!!!!!#C$h$&((()((* +!+$++++++,",Y,,,..,,(.;.y--;.u.@000 812o7711o7711K22I5^52 3^55222 323w333}33O3R333m3w3_3g3347 86655 55$5455!5666666666o777,7/7_7o7W7\7O7Q7D7G797<7999999999999999999j<<<<4=?uFFF@hE>@? E.E>> EE>>g??uFFUEhELBBB8B?>@FSGhEuF%A*A;AFA,A4AAAAAAABBUEhE3C6CjCsCUC^CICOC)DD.EUEcDfDDDDD~DDDDDDDDDDDDDDhEZFFGGbFuFhEEFFEEbFuFEEEEGGFFCIHISIYILINII"MARW,M2RJ"M4NbNrM*NKLrM*NMMMMMMMM NNNNMMOOOOOOPnQ>VVYYp-pjoon(omnjllllhhIggd!f5a9bz``Y_YYp-pYYYYmnllhhggd!fb9b@\o]2\6\YYmnllhhggd!fb9bz\o]Z[ab5aa]^joo]]joo]^``9bEb)`z`[ddqQrpq]ppoo1e!fmnllhhkeemnfIgnn.hhmmi5j-p]pppi1j-p]p5jPjoojjknCnl*mnn]pppq7z:z@zSzV2 _- `  bv] _ c kmq-k 7 `xNNb 3s!(3!(xH`V$%x,,<+f+`*4++*=*H)t)'',,f+v+4+<+)H)'(''\,x,t)+*00110011013333o3|32T33333!).EU8^ .=UMUEM#.rD 3  r{_03Gv!"%%K%r%"&%%& & &s&m'*(-'*')z,,)*))''z,,)*')''''''*z,,(- 04<@b  Z    )  IRUW Z r y _ W   )  [aiJ |;>f}f|0B ] 369?69?Bqxqx0?0?+ > + > P Y k z P Y k z & 1 4 6 r #%#),4 !)V)V '_e'Kip+v#+>>5D,.%W\_ .1xz{pAI70Dqw`a=D18)r,kWk.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.eh_frame_hdr.eh_frame.ctors.dtors.jcr.dynamic.got.got.plt.data.bss.stab.stabstr.comment.debug_aranges.debug_pubnames.debug_info.debug_abbrev.debug_line.debug_frame.debug_str.note.debug_ranges44#HH 1hh07 ?(( `GoTo\\@c 8l ԏ u%pԒ{<DDU``U \\'xx't'<(((00(44(()x*\ 6 6 TQeEF@ֻ Tm-H #941 eF0Ԗ KQ W + e `8'v M /04Hh(\ԏ  Ԓ  D `\x(04 !"#$%&' (/Ę >I/Ę Ę (0   $!,.<0H  >^/D   (H5 (2=H`nMRWags,$08 2   &d1 >tDGhR[dj u  0 6 @L -  `0  S *0J 8| F`{ V f t|4 Y  T T   '0o\ 6oD Eoo TPpA bpY rqY `qe q: rs rv sE tE uE PwE t? u? .@v? Aw? Swd bp a @  s Pt_ @u v Px xA &3 C Q _i y `  y y y   Q 3r Nn g`A  З"  0 c      7  F Y |e U x      @ +  | 0f T T  T t/ 6 C M W c `&$ o  w &  &  &5 '0 @'$ p'   * *L 0+  @+  x -  0.  .0 % 2 @1\ = 3  J ;L W `;a f 0D q z          c N$ o $ w O  @O  `O5 O0 O$ PR `R S@ PS  `S  ,  0  4   S' c T" o 8  PT  D   @ % @U? w UU UX @VM 4 VK V = <  X- Y Z( J Z2 [ S _ P g T q X x \  `  [' [J 0\P c \2 w \t @]c ] 4 ] d  h  ]  p = l  t   c  d e( J @e2 e    0f f   g" , 0g" B Tg< R gk f h m /h y ~ H /l ` 8     l/ Ln| n lo *o> ;! D/ S/ _/ m/ F /  -= b  C ^ #; /s EO M}h^ j |K  9X* @?  `( H "` 'E 1d <1H5 Y2 _hй H@ . ` ; :@ h1 8p # .@ =O@ X? i @h xP1  < E\ Yg; 7 ; 46  ;  :I H@ Op VM ^  t/4M  @   P 2 - t &5 4`N KPV" fS r0) =H@ T v  ? 8< 0P "6 (79 If- \@- s`zM  I_  Th/  ^//D "N /P AS`3 \@5 e` s Y 0 ' @v D7@@ 5 ' A0 J( XP%p j( GF 4? IP&D `w 10K  !pxC (PB 6g  B Of W,t g  w`z  5  1 0 $p.  @@ ' 2PO GY@ c/X q0 ~p- 0C  x {x 0e :I   ;`J )@+ 5 G:[ ly@44 Z 3 1  :k GS D  P < %57`U GY= i@R v/p  9  н_ 1 0 ?  7 5PP ?` C V ex:   = &  ;0)3 pQ (: @.c Nu bE p:p: `Z  < p+i  p  : $9 ::P` [3l rT}BV @ 0 '  .2 -7; *0" 9AI Yb{ y0?   2m  / D 8 7 C  07  7- G : 0 C W  m `.   p 7  0) 3 @z P   Q v !% !$< "!?!3= M!E4 Y!M f!m! !! !4G !@ !9+ !@ !4 !p "H "{ %"`= -" = C" Y" c"} q"+C }"9 "="O""@ "P "" #P@$#0.# @#M#C; _# n#i v#; #) ##0  #` #C #PH #\ #0 $J $"$24$1 R$o$6 $@D $W $hj $6. $,$9 $A $d %p %pS *% >%@ K%3d Y%S a%x%+ % %%,) %8h %3%* %:&  &8)&D /&#@&0 I&q[& r&& & >&c&:&&t&L &@< X&X'h ' 'L{ *'0 3';K'pO'Ph g'bx'3' ''='  ' 'p  ': 'H'' ((1(0FQ ?(^U(@  ^(Ss(Kn (0 (9 (5((((U ((+ ) \ ){ *) ?) Q)0D ^)@} l)Q})@' ) )@p )P3) ))@ )))t)hM ): *< *pF6 !*p  :*=c D*PI T* j*h|*@a **A*u*j *:*+W +5 #+ 0+Q C+A V+a+> g+w++> <+++F +P8 + +p ++= ,,L#,0D ;,`M K,i, q,Y |,=,7 ,d,F ,PGO ,`: ,;,p# -F -м" -@# 2-   C-P` X-   c-Dx- , -:-i -/--. -0g -0 -> P-.{ .D#.:5. I.Tq ^.@ l.|.@<.`.  ..m .3 .@. .P.  .P . .`* /9 !/ ./=>/G/0 V/3 h/0r/\ /g /@ / /< /p$ / /h0 07%0 abi-note.S../sysdeps/i386/elf/start.Sinit.cgcc2_compiled.initfini.c/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crti.Scall_gmon_startcrtstuff.c__CTOR_LIST____DTOR_LIST____JCR_LIST__p.0completed.1__do_global_dtors_auxframe_dummy__CTOR_END____DTOR_END____FRAME_END____JCR_END____do_global_ctors_aux/var/flx-toolchain-0.5.0/i586-flx-linux/build-i686-host-linux/glibc-2.2.5/csu/crtn.Shaproxy.cnb_oldpidsoldpidscfg_nbcfgfilescfg_cfgfileoldpids_sigtell_old_pidssessionhash.cbase64.cprotocols.cprotocolsuri_auth.cstandard.csu.2sa.1sa.0buffers.clog.clogfdunix.0logfdinet.1tvsec.2logmsg.3dataptr.4task.ctimersrqueue_ticksrqueuetime.ctv_offset.1rv.0fd.cpipe.c__pipe_module_initregex.ccfgparse.ccfg_keywordscfg_opts2cfg_optscursectionstr2listenerdefproxycurproxy.0server.cchecks.cset_backend_downredistribute_pendingcheck_for_pendingset_server_downset_server_upset_server_disabledset_server_enabledevent_srv_chk_wevent_srv_chk_rqueue.cclient.cacl_kwsacl_fetch_sportacl_fetch_srcacl_fetch_dstacl_fetch_dportacl_fetch_dconn__client_initproxy.ccfg_kwsproxy_parse_timeoutproxy_parse_rate_limit__proxy_module_initproto_uxst.cproto_unixuxst_bind_listenersuxst_unbind_listeners__uxst_protocol_initproto_http.cacl_parse_methacl_fetch_methacl_match_methacl_parse_veracl_fetch_rqveracl_fetch_stveracl_fetch_stcodeacl_fetch_urlacl_fetch_url_ipacl_fetch_url_portacl_fetch_chdracl_fetch_chdr_cntacl_fetch_chdr_valacl_fetch_chdr_ipacl_fetch_shdracl_fetch_shdr_cntacl_fetch_shdr_valacl_fetch_shdr_ipacl_fetch_pathhttp_err_msgshttp_server_errorfind_http_methhttp_get_pathtmpline.0acl_fetch_hdracl_fetch_hdr_cntacl_fetch_hdr_valacl_fetch_hdr_ip__http_protocol_initstream_sock.cstream_sock_write_loopappsession.cappsess_refreshinitialized.0initialized.1backend.cacl_fetch_nbsrvacl_fetch_connslotsacl_fetch_fe_sess_rateacl_fetch_be_sess_rateacl_fetch_fe_connacl_fetch_be_connacl_fetch_queue_sizeacl_fetch_avg_queue_sizerecount_serversupdate_backend_weightmap_set_server_status_downmap_set_server_status_upfwrr_set_server_status_downfwrr_queue_srvfwrr_set_server_status_upfwrr_update_server_weightfwrr_get_srvfwlc_srv_repositionfwlc_set_server_status_downfwlc_set_server_status_upfwlc_update_server_weight__backend_initstream_interface.cdumpstats.cstats_parse_globalsrv_hlt_st.0srv_hlt_st.1__dumpstats_module_initproto_tcp.cacl_fetch_req_lenacl_fetch_req_ssl_vertcp_parse_tcp_reqproto_tcpv6tcp_bind_listenersproto_tcpv4ip_transp_working.0__tcp_protocol_initsession.chdr_idx.cev_select.c__fd_is_setfd_evts__fd_set__fd_clr__fd_cond_s__fd_cond_c__fd_rem_do_polltmp_evts_do_init_do_term_do_test_do_registersignal.cacl.cacl_fetch_trueacl_fetch_falseacl_fetch_wait_endacl_keywordsmatch_wordacl_free_regfree_patternprune_acl_expr__acl_initmemory.cpoolsrecurse.0freq_ctr.cebtree.ceb32tree.ccttproxy.cev_poll.cpoll_eventsev_epoll.cchg_ptrchg_listnbchangesdmsk2eventepoll_createfd_flush_changesevepoll_fdalloc_chg_list__fd_cloepoll_events_do_forkev_sepoll.cfd_listspec_listnbspecfd_createdabsmaxeventsalloc_spec_entryrelease_spec_entrylast_skipped.0spec_processed.1libtcpsplice.csockfdkruletcp_splice_inittcp_splice_closetcp_splice_cmd_splice_inittcp_splice_cmd_splicetcp_splice_talkmodprobe_tcp_spliceLetextpcreposix.ceintpstringpcre_compile.cescapesposix_namesposix_name_lengthsposix_class_mapserror_textsdigitabcheck_escapeis_counted_repeatread_repeat_countsfirst_significant_codefind_fixedlengthfind_bracketfind_recursecould_be_empty_branchcould_be_emptycheck_posix_syntaxcheck_posix_nameadjust_recurseauto_calloutcomplete_calloutcompile_branchcompile_regexis_anchoredis_startlinefind_firstassertedcharpcre_exec.crep_minrep_maxmatch_refmatchpcre_globals.cpcre_info.cpcre_tables.cpcre_try_flipped.cbyteflippcre_chartables.clibgcc2.c__dso_handleunix_sock_usageenable_all_listenersinit_server_maptcpv4_bind_socketprotocol_bind_allwarnif_misplaced_reqaddbe_downtimehttp_header_add_tail2str2sundefault_acl_listpause_proxyhttp_msg_analyzersigfillset@@GLIBC_2.0recalc_server_maphttp_methodspool2_pipestream_int_report_errorurl_encode_maplog_facilitiesgetgrnam@@GLIBC_2.0get_server_hhpcre_compile2dumpdebug_hdr_tv_remainsess_cookieget_log_facilityishexprognamestats_check_init_uri_authchown@@GLIBC_2.1signal_queuehttp_return_srv_errorappsession_task_initrename@@GLIBC_2.0find_acl_by_nametcp_splice_splicefdhttp_is_sphtprotocol_unregisterhuman_timetv_update_datestrchr@@GLIBC_2.0sessionsfind_acl_defaultprune_acl_condwarnif_rule_after_redirectactconnpool_refill_allocfdopen@@GLIBC_2.1tcp_splice_startwarnif_rule_after_reqxxxpool2_taskhttp_is_ctlhttp_is_lws_tv_ms_cmpnowpid__ctype_tolower@@GLIBC_2.0eb_insert_dupapoolsurl2sadestroyinit_default_instancegetpid@@GLIBC_2.0_DYNAMICeb32_lookup_gerun_queuebuffer_insert_line2sess_update_stream_intsoft_stopbuffer_write_chunkacl_match_domstream_int_check_timeouts__task_wakeupget_log_levelcheck_cttproxy_versionpipes_usedproduce_contentchain_regexappsession_initwrite@@GLIBC_2.0poll@@GLIBC_2.0uxst_req_analyser_statsstart_checksprocess_chkhttp_err_chunkscurr_sec_msstrcmp@@GLIBC_2.0ulltoh_r_pcre_utf8_table1_sizeusageclose@@GLIBC_2.0process_sessiontcp_splice_getinfo__signal_process_queue_fp_hwinet_pton@@GLIBC_2.0http_parse_reqlinefindproxy_modeeb32_inserthttp_capture_bad_messagetcp_splice_initfdtrashfprintf@@GLIBC_2.0fork@@GLIBC_2.0signal_queue_lenchunk_printfstream_sock_shutwsignal@@GLIBC_2.0strl2uicitoa_strencode_stringfflush@@GLIBC_2.0stats_dump_rawstream_int_returnstr2uiappsession_hash_removesetrlimit@@GLIBC_2.2unlink@@GLIBC_2.0_pcre_default_tablessess_term_condhdr_encode_mapstoppinghttp_process_request_body_tv_isgtinit_pendconndefault_srv_errorapply_filters_to_requestfreq_ctr_remainlistenersselect@@GLIBC_2.0apply_filter_to_req_line_tv_remain2vsnprintf@@GLIBC_2.0strerror@@GLIBC_2.0buffer_dumpcfg_unregister_keywordsspliceacl_exec_condvod_versionwarnifnotcapstrl2icsignal_registerbuffer_replace2findserverhostnamesess_set_cookieassign_server_and_queueparse_time_errhextab__errno_location@@GLIBC_2.0acl_match_nothingstats_dump_httpsetgid@@GLIBC_2.0pool2_appsesslog_levelsappsession_hash_initmemchr@@GLIBC_2.0__umoddi3acl_match_begpendconn_addlimit_rprotocol_enable_allpendconn_get_next_sessstrl2llrcstream_sock_shutracl_match_endaccept@@GLIBC_2.0_tv_add_ifset__udivdi3chmod@@GLIBC_2.0appsession_refreshinit_bufferhttp_find_header2shutdown@@GLIBC_2.0maintain_proxiesrelative_pidacl_parse_intputs@@GLIBC_2.0_initdisable_listener_tv_ms_cmp2stream_sock_writelisten@@GLIBC_2.0stats_set_urinext_event_delaysignal_statedisplay_versionstart_datemalloc@@GLIBC_2.0unbind_listener_pcre_utf8_table1delete_listenersrv_getintersetsid@@GLIBC_2.0srv_dynamic_maxconn_pcre_uttmanage_server_side_cookiesprocess_srv_queuewarnif_rule_after_blocknb_tasksinit_sessionreadcfgfilepipe@@GLIBC_2.0fwrr_init_server_groupsinit_tasksess_update_st_con_tcpstats_add_authmemmove@@GLIBC_2.0sendto@@GLIBC_2.0print_csv_headerexp_replacebackend_parse_balanceparse_aclmatch_strperform_http_redirectlink@@GLIBC_2.0manage_client_side_appsessiontcpv6_add_listeneracl_unregister_keywordsacl_match_strsess_set_term_flagserror_messagegetsockopt@@GLIBC_2.0display_build_opts_tv_ms_remainnow_msstdout@@GLIBC_2.0find_cookie_value_endstderr@@GLIBC_2.0abort@@GLIBC_2.0strl2ircwake_expired_tasks_tv_ms_elapsedacl_register_keywordssetsockopt@@GLIBC_2.0_tv_ms_le2execv@@GLIBC_2.0Alertpipes_livevfprintf@@GLIBC_2.0find_hdr_value_endpcre_mallocstats_set_desccfg_parse_listencheck_config_validitywaitpid@@GLIBC_2.0acl_match_dirunix_sock_usage_msgparse_acl_exprsig_dump_statetime@@GLIBC_2.0stats_add_scopeHTTP_301warnif_misplaced_blockpool2_pendconnsig_soft_stop_startacl_match_intstrlcpy2pool_gc2fgets@@GLIBC_2.0_pcre_utf8_table3proxy_cap_strprotocol_disable_allapply_filter_to_sts_linechdir@@GLIBC_2.0str2sa_rangea2base64__fxstat@@GLIBC_2.0assign_server_addressacl_fetch_nothingbuffer_writehttp_is_crlfstrlen@@GLIBC_2.0strl2uihttp_is_token_tv_ms_addtcp_sess_logassign_serveruxst_add_listenersess_update_st_cerhdr_idx_addtotalconn__strtol_internal@@GLIBC_2.0acl_parse_strpool_flush2eb32i_lookupglobaluxst_event_accept__ctype_toupper@@GLIBC_2.0check_replace_stringapply_filter_to_resp_headerspool2_requriacl_parse_ipbuffer_replaceqfprintfinitdeinit_pollerssess_change_server_tv_adddisable_all_listenersfwlc_init_server_treesig_pauserun_poll_loopsignal_initinit_proto_httphttp_200_chunksigprocmask@@GLIBC_2.0strncmp@@GLIBC_2.0pool2_captureget_server_ph_postfputc@@GLIBC_2.0stats_dump_sess_to_buffer_pcre_utf8_table4monthname_pcre_utf8_table2cfg_maxpconncond_find_requirestats_set_noderegcomppool2_bufferpcre_compile__bss_startcheck_response_for_cacheabilitymainprotocol_unbind_alleb_deletetcp_inspect_requestappsession_cleanupdisable_pollerHTTP_401_fmthttp_is_ver_tokenwarnif_rule_after_use_backend__libc_start_main@@GLIBC_2.0_pcre_try_flippedcreate_poolappsession_hash_lookupregexecacl_parse_dotted_verlocaltime_r@@GLIBC_2.0stats_dump_raw_to_bufferfork_pollerfindproxyunix_sock_parse_requeststop_proxyhttp_process_tarpit__task_queueacl_parse_regultoa_rsslv3_client_hello_pktdel_hdr_valuedata_startrun_queue_curmanage_client_side_cookiestcp_splice_stopprintf@@GLIBC_2.0stats_dump_errors_to_bufferbind@@GLIBC_2.0connect_servergetuid@@GLIBC_2.0_finifcntl@@GLIBC_2.0get_pipememcpy@@GLIBC_2.0process_runnable_tasks_pcre_utt_sizelist_pollersHTTP_200fclose@@GLIBC_2.1getsockname@@GLIBC_2.0strrchr@@GLIBC_2.0zeroblocked_sigpollers__strdup@@GLIBC_2.0regerrorhttp_header_add_taileb32_lookup_tv_islegettimeofday@@GLIBC_2.0onewarnif_misplaced_reqxxxsrand@@GLIBC_2.0snprintf@@GLIBC_2.0start_proxiesgethostname@@GLIBC_2.0open@@GLIBC_2.0http_header_match2proxycapture_headerssrv_downtimefdtabstats_set_flagniced_tasksgethostbyname@@GLIBC_2.0pool_destroy2strcasecmp@@GLIBC_2.0send_loginet_ntop@@GLIBC_2.0eb32i_insertacl_match_subapply_filters_to_responsehttp_is_seppcre_stack_mallocgetpwnam@@GLIBC_2.0http_sess_logexit@@GLIBC_2.0http_find_headerstats_set_realmstats_dump_proxystream_int_retnclosecalloc@@GLIBC_2.0invalid_charpendconn_free_pcre_OP_lengthsstr2uicstr2sainit_pollersacl_match_ip_edataparse_acl_cond_IO_putc@@GLIBC_2.0_GLOBAL_OFFSET_TABLE_free@@GLIBC_2.0_endsend@@GLIBC_2.0dateprocess_responsesession_process_countersprune_aclenable_listenercfg_register_keywordsmemset@@GLIBC_2.0srv_redispatch_connect__ctype_b@@GLIBC_2.0base64tabstrncasecmp@@GLIBC_2.0stream_sock_chk_rcvconnect@@GLIBC_2.0stdin@@GLIBC_2.0stream_sock_chk_sndpause_proxiesnb_tasks_curtcpv4_add_listenerinvalid_domaincharlast_timermaxfdpcre_stack_freepcre_freecur_pollerHTTP_302strncpy@@GLIBC_2.0get_server_phput_pipeproxy_cfg_ensure_no_httpsession_freepcre_calloutunbind_all_listenersfopen@@GLIBC_2.1pipes_freeget_srv_from_appsessiontcp_splice_info__strtoul_internal@@GLIBC_2.0Warningmy_strnduphttp_err_codeswarnif_rule_after_reqadd_IO_stdin_useddump_poolsread_freq_ctrfind_acl_kwkill@@GLIBC_2.0apply_filter_to_req_headerskill_pipestats_set_refreshprotocol_registercfg_parse_globaluxst_process_sessionsig_listengetrlimit@@GLIBC_2.2signal_handlerrecv@@GLIBC_2.0regfreesprintf@@GLIBC_2.0fwrite@@GLIBC_2.0acl_match_reglisten_proxieshttp_parse_stslinepmatch__data_startstream_sock_readnbpollerssocket@@GLIBC_2.0_Jv_RegisterClasseshttp_process_requestpool2_sessionrand@@GLIBC_2.0filt_capcfg_maxconnfd_deletesess_fin_stateget_frt_addrstr2netsetuid@@GLIBC_2.0deinitacl_parse_nothingurl2ippcre_execproxy_mode_strappsession_hash_insertevent_acceptread@@GLIBC_2.0HTTP_303sess_establishappsession_hash_fnext_pxid_tv_ms_remain2appsession_hash_destroyhave_appsessiontcp_bind_listenercurr_sec_ms_scaledstats_check_uri_authstream_sock_data_finishnolinger__gmon_start__chroot@@GLIBC_2.0pcre_info